2FRAA

Human cathepsin s with cra-27934, a nitrile inhibitor
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
217
structure length
217
Chain Sequence
LPDSVDWREKGCVTEVKYQGSCGACWAFSAVGALEAQLKLKTGKLVSLSAQNLVDCSTEKYGNKGCNGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYDSKYRAATCSKYTELPYGREDVLKEAVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSWGHNFGEEGYIRMARNKGNHCGIASFPSYPEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Human Cathepsin S with CRA-27934, a Nitrile Inhibitor
rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords cathepsin S
total genus 66
structure length 217
sequence length 217
chains with identical sequence B
ec nomenclature ec 3.4.22.27: Cathepsin S.
pdb deposition date 2006-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2fraA00
1PIPA 3B79A 4FIPA 2CB5A 1PXVA 1CJLA 4QRGA 2DCDA 2Y6EA 3PDFA 3H89A 2YJCA 2HD5A 4X6HA 1AYWA 3IUTA 4YYRA 2HXZA 1CPJA 2AYOA 2DJGB 4ZUXU 1KFUL 4QRVA 3LXSA 2WBFX 3QJ3A 1POPA 3PBHA 1KHPA 4CDDB 1MDWA 4CDEB 3I3TA 2AUXA 2AVWA 4FK5A 3USVA 5A24A 2R9MA 3MHHA 4X6IA 1YT7A 3S3RA 3H6SA 2XU3A 1YK8A 3WXEA 3RVVA 4YYWA 4YVAA 1U5IA 2Y5BA 4RY2A 4AXMA 4YYQA 1MIRA 3OVZA 4W5BA 4W4UA 2F1GA 1QXPA 3GCBA 3QT4A 1F2CA 2C0YA 3IMAA 1BQIA 4BS5A 1U9QX 3BOWA 4WA6A 5PADA 4BPVA 1HUCB 2PADA 4XR7A 3KSEA 3KKUA 2G7YA 2R9NA 5JA7A 4I07A 3OVXA 1F29A 3BPMA 3LFYA 4FJCA 1Q6KA 3E1ZB 1A6RA 4YV8A 3K24A 2R9FA 1CS8A 3KW9A 1BP4A 4YYUA 2PREA 3C9EA 2FO5A 2R9CA 1CB5A 1SP4B 3HD3A 4AXLA 2P0RA 7PCKA 1TL9A 1YK7A 2YJ9A 3IEJA 1QMYA 3F5VA 3OF8A 1TU6A 1XKGA 1F2BA 3D6SA 5F02A 4MZOA 3P5XA 3N3GA 4N4ZA 3I06A 4PADA 2B1NA 1MS6A 3M99A 1NL6A 3ERVA 1CVZA 1S4VA 4BSQA 1KFXL 1PBHA 1MEGA 3K8UA 1CV8A 2E00A 2AS8A 4X6JA 4I05A 3N4CA 3MHSA 1K3BB 4K7CA 4DMXA 2DJFB 2NQIA 1F2AA 3MTNA 2GHUA 2G8JA 2F7DA 1GECE 1MHWA 2JQGR 5J94A 1STFE 3V6EA 2GFOA 3WXFA 1U9XA 4KLBA 2DC6A 1ME3A 5EF4A 2DCCA 3U8EA 4P6EA 2FT2A 1AU0A 3CH2X 3S3QA 4I04A 2BDZA 1NB5A 1DF0A 2BDLA 1AYVA 1ICFA 3NHEA 3O0UA 3F75A 3AI8A 1GMYA 3RVWA 1JQPA 4Q8HA 2OZ2A 1NPZA 2FRQA 2ATOA 1DEUA 1O0EA 3IOQA 2R6NA 1AECA 1QOLA 2FQ9A 2E02A 1ATKA 5CHTA 3HHAA 2AUZA 1GCBA 2FRAA 2FTDA 4BS6A 5K16A 2E03A 5CHVA 2CIOA 1TLOA 1AU4A 3PNRA 1CSBB 2AU1A 2G8EA 2VHFA 5CVNB 3QSDA 1GLOA 2P7UA 1PPOA 1NLJA 1X9YA 3CH3X 1PPNA 1QDQA 3BCNA 3KX1A 2AIMA 1U9VA 4YYVA 1Y4HA 2DC7A 1NB3A 4Q8GA 1SNKA 4HWYA 1NQCA 4MZSA 1AYUA 4CDCB 4N79A 1EF7A 4QRXA 3H7DA 2NQDB 4YYSA 2IPPB 2JQFR 4MSXA 5CVOB 4PI3A 1EWLA 1KHQA 1PADA 2DCAA 1FH0A 1YALA 1ZIVA 2DZYA 2YJBA 9PAPA 4BQVA 3P5WA 1AU2A 2ARYA 1VSNA 1THEA 2DC9A 2H7JA 3OISA 2ACTA 2PNSA 3KWZA 3ZUAA 1EWOA 3BPFA 3RVXA 2IBIA 3P5VA 1PPPA 1PPDA 1BGOA 2DCBA 5FPWA 3O1GA 3H8CA 1BY8A 1ITOA 4CDFB 2HH5A 4QH6A 3CBKA 1EWPA 5EGWA 2OP3A 4QBBA 2VHSA 2O6XA 2FYEA 1EWMA 3BWKA 3KWBX 1M6DA 3OF9A 4OELA 2DC8A 3PW3A 3BC3A 5CVMA 1Y08A 3HHIA 2OULA 2AYNA 2G6DA 3DF0A 1MEMA 3HWNA 1PE6A 3IV2A 1KXRA 3CBJA 2R9OA 3WXGA 1PCIA 4CZWA 1IWDA 1U9WA 1CQDA 1AIMA 4PP1A 4XUIA 4G54A 3K9MA 2DZZA 2HHNA 3MORA 4P6GA 6PADA 2B1MA 2YJ8A 4OEMA 2YJ2A 3N3KA 3H8BA 4N8WA 1YVBA 3KFQA 8PCHA 2P86A 3V6CA 4DMYA 3IHPA 3P5UA 4W5CA 1AU3A 2FUDA 1ME4A 2PBHA 4PP2E 1VJVA 1CTEA 2E01A 2XU1A 2NQAA 2XU5A 2XU4A 2NQGA 3TNXA 5JH3A 1ZCMA
chains in the Genus database with same CATH superfamily
1PIPA 3B79A 4FIPA 2CB5A 1PXVA 1CJLA 2AGAA 4QRGA 2DCDA 2Y6EA 3PDFA 3W31A 3H89A 2YJCA 2HD5A 4X6HA 3BY4A 1AYWA 4OW0A 3IUTA 4YYRA 2HXZA 1CPJA 2AYOA 2DJGB 4ZUXU 1KFUL 4QRVA 3LXSA 2WBFX 4BOPA 3QJ3A 1POPA 3PBHA 1KHPA 4CDDB 1MDWA 4CDEB 3I3TA 2AUXA 2AVWA 4FK5A 3USVA 5A24A 2R9MA 3MHHA 3BBAA 4X6IA 1YT7A 3S3RA 3H6SA 2XU3A 1YK8A 3WXEA 3RVVA 4YYWA 4YVAA 1U5IA 2Y5BA 4RY2A 4AXMA 4YYQA 1MIRA 3E9SA 3OVZA 4W5BA 4W4UA 2F1GA 4IP3A 1QXPA 3GCBA 3QT4A 2BTWA 1F2CA 2C0YA 3IMAA 1BQIA 4BOSA 4BS5A 1U9QX 3BOWA 4WA6A 5PADA 4BPVA 1HUCB 2PADA 4XR7A 4R3DA 3KSEA 3KKUA 2G7YA 2R9NA 5JA7A 4I07A 3OVXA 1F29A 3BPMA 3LFYA 4FJCA 1Q6KA 3E1ZB 5JZEA 3BB7A 1A6RA 4YV8A 3K24A 2BU3A 2FE8A 2R9FA 1CS8A 3KW9A 1BP4A 4YYUA 2PREA 4GUAA 3PT2A 3O65A 3C9EA 4WURA 2FO5A 2R9CA 2J7QC 1CB5A 1SP4B 3HD3A 4AXLA 2P0RA 7PCKA 4IUMA 1TL9A 1YK7A 3PHXA 2YJ9A 3IEJA 1QMYA 3F5VA 4PT5A 3OF8A 1TU6A 3TMPA 1XKGA 1F2BA 3D6SA 5F02A 4MZOA 3P5XA 3N3GA 4N4ZA 5E6JA 3I06A 4PADA 2B1NA 1MS6A 3M99A 1NL6A 3PRMA 3ERVA 1CVZA 1S4VA 4MI7A 4RF1A 4BSQA 1KFXL 1DKIA 1PBHA 1MEGA 3K8UA 4P16A 1CV8A 3MP2A 2E00A 3B21A 2AS8A 4X6JA 4I05A 3N4CA 3MHSA 4XZXA 1K3BB 4K7CA 4DMXA 4D8EA 2DJFB 3PHWA 4BOQA 2NQIA 1F2AA 3MTNA 2GHUA 2G8JA 2F7DA 1GECE 1MHWA 2JQGR 4RF0A 5J94A 1STFE 4RNAA 3V6EA 2GFOA 3WXFA 4ZTBA 1U9XA 4KLBA 2DC6A 1ME3A 3OQCA 5EF4A 2DCCA 3U8EA 4P6EA 2FT2A 1AU0A 3CH2X 3S3QA 4I04A 2BDZA 1NB5A 1DF0A 2BDLA 1AYVA 1ICFA 3NHEA 3O0UA 3F75A 3AI8A 1GMYA 5EZQA 3RVWA 1JQPA 4Q8HA 2OZ2A 1NPZA 2FRQA 2ATOA 1DEUA 1O0EA 3IOQA 2R6NA 1AECA 1QOLA 2FQ9A 2E02A 1ATKA 5CHTA 3HHAA 2AUZA 1GCBA 2FRAA 2FTDA 4HXDB 4BS6A 4OVZA 5K16A 2E03A 1YZBA 4RKXA 5CHVA 2DOSA 2CIOA 1TLOA 1AU4A 3PNRA 1CSBB 2AU1A 2G8EA 2VHFA 5CVNB 2JTCA 3QSDA 1GLOA 2P7UA 1PPOA 1NLJA 3MTVA 1X9YA 3CH3X 1PPNA 1QDQA 3BCNA 3PRPA 3KX1A 2AIMA 1U9VA 3ZNHA 4YYVA 1Y4HA 2DC7A 1NB3A 4Q8GA 1SNKA 2HWKA 4HWYA 1NQCA 4MZSA 1AYUA 4A5UA 4CDCB 3RNVA 4N79A 1EF7A 4QRXA 3H7DA 2JRIA 2NQDB 4YYSA 2IPPB 3PHUA 2JQFR 4MSXA 4D8IA 5CVOB 4PI3A 1EWLA 1KHQA 1PADA 2DCAA 1FH0A 1YALA 1ZIVA 2DZYA 2YJBA 9PAPA 4M0WA 4BQVA 3P5WA 1AU2A 2ARYA 1VSNA 1THEA 2DC9A 2J7QA 2H7JA 3OISA 2ACTA 2PNSA 3C0RA 3KWZA 3ZUAA 1EWOA 3BPFA 3RVXA 2IBIA 3P5VA 1PPPA 1PPDA 1BGOA 2DCBA 2Z84A 3IFUA 5FPWA 3O1GA 3W30A 3H8CA 3MJ5A 3PSEA 1BY8A 1ITOA 4MM3B 4CDFB 2HH5A 4QH6A 3CBKA 1EWPA 4REZA 5EGWA 2OP3A 4QBBA 2VHSA 4BOZA 2O6XA 2FYEA 1EWMA 3BWKA 3KWBX 5EZSA 1M6DA 3OF9A 4OELA 2DC8A 3PW3A 3BC3A 5CVMA 1Y08A 3HHIA 2OULA 2BTWB 2AYNA 2G6DA 3DF0A 1MEMA 3HWNA 1PE6A 4D8BA 3IV2A 1KXRA 3CBJA 2R9OA 4OVZB 3WXGA 1PCIA 4CZWA 1IWDA 5KO3A 1U9WA 1CQDA 1AIMA 4PP1A 4XUIA 4G54A 3K9MA 3TRKA 1UKFA 2DZZA 2HHNA 3MORA 4P6GA 6PADA 2B1MA 2YJ8A 4OEMA 4BOUA 2YJ2A 3N3KA 3H8BA 4N8WA 1YVBA 3KFQA 8PCHA 2P86A 3V6CA 4DMYA 3IHPA 3P5UA 4W5CA 2UZJA 1AU3A 2FUDA 1ME4A 2PBHA 4PP2E 1VJVA 1CTEA 2E01A 2XU1A 2NQAA 2XU5A 2XU4A 2NQGA 3TNXA 5JH3A 1PVJA 1ZCMA
chains in the Genus database with same CATH topology
1PIPA 3B79A 4FIPA 2CB5A 1PXVA 1CJLA 4QRGA 2DCDA 2Y6EA 3PDFA 3H89A 2YJCA 2HD5A 4X6HA 1AYWA 3IUTA 4YYRA 2HXZA 4NV7A 1CPJA 2AYOA 2DJGB 4ZUXU 1KFUL 4QRVA 3LXSA 2WBFX 3QJ3A 1POPA 3PBHA 1KHPA 4CDDB 1MDWA 4CDEB 3I3TA 2AUXA 2AVWA 4FK5A 3USVA 5A24A 2R9MA 4GUZA 3MHHA 4X6IA 1YT7A 3S3RA 3H6SA 2XU3A 1YK8A 3WXEA 3RVVA 4YYWA 4YVAA 1U5IA 2Y5BA 4RY2A 4AXMA 4YYQA 1MIRA 3OVZA 4W5BA 4W4UA 2F1GA 1QXPA 3GCBA 3QT4A 1F2CA 4NV8A 2C0YA 3IMAA 1BQIA 4BS5A 1U9QX 3BOWA 4WA6A 5PADA 4BPVA 1HUCB 2PADA 4XR7A 3KSEA 3KKUA 2G7YA 2R9NA 5JA7A 4I07A 3OVXA 1F29A 3BPMA 3LFYA 4FJCA 1Q6KA 3E1ZB 1A6RA 4YV8A 3K24A 2R9FA 1CS8A 3KW9A 1BP4A 4YYUA 2PREA 3C9EA 2FO5A 2R9CA 1CB5A 1SP4B 3HD3A 4AXLA 2P0RA 7PCKA 1TL9A 1YK7A 2YJ9A 3IEJA 1QMYA 3F5VA 3OF8A 1TU6A 1XKGA 1F2BA 3D6SA 5F02A 4MZOA 3P5XA 3N3GA 4N4ZA 3I06A 4PADA 2B1NA 3LTWA 1MS6A 3M99A 1NL6A 3ERVA 1CVZA 1S4VA 4BSQA 1KFXL 1PBHA 1MEGA 3K8UA 1CV8A 2E00A 2AS8A 4X6JA 4I05A 3N4CA 3MHSA 1K3BB 4K7CA 4DMXA 2DJFB 2NQIA 1F2AA 3MTNA 2GHUA 2G8JA 2F7DA 1GECE 1MHWA 2JQGR 5J94A 1STFE 3V6EA 2GFOA 3WXFA 1U9XA 4KLBA 2DC6A 1ME3A 5EF4A 2DCCA 3U8EA 4P6EA 2FT2A 1AU0A 3CH2X 3S3QA 4I04A 1W4TA 2BDZA 1NB5A 1DF0A 2BDLA 1AYVA 1ICFA 3NHEA 3O0UA 3F75A 3AI8A 1GMYA 3RVWA 2VFBA 1JQPA 4Q8HA 2OZ2A 1NPZA 2FRQA 2ATOA 1DEUA 1O0EA 3IOQA 2R6NA 1AECA 1QOLA 4B55A 2FQ9A 2E02A 1ATKA 5CHTA 3HHAA 2AUZA 1GCBA 2FRAA 2FTDA 4BS6A 5K16A 2E03A 5CHVA 2CIOA 1TLOA 1AU4A 3PNRA 1CSBB 1GX3A 2AU1A 2G8EA 2VHFA 5CVNB 3QSDA 1GLOA 2P7UA 1PPOA 1NLJA 1X9YA 3CH3X 1PPNA 1QDQA 3BCNA 3KX1A 2AIMA 1U9VA 4YYVA 1Y4HA 2DC7A 1NB3A 4Q8GA 1SNKA 4HWYA 1NQCA 4MZSA 1AYUA 4CDCB 4N79A 1EF7A 4QRXA 3H7DA 2NQDB 4YYSA 2IPPB 2JQFR 4MSXA 5CVOB 4PI3A 1EWLA 1KHQA 1PADA 2DCAA 1FH0A 1YALA 1ZIVA 2DZYA 2YJBA 9PAPA 4BQVA 3P5WA 1AU2A 2ARYA 1VSNA 1THEA 2DC9A 2H7JA 3D9WA 3OISA 2ACTA 2PNSA 3KWZA 3ZUAA 1E2TA 1EWOA 2VFCA 3BPFA 4BGFA 3RVXA 2IBIA 3P5VA 1PPPA 1PPDA 1BGOA 2DCBA 2BSZA 5FPWA 3O1GA 3H8CA 1BY8A 1ITOA 4CDFB 2HH5A 4QH6A 3CBKA 1EWPA 5EGWA 2OP3A 4QBBA 2VHSA 2O6XA 2FYEA 1EWMA 3BWKA 3KWBX 1M6DA 3OF9A 4OELA 2DC8A 3PW3A 3BC3A 5CVMA 1Y08A 3HHIA 2OULA 2AYNA 2G6DA 3DF0A 1MEMA 3HWNA 1PE6A 3IV2A 1KXRA 3CBJA 2R9OA 3WXGA 1PCIA 4CZWA 1IWDA 1U9WA 1CQDA 1AIMA 4PP1A 4XUIA 4G54A 3K9MA 2DZZA 2HHNA 1W6FA 3MORA 4P6GA 6PADA 2B1MA 2YJ8A 4OEMA 2YJ2A 3N3KA 3H8BA 4N8WA 1YVBA 3KFQA 8PCHA 2P86A 3V6CA 4DMYA 3IHPA 3P5UA 4W5CA 4C5PA 1AU3A 2FUDA 1ME4A 2PBHA 4PP2E 1VJVA 1CTEA 2E01A 2XU1A 2NQAA 1W5RA 2XU5A 2XU4A 2NQGA 3TNXA 5JH3A 1ZCMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PIP A;  3B79 A;  4FIP A;  2CB5 A;  1PXV A;  1CJL A;  4QRG A;  2DCD A;  2Y6E A;  3PDF A;  3H89 A;  2YJC A;  2HD5 A;  4X6H A;  1AYW A;  3IUT A;  4YYR A;  2HXZ A;  1CPJ A;  2AYO A;  2DJG B;  4ZUX U;  1KFU L;  4QRV A;  3LXS A;  2WBF X;  3QJ3 A;  1POP A;  3PBH A;  1KHP A;  4CDD B;  1MDW A;  4CDE B;  3I3T A;  2AUX A;  2AVW A;  4FK5 A;  3USV A;  5A24 A;  2R9M A;  3MHH A;  4X6I A;  1YT7 A;  3S3R A;  3H6S A;  2XU3 A;  1YK8 A;  3WXE A;  3RVV A;  4YYW A;  4YVA A;  1U5I A;  2Y5B A;  4RY2 A;  4AXM A;  4YYQ A;  1MIR A;  3OVZ A;  4W5B A;  4W4U A;  2F1G A;  1QXP A;  3GCB A;  3QT4 A;  1F2C A;  2C0Y A;  3IMA A;  1BQI A;  4BS5 A;  1U9Q X;  3BOW A;  4WA6 A;  5PAD A;  4BPV A;  1HUC B;  2PAD A;  4XR7 A;  3KSE A;  3KKU A;  2G7Y A;  2R9N A;  5JA7 A;  4I07 A;  3OVX A;  1F29 A;  3BPM A;  3LFY A;  4FJC A;  1Q6K A;  3E1Z B;  1A6R A;  4YV8 A;  3K24 A;  2R9F A;  1CS8 A;  3KW9 A;  1BP4 A;  4YYU A;  2PRE A;  3C9E A;  2FO5 A;  2R9C A;  1CB5 A;  1SP4 B;  3HD3 A;  4AXL A;  2P0R A;  7PCK A;  1TL9 A;  1YK7 A;  2YJ9 A;  3IEJ A;  1QMY A;  3F5V A;  3OF8 A;  1TU6 A;  1XKG A;  1F2B A;  3D6S A;  5F02 A;  4MZO A;  3P5X A;  3N3G A;  4N4Z A;  3I06 A;  4PAD A;  2B1N A;  1MS6 A;  3M99 A;  1NL6 A;  3ERV A;  1CVZ A;  1S4V A;  4BSQ A;  1KFX L;  1PBH A;  1MEG A;  3K8U A;  1CV8 A;  2E00 A;  2AS8 A;  4X6J A;  4I05 A;  3N4C A;  3MHS A;  1K3B B;  4K7C A;  4DMX A;  2DJF B;  2NQI A;  1F2A A;  3MTN A;  2GHU A;  2G8J A;  2F7D A;  1GEC E;  1MHW A;  2JQG R;  5J94 A;  1STF E;  3V6E A;  2GFO A;  3WXF A;  1U9X A;  4KLB A;  2DC6 A;  1ME3 A;  5EF4 A;  2DCC A;  3U8E A;  4P6E A;  2FT2 A;  1AU0 A;  3CH2 X;  3S3Q A;  4I04 A;  2BDZ A;  1NB5 A;  1DF0 A;  2BDL A;  1AYV A;  1ICF A;  3NHE A;  3O0U A;  3F75 A;  3AI8 A;  1GMY A;  3RVW A;  1JQP A;  4Q8H A;  2OZ2 A;  1NPZ A;  2FRQ A;  2ATO A;  1DEU A;  1O0E A;  3IOQ A;  2R6N A;  1AEC A;  1QOL A;  2FQ9 A;  2E02 A;  1ATK A;  5CHT A;  3HHA A;  2AUZ A;  1GCB A;  2FRA A;  2FTD A;  4BS6 A;  5K16 A;  2E03 A;  5CHV A;  2CIO A;  1TLO A;  1AU4 A;  3PNR A;  1CSB B;  2AU1 A;  2G8E A;  2VHF A;  5CVN B;  3QSD A;  1GLO A;  2P7U A;  1PPO A;  1NLJ A;  1X9Y A;  3CH3 X;  1PPN A;  1QDQ A;  3BCN A;  3KX1 A;  2AIM A;  1U9V A;  4YYV A;  1Y4H A;  2DC7 A;  1NB3 A;  4Q8G A;  1SNK A;  4HWY A;  1NQC A;  4MZS A;  1AYU A;  4CDC B;  4N79 A;  1EF7 A;  4QRX A;  3H7D A;  2NQD B;  4YYS A;  2IPP B;  2JQF R;  4MSX A;  5CVO B;  4PI3 A;  1EWL A;  1KHQ A;  1PAD A;  2DCA A;  1FH0 A;  1YAL A;  1ZIV A;  2DZY A;  2YJB A;  9PAP A;  4BQV A;  3P5W A;  1AU2 A;  2ARY A;  1VSN A;  1THE A;  2DC9 A;  2H7J A;  3OIS A;  2ACT A;  2PNS A;  3KWZ A;  3ZUA A;  1EWO A;  3BPF A;  3RVX A;  2IBI A;  3P5V A;  1PPP A;  1PPD A;  1BGO A;  2DCB A;  5FPW A;  3O1G A;  3H8C A;  1BY8 A;  1ITO A;  4CDF B;  2HH5 A;  4QH6 A;  3CBK A;  1EWP A;  5EGW A;  2OP3 A;  4QBB A;  2VHS A;  2O6X A;  2FYE A;  1EWM A;  3BWK A;  3KWB X;  1M6D A;  3OF9 A;  4OEL A;  2DC8 A;  3PW3 A;  3BC3 A;  5CVM A;  1Y08 A;  3HHI A;  2OUL A;  2AYN A;  2G6D A;  3DF0 A;  1MEM A;  3HWN A;  1PE6 A;  3IV2 A;  1KXR A;  3CBJ A;  2R9O A;  3WXG A;  1PCI A;  4CZW A;  1IWD A;  1U9W A;  1CQD A;  1AIM A;  4PP1 A;  4XUI A;  4G54 A;  3K9M A;  2DZZ A;  2HHN A;  3MOR A;  4P6G A;  6PAD A;  2B1M A;  2YJ8 A;  4OEM A;  2YJ2 A;  3N3K A;  3H8B A;  4N8W A;  1YVB A;  3KFQ A;  8PCH A;  2P86 A;  3V6C A;  4DMY A;  3IHP A;  3P5U A;  4W5C A;  1AU3 A;  2FUD A;  1ME4 A;  2PBH A;  4PP2 E;  1VJV A;  1CTE A;  2E01 A;  2XU1 A;  2NQA A;  2XU5 A;  2XU4 A;  2NQG A;  3TNX A;  5JH3 A;  1ZCM A; 
#chains in the Genus database with same CATH topology
 1PIP A;  3B79 A;  4FIP A;  2CB5 A;  1PXV A;  1CJL A;  2AGA A;  4QRG A;  2DCD A;  2Y6E A;  3PDF A;  3W31 A;  3H89 A;  2YJC A;  2HD5 A;  4X6H A;  3BY4 A;  1AYW A;  4OW0 A;  3IUT A;  4YYR A;  2HXZ A;  1CPJ A;  2AYO A;  2DJG B;  4ZUX U;  1KFU L;  4QRV A;  3LXS A;  2WBF X;  4BOP A;  3QJ3 A;  1POP A;  3PBH A;  1KHP A;  4CDD B;  1MDW A;  4CDE B;  3I3T A;  2AUX A;  2AVW A;  4FK5 A;  3USV A;  5A24 A;  2R9M A;  3MHH A;  3BBA A;  4X6I A;  1YT7 A;  3S3R A;  3H6S A;  2XU3 A;  1YK8 A;  3WXE A;  3RVV A;  4YYW A;  4YVA A;  1U5I A;  2Y5B A;  4RY2 A;  4AXM A;  4YYQ A;  1MIR A;  3E9S A;  3OVZ A;  4W5B A;  4W4U A;  2F1G A;  4IP3 A;  1QXP A;  3GCB A;  3QT4 A;  2BTW A;  1F2C A;  2C0Y A;  3IMA A;  1BQI A;  4BOS A;  4BS5 A;  1U9Q X;  3BOW A;  4WA6 A;  5PAD A;  4BPV A;  1HUC B;  2PAD A;  4XR7 A;  4R3D A;  3KSE A;  3KKU A;  2G7Y A;  2R9N A;  5JA7 A;  4I07 A;  3OVX A;  1F29 A;  3BPM A;  3LFY A;  4FJC A;  1Q6K A;  3E1Z B;  5JZE A;  3BB7 A;  1A6R A;  4YV8 A;  3K24 A;  2BU3 A;  2FE8 A;  2R9F A;  1CS8 A;  3KW9 A;  1BP4 A;  4YYU A;  2PRE A;  4GUA A;  3PT2 A;  3O65 A;  3C9E A;  4WUR A;  2FO5 A;  2R9C A;  2J7Q C;  1CB5 A;  1SP4 B;  3HD3 A;  4AXL A;  2P0R A;  7PCK A;  4IUM A;  1TL9 A;  1YK7 A;  3PHX A;  2YJ9 A;  3IEJ A;  1QMY A;  3F5V A;  4PT5 A;  3OF8 A;  1TU6 A;  3TMP A;  1XKG A;  1F2B A;  3D6S A;  5F02 A;  4MZO A;  3P5X A;  3N3G A;  4N4Z A;  5E6J A;  3I06 A;  4PAD A;  2B1N A;  1MS6 A;  3M99 A;  1NL6 A;  3PRM A;  3ERV A;  1CVZ A;  1S4V A;  4MI7 A;  4RF1 A;  4BSQ A;  1KFX L;  1DKI A;  1PBH A;  1MEG A;  3K8U A;  4P16 A;  1CV8 A;  3MP2 A;  2E00 A;  3B21 A;  2AS8 A;  4X6J A;  4I05 A;  3N4C A;  3MHS A;  4XZX A;  1K3B B;  4K7C A;  4DMX A;  4D8E A;  2DJF B;  3PHW A;  4BOQ A;  2NQI A;  1F2A A;  3MTN A;  2GHU A;  2G8J A;  2F7D A;  1GEC E;  1MHW A;  2JQG R;  4RF0 A;  5J94 A;  1STF E;  4RNA A;  3V6E A;  2GFO A;  3WXF A;  4ZTB A;  1U9X A;  4KLB A;  2DC6 A;  1ME3 A;  3OQC A;  5EF4 A;  2DCC A;  3U8E A;  4P6E A;  2FT2 A;  1AU0 A;  3CH2 X;  3S3Q A;  4I04 A;  2BDZ A;  1NB5 A;  1DF0 A;  2BDL A;  1AYV A;  1ICF A;  3NHE A;  3O0U A;  3F75 A;  3AI8 A;  1GMY A;  5EZQ A;  3RVW A;  1JQP A;  4Q8H A;  2OZ2 A;  1NPZ A;  2FRQ A;  2ATO A;  1DEU A;  1O0E A;  3IOQ A;  2R6N A;  1AEC A;  1QOL A;  2FQ9 A;  2E02 A;  1ATK A;  5CHT A;  3HHA A;  2AUZ A;  1GCB A;  2FRA A;  2FTD A;  4HXD B;  4BS6 A;  4OVZ A;  5K16 A;  2E03 A;  1YZB A;  4RKX A;  5CHV A;  2DOS A;  2CIO A;  1TLO A;  1AU4 A;  3PNR A;  1CSB B;  2AU1 A;  2G8E A;  2VHF A;  5CVN B;  2JTC A;  3QSD A;  1GLO A;  2P7U A;  1PPO A;  1NLJ A;  3MTV A;  1X9Y A;  3CH3 X;  1PPN A;  1QDQ A;  3BCN A;  3PRP A;  3KX1 A;  2AIM A;  1U9V A;  3ZNH A;  4YYV A;  1Y4H A;  2DC7 A;  1NB3 A;  4Q8G A;  1SNK A;  2HWK A;  4HWY A;  1NQC A;  4MZS A;  1AYU A;  4A5U A;  4CDC B;  3RNV A;  4N79 A;  1EF7 A;  4QRX A;  3H7D A;  2JRI A;  2NQD B;  4YYS A;  2IPP B;  3PHU A;  2JQF R;  4MSX A;  4D8I A;  5CVO B;  4PI3 A;  1EWL A;  1KHQ A;  1PAD A;  2DCA A;  1FH0 A;  1YAL A;  1ZIV A;  2DZY A;  2YJB A;  9PAP A;  4M0W A;  4BQV A;  3P5W A;  1AU2 A;  2ARY A;  1VSN A;  1THE A;  2DC9 A;  2J7Q A;  2H7J A;  3OIS A;  2ACT A;  2PNS A;  3C0R A;  3KWZ A;  3ZUA A;  1EWO A;  3BPF A;  3RVX A;  2IBI A;  3P5V A;  1PPP A;  1PPD A;  1BGO A;  2DCB A;  2Z84 A;  3IFU A;  5FPW A;  3O1G A;  3W30 A;  3H8C A;  3MJ5 A;  3PSE A;  1BY8 A;  1ITO A;  4MM3 B;  4CDF B;  2HH5 A;  4QH6 A;  3CBK A;  1EWP A;  4REZ A;  5EGW A;  2OP3 A;  4QBB A;  2VHS A;  4BOZ A;  2O6X A;  2FYE A;  1EWM A;  3BWK A;  3KWB X;  5EZS A;  1M6D A;  3OF9 A;  4OEL A;  2DC8 A;  3PW3 A;  3BC3 A;  5CVM A;  1Y08 A;  3HHI A;  2OUL A;  2BTW B;  2AYN A;  2G6D A;  3DF0 A;  1MEM A;  3HWN A;  1PE6 A;  4D8B A;  3IV2 A;  1KXR A;  3CBJ A;  2R9O A;  4OVZ B;  3WXG A;  1PCI A;  4CZW A;  1IWD A;  5KO3 A;  1U9W A;  1CQD A;  1AIM A;  4PP1 A;  4XUI A;  4G54 A;  3K9M A;  3TRK A;  1UKF A;  2DZZ A;  2HHN A;  3MOR A;  4P6G A;  6PAD A;  2B1M A;  2YJ8 A;  4OEM A;  4BOU A;  2YJ2 A;  3N3K A;  3H8B A;  4N8W A;  1YVB A;  3KFQ A;  8PCH A;  2P86 A;  3V6C A;  4DMY A;  3IHP A;  3P5U A;  4W5C A;  2UZJ A;  1AU3 A;  2FUD A;  1ME4 A;  2PBH A;  4PP2 E;  1VJV A;  1CTE A;  2E01 A;  2XU1 A;  2NQA A;  2XU5 A;  2XU4 A;  2NQG A;  3TNX A;  5JH3 A;  1PVJ A;  1ZCM A; 
#chains in the Genus database with same CATH homology
 1PIP A;  3B79 A;  4FIP A;  2CB5 A;  1PXV A;  1CJL A;  4QRG A;  2DCD A;  2Y6E A;  3PDF A;  3H89 A;  2YJC A;  2HD5 A;  4X6H A;  1AYW A;  3IUT A;  4YYR A;  2HXZ A;  4NV7 A;  1CPJ A;  2AYO A;  2DJG B;  4ZUX U;  1KFU L;  4QRV A;  3LXS A;  2WBF X;  3QJ3 A;  1POP A;  3PBH A;  1KHP A;  4CDD B;  1MDW A;  4CDE B;  3I3T A;  2AUX A;  2AVW A;  4FK5 A;  3USV A;  5A24 A;  2R9M A;  4GUZ A;  3MHH A;  4X6I A;  1YT7 A;  3S3R A;  3H6S A;  2XU3 A;  1YK8 A;  3WXE A;  3RVV A;  4YYW A;  4YVA A;  1U5I A;  2Y5B A;  4RY2 A;  4AXM A;  4YYQ A;  1MIR A;  3OVZ A;  4W5B A;  4W4U A;  2F1G A;  1QXP A;  3GCB A;  3QT4 A;  1F2C A;  4NV8 A;  2C0Y A;  3IMA A;  1BQI A;  4BS5 A;  1U9Q X;  3BOW A;  4WA6 A;  5PAD A;  4BPV A;  1HUC B;  2PAD A;  4XR7 A;  3KSE A;  3KKU A;  2G7Y A;  2R9N A;  5JA7 A;  4I07 A;  3OVX A;  1F29 A;  3BPM A;  3LFY A;  4FJC A;  1Q6K A;  3E1Z B;  1A6R A;  4YV8 A;  3K24 A;  2R9F A;  1CS8 A;  3KW9 A;  1BP4 A;  4YYU A;  2PRE A;  3C9E A;  2FO5 A;  2R9C A;  1CB5 A;  1SP4 B;  3HD3 A;  4AXL A;  2P0R A;  7PCK A;  1TL9 A;  1YK7 A;  2YJ9 A;  3IEJ A;  1QMY A;  3F5V A;  3OF8 A;  1TU6 A;  1XKG A;  1F2B A;  3D6S A;  5F02 A;  4MZO A;  3P5X A;  3N3G A;  4N4Z A;  3I06 A;  4PAD A;  2B1N A;  3LTW A;  1MS6 A;  3M99 A;  1NL6 A;  3ERV A;  1CVZ A;  1S4V A;  4BSQ A;  1KFX L;  1PBH A;  1MEG A;  3K8U A;  1CV8 A;  2E00 A;  2AS8 A;  4X6J A;  4I05 A;  3N4C A;  3MHS A;  1K3B B;  4K7C A;  4DMX A;  2DJF B;  2NQI A;  1F2A A;  3MTN A;  2GHU A;  2G8J A;  2F7D A;  1GEC E;  1MHW A;  2JQG R;  5J94 A;  1STF E;  3V6E A;  2GFO A;  3WXF A;  1U9X A;  4KLB A;  2DC6 A;  1ME3 A;  5EF4 A;  2DCC A;  3U8E A;  4P6E A;  2FT2 A;  1AU0 A;  3CH2 X;  3S3Q A;  4I04 A;  1W4T A;  2BDZ A;  1NB5 A;  1DF0 A;  2BDL A;  1AYV A;  1ICF A;  3NHE A;  3O0U A;  3F75 A;  3AI8 A;  1GMY A;  3RVW A;  2VFB A;  1JQP A;  4Q8H A;  2OZ2 A;  1NPZ A;  2FRQ A;  2ATO A;  1DEU A;  1O0E A;  3IOQ A;  2R6N A;  1AEC A;  1QOL A;  4B55 A;  2FQ9 A;  2E02 A;  1ATK A;  5CHT A;  3HHA A;  2AUZ A;  1GCB A;  2FRA A;  2FTD A;  4BS6 A;  5K16 A;  2E03 A;  5CHV A;  2CIO A;  1TLO A;  1AU4 A;  3PNR A;  1CSB B;  1GX3 A;  2AU1 A;  2G8E A;  2VHF A;  5CVN B;  3QSD A;  1GLO A;  2P7U A;  1PPO A;  1NLJ A;  1X9Y A;  3CH3 X;  1PPN A;  1QDQ A;  3BCN A;  3KX1 A;  2AIM A;  1U9V A;  4YYV A;  1Y4H A;  2DC7 A;  1NB3 A;  4Q8G A;  1SNK A;  4HWY A;  1NQC A;  4MZS A;  1AYU A;  4CDC B;  4N79 A;  1EF7 A;  4QRX A;  3H7D A;  2NQD B;  4YYS A;  2IPP B;  2JQF R;  4MSX A;  5CVO B;  4PI3 A;  1EWL A;  1KHQ A;  1PAD A;  2DCA A;  1FH0 A;  1YAL A;  1ZIV A;  2DZY A;  2YJB A;  9PAP A;  4BQV A;  3P5W A;  1AU2 A;  2ARY A;  1VSN A;  1THE A;  2DC9 A;  2H7J A;  3D9W A;  3OIS A;  2ACT A;  2PNS A;  3KWZ A;  3ZUA A;  1E2T A;  1EWO A;  2VFC A;  3BPF A;  4BGF A;  3RVX A;  2IBI A;  3P5V A;  1PPP A;  1PPD A;  1BGO A;  2DCB A;  2BSZ A;  5FPW A;  3O1G A;  3H8C A;  1BY8 A;  1ITO A;  4CDF B;  2HH5 A;  4QH6 A;  3CBK A;  1EWP A;  5EGW A;  2OP3 A;  4QBB A;  2VHS A;  2O6X A;  2FYE A;  1EWM A;  3BWK A;  3KWB X;  1M6D A;  3OF9 A;  4OEL A;  2DC8 A;  3PW3 A;  3BC3 A;  5CVM A;  1Y08 A;  3HHI A;  2OUL A;  2AYN A;  2G6D A;  3DF0 A;  1MEM A;  3HWN A;  1PE6 A;  3IV2 A;  1KXR A;  3CBJ A;  2R9O A;  3WXG A;  1PCI A;  4CZW A;  1IWD A;  1U9W A;  1CQD A;  1AIM A;  4PP1 A;  4XUI A;  4G54 A;  3K9M A;  2DZZ A;  2HHN A;  1W6F A;  3MOR A;  4P6G A;  6PAD A;  2B1M A;  2YJ8 A;  4OEM A;  2YJ2 A;  3N3K A;  3H8B A;  4N8W A;  1YVB A;  3KFQ A;  8PCH A;  2P86 A;  3V6C A;  4DMY A;  3IHP A;  3P5U A;  4W5C A;  4C5P A;  1AU3 A;  2FUD A;  1ME4 A;  2PBH A;  4PP2 E;  1VJV A;  1CTE A;  2E01 A;  2XU1 A;  2NQA A;  1W5R A;  2XU5 A;  2XU4 A;  2NQG A;  3TNX A;  5JH3 A;  1ZCM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...