2FRAA

Human cathepsin s with cra-27934, a nitrile inhibitor
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
217
structure length
217
Chain Sequence
LPDSVDWREKGCVTEVKYQGSCGACWAFSAVGALEAQLKLKTGKLVSLSAQNLVDCSTEKYGNKGCNGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYDSKYRAATCSKYTELPYGREDVLKEAVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSWGHNFGEEGYIRMARNKGNHCGIASFPSYPEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Human Cathepsin S with CRA-27934, a Nitrile Inhibitor
rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords cathepsin S
total genus 66
structure length 217
sequence length 217
chains with identical sequence B
ec nomenclature ec 3.4.22.27: Cathepsin S.
pdb deposition date 2006-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2fraA00
4QRGA 1VJVA 1CQDA 2OULA 2R6NA 3OVZA 3IMAA 3H8CA 3CBJA 1PPPA 4W4UA 4I04A 4QRVA 2YJ9A 5FPWA 2WBFX 3WXEA 3LFYA 5J94A 3I3TA 1VSNA 2DJFB 4X6HA 5EF4A 1QXPA 3WXFA 2F1GA 3V6CA 3F5VA 2AYOA 3S3QA 3BCNA 4OELA 5PADA 2YJCA 2P86A 1KFUL 1AU3A 3WXGA 2ACTA 3KKUA 1DEUA 2AIMA 3N3KA 2FYEA 1NPZA 2DZYA 3AI8A 3BWKA 4MZOA 1AU2A 3HHIA 1AU0A 1AYUA 3KWBX 2DC7A 2G8JA 1KFXL 3ERVA 3F75A 1NQCA 2AYNA 1THEA 4BPVA 4BS6A 3TNXA 3K9MA 3N4CA 1NLJA 4G54A 2E02A 3H89A 2DCDA 2DC9A 2FRAA 2E00A 1U9VA 3P5VA 1QOLA 6PADA 4DMXA 3HHAA 1Y4HA 4WA6A 2DC8A 2Y5BA 1F2AA 2AS8A 1U5IA 3IEJA 1CTEA 1QMYA 2DCCA 3QJ3A 4XUIA 3HWNA 1JQPA 4BSQA 4N8WA 3V6EA 2R9MA 3QT4A 3RVXA 2DC6A 4BQVA 3OVXA 4P6GA 2JQFR 2BDLA 4HWYA 3USVA 1CS8A 2FQ9A 2CB5A 2OP3A 4MSXA 1PBHA 1EWMA 3HD3A 1MDWA 1STFE 2GHUA 4CDDB 1F2BA 1ME3A 2H7JA 4FIPA 1MS6A 2C0YA 3CH3X 4FK5A 2B1MA 1SP4B 1AECA 1HUCB 1ICFA 2DCBA 4YV8A 1AYWA 2FT2A 1TU6A 1NB5A 3O0UA 3DF0A 1ITOA 3BC3A 2ATOA 2G8EA 1CVZA 2PREA 3P5XA 4X6JA 2AVWA 4PP1A 2ARYA 3IOQA 2VHSA 3PDFA 3I06A 2YJ8A 4QBBA 3N3GA 1YK8A 2OZ2A 1EWLA 3KWZA 2XU3A 1EWOA 1U9XA 3BPFA 4YYQA 1YK7A 1QDQA 5CVOB 1YVBA 1AYVA 4MZSA 9PAPA 1GCBA 1S4VA 4N79A 1X9YA 5A24A 2AUZA 3ZUAA 4CDCB 4YYSA 1PIPA 2NQAA 4YYWA 4W5BA 3E1ZB 3O1GA 4YYUA 2HHNA 3RVVA 3RVWA 1CPJA 5CHVA 2FRQA 3MHHA 1TLOA 1MEMA 1DF0A 4P6EA 4Q8GA 1ATKA 2O6XA 2FTDA 1PPNA 1PCIA 1BQIA 3MHSA 2R9NA 1IWDA 4PP2E 2G6DA 1MHWA 2XU5A 5CVNB 3S3RA 1U9WA 2BDZA 7PCKA 3IHPA 1Q6KA 2PADA 1BP4A 1PXVA 1CB5A 3IV2A 1U9QX 3K24A 4W5CA 4I05A 4X6IA 2HXZA 3BPMA 2IBIA 1O0EA 2IPPB 2DZZA 2PNSA 4QRXA 1Y08A 3KW9A 3MORA 3H8BA 5JA7A 4PADA 1YALA 2P7UA 1XKGA 4YVAA 4ZUXU 1CJLA 1BGOA 3GCBA 3U8EA 3OF9A 1MEGA 3P5WA 1NL6A 1AU4A 3CH2X 1YT7A 2HH5A 1SNKA 1ZIVA 4CDEB 2YJBA 1GLOA 3K8UA 3C9EA 2F7DA 2FO5A 2HD5A 2R9OA 3M99A 1PE6A 2YJ2A 2R9CA 5K16A 1M6DA 3LXSA 2R9FA 1PADA 3OF8A 2E03A 4N4ZA 3D6SA 1EWPA 1PPDA 2PBHA 2NQGA 2XU1A 3MTNA 1A6RA 1AIMA 4OEMA 3PNRA 5CVMA 4QH6A 4Q8HA 2VHFA 4I07A 1CV8A 4XR7A 4CZWA 3OISA 3PBHA 1PPOA 4AXLA 1NB3A 1KHPA 4YYVA 3H6SA 3IUTA 3P5UA 2JQGR 1GECE 1EF7A 4DMYA 4AXMA 5CHTA 4K7CA 1GMYA 1TL9A 4FJCA 4KLBA 4PI3A 2P0RA 1ZCMA 2DCAA 2NQDB 3KX1A 1KHQA 1BY8A 2Y6EA 5EGWA 1F29A 3B79A 2CIOA 3CBKA 1FH0A 1KXRA 3QSDA 4CDFB 1MIRA 4YYRA 2E01A 1POPA 3NHEA 1ME4A 8PCHA 2AUXA 3H7DA 1K3BB 2G7YA 3KSEA 2AU1A 4RY2A 2XU4A 3KFQA 2GFOA 1CSBB 3PW3A 2B1NA 5F02A 5JH3A 4BS5A 2DJGB 3BOWA 1F2CA 2FUDA 2NQIA
chains in the Genus database with same CATH superfamily
4QRGA 1VJVA 1DKIA 1CQDA 2OULA 2R6NA 4IP3A 3OVZA 3IMAA 3H8CA 3CBJA 1PPPA 4W4UA 4I04A 4QRVA 3MJ5A 2YJ9A 5FPWA 4RNAA 2WBFX 3WXEA 3LFYA 5J94A 3I3TA 2BU3A 1VSNA 2DJFB 4X6HA 5EF4A 1QXPA 4IUMA 3WXFA 2F1GA 3V6CA 3F5VA 2AYOA 3BBAA 4RF0A 3S3QA 3BCNA 4OELA 5PADA 2YJCA 4RKXA 4GUAA 2P86A 1KFUL 2JTCA 1AU3A 3WXGA 2ACTA 3KKUA 1DEUA 2AIMA 3N3KA 4OVZA 2FYEA 1NPZA 4M0WA 2DZYA 3AI8A 3BWKA 4MZOA 1AU2A 3HHIA 3IFUA 1AU0A 1AYUA 3KWBX 2DC7A 2G8JA 3PSEA 1KFXL 2DOSA 3ERVA 3F75A 1NQCA 2AYNA 1THEA 4BPVA 2J7QA 4BS6A 3TNXA 3K9MA 3N4CA 3PT2A 1NLJA 4G54A 2E02A 3H89A 2DCDA 2DC9A 2FRAA 2BTWB 2E00A 1U9VA 3P5VA 3OQCA 1QOLA 4R3DA 6PADA 4DMXA 3HHAA 1Y4HA 4WA6A 3BY4A 4OVZB 2DC8A 2Y5BA 1F2AA 2AS8A 1U5IA 3IEJA 1CTEA 1QMYA 2DCCA 3QJ3A 4XUIA 3HWNA 1JQPA 4BSQA 4N8WA 3V6EA 4BOZA 2R9MA 3QT4A 3RVXA 2DC6A 3PHWA 4PT5A 4BQVA 3OVXA 4MI7A 4MM3B 2JQFR 2BDLA 4P6GA 4HWYA 3USVA 1CS8A 2FQ9A 3W30A 2CB5A 2OP3A 4MSXA 5JZEA 1PBHA 1EWMA 3HD3A 1MDWA 1STFE 2GHUA 4CDDB 3MTVA 1F2BA 1ME3A 4BOSA 2H7JA 4FIPA 1MS6A 2C0YA 4BOUA 3CH3X 4FK5A 2B1MA 1SP4B 5KO3A 1AECA 1HUCB 1ICFA 2DCBA 4YV8A 2HWKA 1AYWA 2FT2A 1TU6A 1NB5A 3O0UA 5EZSA 3C0RA 3DF0A 1ITOA 3BC3A 2ATOA 2G8EA 1CVZA 2PREA 3P5XA 4X6JA 2AVWA 4PP1A 2ARYA 3IOQA 2VHSA 3PDFA 3I06A 2YJ8A 4QBBA 3N3GA 1YK8A 2OZ2A 1EWLA 3KWZA 2XU3A 1EWOA 1U9XA 3BPFA 4YYQA 1YK7A 1QDQA 5CVOB 1YVBA 1AYVA 4MZSA 3PHXA 4RF1A 9PAPA 1GCBA 1S4VA 4N79A 1X9YA 5A24A 3RNVA 2AUZA 3ZUAA 4CDCB 4YYSA 1PIPA 2AGAA 2NQAA 4YYWA 4W5BA 3E1ZB 3O1GA 4YYUA 2HHNA 3RVVA 3RVWA 1CPJA 5CHVA 2Z84A 4REZA 2FRQA 3MHHA 1UKFA 1TLOA 1MEMA 1DF0A 4P6EA 4Q8GA 1ATKA 2O6XA 2FTDA 1PPNA 1PCIA 1BQIA 3MHSA 2R9NA 1IWDA 4PP2E 3TRKA 2G6DA 1MHWA 2XU5A 2JRIA 5CVNB 3S3RA 3B21A 3TMPA 1U9WA 2BDZA 7PCKA 1PVJA 3IHPA 1Q6KA 2UZJA 2PADA 1BP4A 1PXVA 1CB5A 3IV2A 1U9QX 3K24A 4W5CA 4I05A 4X6IA 2HXZA 3BPMA 2IBIA 1O0EA 3PHUA 2IPPB 2DZZA 2BTWA 2PNSA 4QRXA 1Y08A 3KW9A 3MORA 3H8BA 5JA7A 4P16A 5E6JA 4PADA 1YALA 2P7UA 1XKGA 4YVAA 4BOPA 4ZUXU 4ZTBA 1CJLA 1BGOA 3ZNHA 3GCBA 3U8EA 3OF9A 1MEGA 5EZQA 3P5WA 3O65A 1NL6A 1AU4A 3CH2X 1YZBA 1YT7A 2HH5A 1SNKA 1ZIVA 4CDEB 2YJBA 1GLOA 4A5UA 4XZXA 3K8UA 4OW0A 3C9EA 2F7DA 2FO5A 2HD5A 4D8IA 2FE8A 2R9OA 2J7QC 3M99A 3BB7A 3E9SA 4D8EA 1PE6A 4BOQA 4WURA 2YJ2A 3PRPA 2R9CA 5K16A 1M6DA 3LXSA 2R9FA 1PADA 3OF8A 2E03A 4N4ZA 3D6SA 1EWPA 1PPDA 2PBHA 2NQGA 2XU1A 3MTNA 1A6RA 4HXDB 1AIMA 4OEMA 3PNRA 5CVMA 4QH6A 4Q8HA 2VHFA 4I07A 1CV8A 4XR7A 4CZWA 3OISA 3PBHA 1PPOA 4AXLA 1NB3A 1KHPA 4YYVA 3H6SA 3IUTA 3P5UA 2JQGR 1GECE 1EF7A 4DMYA 4AXMA 5CHTA 4K7CA 1GMYA 1TL9A 4FJCA 4KLBA 4PI3A 2P0RA 1ZCMA 2DCAA 2NQDB 3KX1A 1KHQA 1BY8A 2Y6EA 5EGWA 3W31A 1F29A 3B79A 2CIOA 3CBKA 1FH0A 1KXRA 3QSDA 4CDFB 1MIRA 4YYRA 2E01A 1POPA 3MP2A 3NHEA 1ME4A 8PCHA 4D8BA 2AUXA 3H7DA 1K3BB 2G7YA 3KSEA 2AU1A 4RY2A 2XU4A 3KFQA 2GFOA 1CSBB 3PW3A 2B1NA 5F02A 5JH3A 4BS5A 2DJGB 3BOWA 1F2CA 2FUDA 2NQIA 3PRMA
chains in the Genus database with same CATH topology
4QRGA 1VJVA 1CQDA 2OULA 2R6NA 3OVZA 3IMAA 3H8CA 3CBJA 1PPPA 4W4UA 4I04A 4QRVA 2VFCA 2YJ9A 5FPWA 2WBFX 3WXEA 3LFYA 5J94A 3I3TA 1VSNA 2DJFB 4X6HA 5EF4A 1QXPA 3WXFA 2F1GA 3V6CA 3F5VA 2AYOA 3S3QA 3BCNA 4OELA 5PADA 2YJCA 2P86A 1KFUL 1AU3A 3WXGA 2ACTA 3KKUA 1DEUA 2AIMA 3N3KA 2FYEA 1NPZA 2DZYA 3AI8A 3BWKA 4MZOA 1AU2A 3HHIA 4NV8A 3LTWA 1AU0A 1AYUA 3KWBX 2DC7A 2G8JA 1KFXL 3ERVA 3F75A 1NQCA 2AYNA 1THEA 4BPVA 4BS6A 3TNXA 3K9MA 3N4CA 1NLJA 4G54A 2E02A 3H89A 2DCDA 2DC9A 2FRAA 2E00A 1U9VA 3P5VA 1QOLA 6PADA 4DMXA 3HHAA 1Y4HA 4WA6A 2DC8A 2Y5BA 1F2AA 2AS8A 1U5IA 3IEJA 1CTEA 1QMYA 2DCCA 3QJ3A 4XUIA 3HWNA 1JQPA 4BSQA 4N8WA 3V6EA 2R9MA 3QT4A 3RVXA 2DC6A 4BQVA 3OVXA 4P6GA 2JQFR 2BDLA 4HWYA 3USVA 1CS8A 2FQ9A 2CB5A 2OP3A 4MSXA 1PBHA 1EWMA 3HD3A 1MDWA 1STFE 2GHUA 4CDDB 1F2BA 1ME3A 2H7JA 4FIPA 1MS6A 2C0YA 3CH3X 4FK5A 2B1MA 1SP4B 1AECA 1HUCB 1ICFA 2DCBA 4YV8A 1AYWA 2FT2A 1TU6A 1NB5A 3O0UA 3DF0A 1ITOA 3BC3A 2ATOA 2G8EA 1CVZA 2PREA 3P5XA 4X6JA 2AVWA 4PP1A 2ARYA 3IOQA 2VHSA 3PDFA 3I06A 2YJ8A 4QBBA 3N3GA 1YK8A 2OZ2A 1EWLA 3KWZA 2XU3A 1EWOA 1U9XA 3BPFA 4YYQA 1YK7A 1QDQA 5CVOB 1YVBA 1AYVA 4MZSA 9PAPA 1GCBA 1S4VA 4N79A 1X9YA 5A24A 2AUZA 3ZUAA 4CDCB 4YYSA 1PIPA 2NQAA 4YYWA 4W5BA 3E1ZB 3O1GA 4YYUA 2HHNA 3RVVA 3RVWA 1CPJA 1W4TA 5CHVA 2FRQA 3MHHA 1TLOA 1MEMA 1DF0A 4P6EA 4Q8GA 1ATKA 2O6XA 2FTDA 1PPNA 1PCIA 1BQIA 3MHSA 2R9NA 1IWDA 4PP2E 2G6DA 1MHWA 2XU5A 5CVNB 3S3RA 1U9WA 2BDZA 7PCKA 3IHPA 1Q6KA 2PADA 1W6FA 1BP4A 1PXVA 1CB5A 4BGFA 3IV2A 1U9QX 3K24A 4NV7A 4W5CA 4I05A 4X6IA 2HXZA 3BPMA 2IBIA 1O0EA 4GUZA 2IPPB 2DZZA 2PNSA 4QRXA 1Y08A 3KW9A 3MORA 3H8BA 5JA7A 4PADA 1YALA 2P7UA 1XKGA 4YVAA 4ZUXU 1CJLA 1BGOA 3GCBA 3U8EA 3OF9A 1MEGA 3P5WA 1NL6A 1AU4A 3CH2X 1YT7A 2HH5A 1SNKA 1ZIVA 4CDEB 2YJBA 1GLOA 3K8UA 3C9EA 2F7DA 2FO5A 2HD5A 2R9OA 3M99A 1PE6A 2YJ2A 4B55A 2R9CA 5K16A 1M6DA 3LXSA 2R9FA 1PADA 3OF8A 2E03A 4N4ZA 3D6SA 1EWPA 1PPDA 2PBHA 2NQGA 2XU1A 3MTNA 1A6RA 1AIMA 4OEMA 3PNRA 5CVMA 4QH6A 4Q8HA 2VHFA 2VFBA 4I07A 1CV8A 4XR7A 4CZWA 3OISA 3PBHA 1PPOA 4AXLA 1NB3A 1KHPA 4YYVA 3H6SA 3IUTA 3P5UA 2JQGR 1GX3A 1GECE 1EF7A 4DMYA 4AXMA 5CHTA 4K7CA 1GMYA 1TL9A 4FJCA 4KLBA 4PI3A 2P0RA 1ZCMA 2DCAA 2NQDB 3KX1A 1KHQA 1BY8A 2Y6EA 5EGWA 2BSZA 1F29A 3B79A 2CIOA 1E2TA 3CBKA 1FH0A 1KXRA 3QSDA 4CDFB 1MIRA 4YYRA 2E01A 1POPA 3NHEA 1ME4A 8PCHA 2AUXA 3H7DA 1K3BB 2G7YA 3KSEA 2AU1A 1W5RA 4RY2A 2XU4A 3KFQA 2GFOA 1CSBB 3PW3A 2B1NA 5F02A 5JH3A 4BS5A 4C5PA 3D9WA 2DJGB 3BOWA 1F2CA 2FUDA 2NQIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QRG A;  1VJV A;  1CQD A;  2OUL A;  2R6N A;  3OVZ A;  3IMA A;  3H8C A;  3CBJ A;  1PPP A;  4W4U A;  4I04 A;  4QRV A;  2YJ9 A;  5FPW A;  2WBF X;  3WXE A;  3LFY A;  5J94 A;  3I3T A;  1VSN A;  2DJF B;  4X6H A;  5EF4 A;  1QXP A;  3WXF A;  2F1G A;  3V6C A;  3F5V A;  2AYO A;  3S3Q A;  3BCN A;  4OEL A;  5PAD A;  2YJC A;  2P86 A;  1KFU L;  1AU3 A;  3WXG A;  2ACT A;  3KKU A;  1DEU A;  2AIM A;  3N3K A;  2FYE A;  1NPZ A;  2DZY A;  3AI8 A;  3BWK A;  4MZO A;  1AU2 A;  3HHI A;  1AU0 A;  1AYU A;  3KWB X;  2DC7 A;  2G8J A;  1KFX L;  3ERV A;  3F75 A;  1NQC A;  2AYN A;  1THE A;  4BPV A;  4BS6 A;  3TNX A;  3K9M A;  3N4C A;  1NLJ A;  4G54 A;  2E02 A;  3H89 A;  2DCD A;  2DC9 A;  2FRA A;  2E00 A;  1U9V A;  3P5V A;  1QOL A;  6PAD A;  4DMX A;  3HHA A;  1Y4H A;  4WA6 A;  2DC8 A;  2Y5B A;  1F2A A;  2AS8 A;  1U5I A;  3IEJ A;  1CTE A;  1QMY A;  2DCC A;  3QJ3 A;  4XUI A;  3HWN A;  1JQP A;  4BSQ A;  4N8W A;  3V6E A;  2R9M A;  3QT4 A;  3RVX A;  2DC6 A;  4BQV A;  3OVX A;  4P6G A;  2JQF R;  2BDL A;  4HWY A;  3USV A;  1CS8 A;  2FQ9 A;  2CB5 A;  2OP3 A;  4MSX A;  1PBH A;  1EWM A;  3HD3 A;  1MDW A;  1STF E;  2GHU A;  4CDD B;  1F2B A;  1ME3 A;  2H7J A;  4FIP A;  1MS6 A;  2C0Y A;  3CH3 X;  4FK5 A;  2B1M A;  1SP4 B;  1AEC A;  1HUC B;  1ICF A;  2DCB A;  4YV8 A;  1AYW A;  2FT2 A;  1TU6 A;  1NB5 A;  3O0U A;  3DF0 A;  1ITO A;  3BC3 A;  2ATO A;  2G8E A;  1CVZ A;  2PRE A;  3P5X A;  4X6J A;  2AVW A;  4PP1 A;  2ARY A;  3IOQ A;  2VHS A;  3PDF A;  3I06 A;  2YJ8 A;  4QBB A;  3N3G A;  1YK8 A;  2OZ2 A;  1EWL A;  3KWZ A;  2XU3 A;  1EWO A;  1U9X A;  3BPF A;  4YYQ A;  1YK7 A;  1QDQ A;  5CVO B;  1YVB A;  1AYV A;  4MZS A;  9PAP A;  1GCB A;  1S4V A;  4N79 A;  1X9Y A;  5A24 A;  2AUZ A;  3ZUA A;  4CDC B;  4YYS A;  1PIP A;  2NQA A;  4YYW A;  4W5B A;  3E1Z B;  3O1G A;  4YYU A;  2HHN A;  3RVV A;  3RVW A;  1CPJ A;  5CHV A;  2FRQ A;  3MHH A;  1TLO A;  1MEM A;  1DF0 A;  4P6E A;  4Q8G A;  1ATK A;  2O6X A;  2FTD A;  1PPN A;  1PCI A;  1BQI A;  3MHS A;  2R9N A;  1IWD A;  4PP2 E;  2G6D A;  1MHW A;  2XU5 A;  5CVN B;  3S3R A;  1U9W A;  2BDZ A;  7PCK A;  3IHP A;  1Q6K A;  2PAD A;  1BP4 A;  1PXV A;  1CB5 A;  3IV2 A;  1U9Q X;  3K24 A;  4W5C A;  4I05 A;  4X6I A;  2HXZ A;  3BPM A;  2IBI A;  1O0E A;  2IPP B;  2DZZ A;  2PNS A;  4QRX A;  1Y08 A;  3KW9 A;  3MOR A;  3H8B A;  5JA7 A;  4PAD A;  1YAL A;  2P7U A;  1XKG A;  4YVA A;  4ZUX U;  1CJL A;  1BGO A;  3GCB A;  3U8E A;  3OF9 A;  1MEG A;  3P5W A;  1NL6 A;  1AU4 A;  3CH2 X;  1YT7 A;  2HH5 A;  1SNK A;  1ZIV A;  4CDE B;  2YJB A;  1GLO A;  3K8U A;  3C9E A;  2F7D A;  2FO5 A;  2HD5 A;  2R9O A;  3M99 A;  1PE6 A;  2YJ2 A;  2R9C A;  5K16 A;  1M6D A;  3LXS A;  2R9F A;  1PAD A;  3OF8 A;  2E03 A;  4N4Z A;  3D6S A;  1EWP A;  1PPD A;  2PBH A;  2NQG A;  2XU1 A;  3MTN A;  1A6R A;  1AIM A;  4OEM A;  3PNR A;  5CVM A;  4QH6 A;  4Q8H A;  2VHF A;  4I07 A;  1CV8 A;  4XR7 A;  4CZW A;  3OIS A;  3PBH A;  1PPO A;  4AXL A;  1NB3 A;  1KHP A;  4YYV A;  3H6S A;  3IUT A;  3P5U A;  2JQG R;  1GEC E;  1EF7 A;  4DMY A;  4AXM A;  5CHT A;  4K7C A;  1GMY A;  1TL9 A;  4FJC A;  4KLB A;  4PI3 A;  2P0R A;  1ZCM A;  2DCA A;  2NQD B;  3KX1 A;  1KHQ A;  1BY8 A;  2Y6E A;  5EGW A;  1F29 A;  3B79 A;  2CIO A;  3CBK A;  1FH0 A;  1KXR A;  3QSD A;  4CDF B;  1MIR A;  4YYR A;  2E01 A;  1POP A;  3NHE A;  1ME4 A;  8PCH A;  2AUX A;  3H7D A;  1K3B B;  2G7Y A;  3KSE A;  2AU1 A;  4RY2 A;  2XU4 A;  3KFQ A;  2GFO A;  1CSB B;  3PW3 A;  2B1N A;  5F02 A;  5JH3 A;  4BS5 A;  2DJG B;  3BOW A;  1F2C A;  2FUD A;  2NQI A; 
#chains in the Genus database with same CATH topology
 4QRG A;  1VJV A;  1DKI A;  1CQD A;  2OUL A;  2R6N A;  4IP3 A;  3OVZ A;  3IMA A;  3H8C A;  3CBJ A;  1PPP A;  4W4U A;  4I04 A;  4QRV A;  3MJ5 A;  2YJ9 A;  5FPW A;  4RNA A;  2WBF X;  3WXE A;  3LFY A;  5J94 A;  3I3T A;  2BU3 A;  1VSN A;  2DJF B;  4X6H A;  5EF4 A;  1QXP A;  4IUM A;  3WXF A;  2F1G A;  3V6C A;  3F5V A;  2AYO A;  3BBA A;  4RF0 A;  3S3Q A;  3BCN A;  4OEL A;  5PAD A;  2YJC A;  4RKX A;  4GUA A;  2P86 A;  1KFU L;  2JTC A;  1AU3 A;  3WXG A;  2ACT A;  3KKU A;  1DEU A;  2AIM A;  3N3K A;  4OVZ A;  2FYE A;  1NPZ A;  4M0W A;  2DZY A;  3AI8 A;  3BWK A;  4MZO A;  1AU2 A;  3HHI A;  3IFU A;  1AU0 A;  1AYU A;  3KWB X;  2DC7 A;  2G8J A;  3PSE A;  1KFX L;  2DOS A;  3ERV A;  3F75 A;  1NQC A;  2AYN A;  1THE A;  4BPV A;  2J7Q A;  4BS6 A;  3TNX A;  3K9M A;  3N4C A;  3PT2 A;  1NLJ A;  4G54 A;  2E02 A;  3H89 A;  2DCD A;  2DC9 A;  2FRA A;  2BTW B;  2E00 A;  1U9V A;  3P5V A;  3OQC A;  1QOL A;  4R3D A;  6PAD A;  4DMX A;  3HHA A;  1Y4H A;  4WA6 A;  3BY4 A;  4OVZ B;  2DC8 A;  2Y5B A;  1F2A A;  2AS8 A;  1U5I A;  3IEJ A;  1CTE A;  1QMY A;  2DCC A;  3QJ3 A;  4XUI A;  3HWN A;  1JQP A;  4BSQ A;  4N8W A;  3V6E A;  4BOZ A;  2R9M A;  3QT4 A;  3RVX A;  2DC6 A;  3PHW A;  4PT5 A;  4BQV A;  3OVX A;  4MI7 A;  4MM3 B;  2JQF R;  2BDL A;  4P6G A;  4HWY A;  3USV A;  1CS8 A;  2FQ9 A;  3W30 A;  2CB5 A;  2OP3 A;  4MSX A;  5JZE A;  1PBH A;  1EWM A;  3HD3 A;  1MDW A;  1STF E;  2GHU A;  4CDD B;  3MTV A;  1F2B A;  1ME3 A;  4BOS A;  2H7J A;  4FIP A;  1MS6 A;  2C0Y A;  4BOU A;  3CH3 X;  4FK5 A;  2B1M A;  1SP4 B;  5KO3 A;  1AEC A;  1HUC B;  1ICF A;  2DCB A;  4YV8 A;  2HWK A;  1AYW A;  2FT2 A;  1TU6 A;  1NB5 A;  3O0U A;  5EZS A;  3C0R A;  3DF0 A;  1ITO A;  3BC3 A;  2ATO A;  2G8E A;  1CVZ A;  2PRE A;  3P5X A;  4X6J A;  2AVW A;  4PP1 A;  2ARY A;  3IOQ A;  2VHS A;  3PDF A;  3I06 A;  2YJ8 A;  4QBB A;  3N3G A;  1YK8 A;  2OZ2 A;  1EWL A;  3KWZ A;  2XU3 A;  1EWO A;  1U9X A;  3BPF A;  4YYQ A;  1YK7 A;  1QDQ A;  5CVO B;  1YVB A;  1AYV A;  4MZS A;  3PHX A;  4RF1 A;  9PAP A;  1GCB A;  1S4V A;  4N79 A;  1X9Y A;  5A24 A;  3RNV A;  2AUZ A;  3ZUA A;  4CDC B;  4YYS A;  1PIP A;  2AGA A;  2NQA A;  4YYW A;  4W5B A;  3E1Z B;  3O1G A;  4YYU A;  2HHN A;  3RVV A;  3RVW A;  1CPJ A;  5CHV A;  2Z84 A;  4REZ A;  2FRQ A;  3MHH A;  1UKF A;  1TLO A;  1MEM A;  1DF0 A;  4P6E A;  4Q8G A;  1ATK A;  2O6X A;  2FTD A;  1PPN A;  1PCI A;  1BQI A;  3MHS A;  2R9N A;  1IWD A;  4PP2 E;  3TRK A;  2G6D A;  1MHW A;  2XU5 A;  2JRI A;  5CVN B;  3S3R A;  3B21 A;  3TMP A;  1U9W A;  2BDZ A;  7PCK A;  1PVJ A;  3IHP A;  1Q6K A;  2UZJ A;  2PAD A;  1BP4 A;  1PXV A;  1CB5 A;  3IV2 A;  1U9Q X;  3K24 A;  4W5C A;  4I05 A;  4X6I A;  2HXZ A;  3BPM A;  2IBI A;  1O0E A;  3PHU A;  2IPP B;  2DZZ A;  2BTW A;  2PNS A;  4QRX A;  1Y08 A;  3KW9 A;  3MOR A;  3H8B A;  5JA7 A;  4P16 A;  5E6J A;  4PAD A;  1YAL A;  2P7U A;  1XKG A;  4YVA A;  4BOP A;  4ZUX U;  4ZTB A;  1CJL A;  1BGO A;  3ZNH A;  3GCB A;  3U8E A;  3OF9 A;  1MEG A;  5EZQ A;  3P5W A;  3O65 A;  1NL6 A;  1AU4 A;  3CH2 X;  1YZB A;  1YT7 A;  2HH5 A;  1SNK A;  1ZIV A;  4CDE B;  2YJB A;  1GLO A;  4A5U A;  4XZX A;  3K8U A;  4OW0 A;  3C9E A;  2F7D A;  2FO5 A;  2HD5 A;  4D8I A;  2FE8 A;  2R9O A;  2J7Q C;  3M99 A;  3BB7 A;  3E9S A;  4D8E A;  1PE6 A;  4BOQ A;  4WUR A;  2YJ2 A;  3PRP A;  2R9C A;  5K16 A;  1M6D A;  3LXS A;  2R9F A;  1PAD A;  3OF8 A;  2E03 A;  4N4Z A;  3D6S A;  1EWP A;  1PPD A;  2PBH A;  2NQG A;  2XU1 A;  3MTN A;  1A6R A;  4HXD B;  1AIM A;  4OEM A;  3PNR A;  5CVM A;  4QH6 A;  4Q8H A;  2VHF A;  4I07 A;  1CV8 A;  4XR7 A;  4CZW A;  3OIS A;  3PBH A;  1PPO A;  4AXL A;  1NB3 A;  1KHP A;  4YYV A;  3H6S A;  3IUT A;  3P5U A;  2JQG R;  1GEC E;  1EF7 A;  4DMY A;  4AXM A;  5CHT A;  4K7C A;  1GMY A;  1TL9 A;  4FJC A;  4KLB A;  4PI3 A;  2P0R A;  1ZCM A;  2DCA A;  2NQD B;  3KX1 A;  1KHQ A;  1BY8 A;  2Y6E A;  5EGW A;  3W31 A;  1F29 A;  3B79 A;  2CIO A;  3CBK A;  1FH0 A;  1KXR A;  3QSD A;  4CDF B;  1MIR A;  4YYR A;  2E01 A;  1POP A;  3MP2 A;  3NHE A;  1ME4 A;  8PCH A;  4D8B A;  2AUX A;  3H7D A;  1K3B B;  2G7Y A;  3KSE A;  2AU1 A;  4RY2 A;  2XU4 A;  3KFQ A;  2GFO A;  1CSB B;  3PW3 A;  2B1N A;  5F02 A;  5JH3 A;  4BS5 A;  2DJG B;  3BOW A;  1F2C A;  2FUD A;  2NQI A;  3PRM A; 
#chains in the Genus database with same CATH homology
 4QRG A;  1VJV A;  1CQD A;  2OUL A;  2R6N A;  3OVZ A;  3IMA A;  3H8C A;  3CBJ A;  1PPP A;  4W4U A;  4I04 A;  4QRV A;  2VFC A;  2YJ9 A;  5FPW A;  2WBF X;  3WXE A;  3LFY A;  5J94 A;  3I3T A;  1VSN A;  2DJF B;  4X6H A;  5EF4 A;  1QXP A;  3WXF A;  2F1G A;  3V6C A;  3F5V A;  2AYO A;  3S3Q A;  3BCN A;  4OEL A;  5PAD A;  2YJC A;  2P86 A;  1KFU L;  1AU3 A;  3WXG A;  2ACT A;  3KKU A;  1DEU A;  2AIM A;  3N3K A;  2FYE A;  1NPZ A;  2DZY A;  3AI8 A;  3BWK A;  4MZO A;  1AU2 A;  3HHI A;  4NV8 A;  3LTW A;  1AU0 A;  1AYU A;  3KWB X;  2DC7 A;  2G8J A;  1KFX L;  3ERV A;  3F75 A;  1NQC A;  2AYN A;  1THE A;  4BPV A;  4BS6 A;  3TNX A;  3K9M A;  3N4C A;  1NLJ A;  4G54 A;  2E02 A;  3H89 A;  2DCD A;  2DC9 A;  2FRA A;  2E00 A;  1U9V A;  3P5V A;  1QOL A;  6PAD A;  4DMX A;  3HHA A;  1Y4H A;  4WA6 A;  2DC8 A;  2Y5B A;  1F2A A;  2AS8 A;  1U5I A;  3IEJ A;  1CTE A;  1QMY A;  2DCC A;  3QJ3 A;  4XUI A;  3HWN A;  1JQP A;  4BSQ A;  4N8W A;  3V6E A;  2R9M A;  3QT4 A;  3RVX A;  2DC6 A;  4BQV A;  3OVX A;  4P6G A;  2JQF R;  2BDL A;  4HWY A;  3USV A;  1CS8 A;  2FQ9 A;  2CB5 A;  2OP3 A;  4MSX A;  1PBH A;  1EWM A;  3HD3 A;  1MDW A;  1STF E;  2GHU A;  4CDD B;  1F2B A;  1ME3 A;  2H7J A;  4FIP A;  1MS6 A;  2C0Y A;  3CH3 X;  4FK5 A;  2B1M A;  1SP4 B;  1AEC A;  1HUC B;  1ICF A;  2DCB A;  4YV8 A;  1AYW A;  2FT2 A;  1TU6 A;  1NB5 A;  3O0U A;  3DF0 A;  1ITO A;  3BC3 A;  2ATO A;  2G8E A;  1CVZ A;  2PRE A;  3P5X A;  4X6J A;  2AVW A;  4PP1 A;  2ARY A;  3IOQ A;  2VHS A;  3PDF A;  3I06 A;  2YJ8 A;  4QBB A;  3N3G A;  1YK8 A;  2OZ2 A;  1EWL A;  3KWZ A;  2XU3 A;  1EWO A;  1U9X A;  3BPF A;  4YYQ A;  1YK7 A;  1QDQ A;  5CVO B;  1YVB A;  1AYV A;  4MZS A;  9PAP A;  1GCB A;  1S4V A;  4N79 A;  1X9Y A;  5A24 A;  2AUZ A;  3ZUA A;  4CDC B;  4YYS A;  1PIP A;  2NQA A;  4YYW A;  4W5B A;  3E1Z B;  3O1G A;  4YYU A;  2HHN A;  3RVV A;  3RVW A;  1CPJ A;  1W4T A;  5CHV A;  2FRQ A;  3MHH A;  1TLO A;  1MEM A;  1DF0 A;  4P6E A;  4Q8G A;  1ATK A;  2O6X A;  2FTD A;  1PPN A;  1PCI A;  1BQI A;  3MHS A;  2R9N A;  1IWD A;  4PP2 E;  2G6D A;  1MHW A;  2XU5 A;  5CVN B;  3S3R A;  1U9W A;  2BDZ A;  7PCK A;  3IHP A;  1Q6K A;  2PAD A;  1W6F A;  1BP4 A;  1PXV A;  1CB5 A;  4BGF A;  3IV2 A;  1U9Q X;  3K24 A;  4NV7 A;  4W5C A;  4I05 A;  4X6I A;  2HXZ A;  3BPM A;  2IBI A;  1O0E A;  4GUZ A;  2IPP B;  2DZZ A;  2PNS A;  4QRX A;  1Y08 A;  3KW9 A;  3MOR A;  3H8B A;  5JA7 A;  4PAD A;  1YAL A;  2P7U A;  1XKG A;  4YVA A;  4ZUX U;  1CJL A;  1BGO A;  3GCB A;  3U8E A;  3OF9 A;  1MEG A;  3P5W A;  1NL6 A;  1AU4 A;  3CH2 X;  1YT7 A;  2HH5 A;  1SNK A;  1ZIV A;  4CDE B;  2YJB A;  1GLO A;  3K8U A;  3C9E A;  2F7D A;  2FO5 A;  2HD5 A;  2R9O A;  3M99 A;  1PE6 A;  2YJ2 A;  4B55 A;  2R9C A;  5K16 A;  1M6D A;  3LXS A;  2R9F A;  1PAD A;  3OF8 A;  2E03 A;  4N4Z A;  3D6S A;  1EWP A;  1PPD A;  2PBH A;  2NQG A;  2XU1 A;  3MTN A;  1A6R A;  1AIM A;  4OEM A;  3PNR A;  5CVM A;  4QH6 A;  4Q8H A;  2VHF A;  2VFB A;  4I07 A;  1CV8 A;  4XR7 A;  4CZW A;  3OIS A;  3PBH A;  1PPO A;  4AXL A;  1NB3 A;  1KHP A;  4YYV A;  3H6S A;  3IUT A;  3P5U A;  2JQG R;  1GX3 A;  1GEC E;  1EF7 A;  4DMY A;  4AXM A;  5CHT A;  4K7C A;  1GMY A;  1TL9 A;  4FJC A;  4KLB A;  4PI3 A;  2P0R A;  1ZCM A;  2DCA A;  2NQD B;  3KX1 A;  1KHQ A;  1BY8 A;  2Y6E A;  5EGW A;  2BSZ A;  1F29 A;  3B79 A;  2CIO A;  1E2T A;  3CBK A;  1FH0 A;  1KXR A;  3QSD A;  4CDF B;  1MIR A;  4YYR A;  2E01 A;  1POP A;  3NHE A;  1ME4 A;  8PCH A;  2AUX A;  3H7D A;  1K3B B;  2G7Y A;  3KSE A;  2AU1 A;  1W5R A;  4RY2 A;  2XU4 A;  3KFQ A;  2GFO A;  1CSB B;  3PW3 A;  2B1N A;  5F02 A;  5JH3 A;  4BS5 A;  4C5P A;  3D9W A;  2DJG B;  3BOW A;  1F2C A;  2FUD A;  2NQI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...