2FRAA

Human cathepsin s with cra-27934, a nitrile inhibitor
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
217
structure length
217
Chain Sequence
LPDSVDWREKGCVTEVKYQGSCGACWAFSAVGALEAQLKLKTGKLVSLSAQNLVDCSTEKYGNKGCNGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYDSKYRAATCSKYTELPYGREDVLKEAVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSWGHNFGEEGYIRMARNKGNHCGIASFPSYPEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cathepsin S
publication title Human Cathepsin S with CRA-27934, a Nitrile Inhibitor
rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 66
structure length 217
sequence length 217
chains with identical sequence B
ec nomenclature ec 3.4.22.27: Cathepsin S.
pdb deposition date 2006-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2fraA00
1PE6A 3MORA 4WA6A 3H6SA 4FJCA 1CV8A 3BWKA 1HUCB 1AU4A 3ZUAA 1KHPA 2R9CA 1PPOA 3PW3A 3RVWA 2F1GA 2JQGR 1POPA 1Y4HA 4K7CA 1S4VA 1F2CA 1ITOA 1EWPA 2OP3A 4P6GA 3WXGA 2DCCA 3GCBA 1ICFA 5CVOB 1QDQA 3D6SA 2AYNA 2YJCA 1PIPA 1GLOA 3I06A 2WBFX 1PPPA 3IUTA 1JQPA 2FT2A 5EF4A 2O6XA 3IMAA 1AU3A 3P5VA 3CH3X 4BS6A 4PP1A 1AYWA 3P5WA 2G7YA 2GHUA 1VJVA 1IWDA 4I04A 4OEMA 4CDFB 1EWLA 3S3QA 2R6NA 2HHNA 3K9MA 3KW9A 3MHHA 4FK5A 3WXFA 3BOWA 5J94A 1YALA 2FRQA 2E01A 1ME4A 1U9XA 3KWBX 4FIPA 1XKGA 4MZSA 1AIMA 9PAPA 2XU1A 4PADA 2OULA 1NL6A 2PREA 3KFQA 3NHEA 2AU1A 2AYOA 1AU0A 4XUIA 3KX1A 1NPZA 1PADA 4ZUXU 3H89A 4MZOA 3HHIA 2PNSA 2Y5BA 4YYQA 1U9WA 3BPFA 2XU5A 5CVMA 2E03A 3BPMA 3O0UA 2CIOA 1NLJA 3OF8A 3P5XA 2R9NA 2P0RA 1CSBB 1PPNA 1U9QX 2FUDA 1FH0A 2R9OA 2HH5A 4YYVA 3KKUA 3S3RA 3IV2A 5F02A 4G54A 2BDLA 1QOLA 2G8EA 3E1ZB 4X6JA 1ME3A 1BQIA 4W5CA 4YYRA 1MDWA 3QT4A 2AIMA 3BC3A 2ACTA 4N8WA 4Q8HA 2VHFA 1NB3A 2Y6EA 1CTEA 4YVAA 3N3GA 1ATKA 5CVNB 5K16A 2AS8A 2NQDB 3ERVA 1O0EA 3OVZA 3LFYA 2YJ8A 1THEA 1AYVA 1EWMA 4PI3A 2BDZA 4CDCB 4W5BA 1PPDA 4PP2E 1U5IA 5FPWA 1U9VA 3QJ3A 2CB5A 1EWOA 4BS5A 2PADA 4QBBA 2DZYA 4XR7A 3KSEA 4DMXA 4CZWA 3I3TA 1F29A 3PNRA 2NQAA 4QRVA 5EGWA 3F5VA 2PBHA 1KHQA 1PXVA 3AI8A 7PCKA 3WXEA 5CHVA 2XU4A 3LXSA 1GCBA 1PCIA 1X9YA 3H7DA 1KXRA 1PBHA 3HD3A 2R9FA 2P7UA 4RY2A 1CS8A 1ZCMA 5PADA 3OISA 2YJBA 4QH6A 4YV8A 3V6EA 2E00A 1YVBA 1CVZA 1YK8A 2HXZA 2G6DA 3MHSA 2R9MA 2DZZA 4W4UA 2GFOA 4P6EA 1CPJA 3QSDA 1NB5A 1AYUA 2ATOA 1MIRA 2IBIA 4CDDB 4YYSA 1MS6A 4HWYA 1TU6A 3U8EA 4OELA 4I07A 2ARYA 1Y08A 4YYWA 2DC9A 1A6RA 1F2AA 1VSNA 3IHPA 3P5UA 5CHTA 3F75A 5JA7A 2B1NA 2E02A 3V6CA 2G8JA 3N4CA 1CQDA 2DC8A 1ZIVA 4BPVA 1AU2A 4N4ZA 1BP4A 4Q8GA 1TL9A 5JH3A 3RVVA 2JQFR 2HD5A 1KFUL 3K8UA 2DC6A 3MTNA 2AUXA 1GMYA 4CDEB 3N3KA 2YJ9A 1BGOA 2DJGB 3TNXA 2DCAA 3KWZA 4BQVA 2FO5A 1MHWA 3H8BA 3O1GA 4QRXA 4AXMA 1SNKA 1SP4B 1EF7A 1YK7A 3OF9A 6PADA 2XU3A 2H7JA 1Q6KA 3K24A 2DCDA 5A24A 3CH2X 1TLOA 3PBHA 2FQ9A 4X6IA 3M99A 1M6DA 1STFE 2F7DA 2VHSA 1QXPA 8PCHA 4I05A 3H8CA 3USVA 4AXLA 2YJ2A 4KLBA 4YYUA 3BCNA 1QMYA 3RVXA 4DMYA 4QRGA 3IEJA 3C9EA 3OVXA 3IOQA 1F2BA 1AECA 3HHAA 3CBJA 4BSQA 2DJFB 2AVWA 3B79A 1MEMA 3PDFA 2B1MA 1KFXL 1YT7A 3CBKA 2IPPB 2FRAA 2OZ2A 2P86A 1GECE 2FYEA 4MSXA 1DEUA 2C0YA 1NQCA 2FTDA 1MEGA 4N79A 1DF0A 2NQGA 3DF0A 3HWNA 4X6HA 1CJLA 2DCBA 2DC7A 2NQIA 1BY8A 1CB5A 1K3BB 2AUZA
chains in the Genus database with same CATH superfamily
1PE6A 3MORA 4WA6A 3H6SA 4XZXA 4FJCA 1PVJA 1CV8A 3BWKA 1HUCB 1AU4A 3MP2A 3ZUAA 1KHPA 2R9CA 1PPOA 3PW3A 3RVWA 2F1GA 2JRIA 2JQGR 1POPA 1Y4HA 4D8BA 4K7CA 1S4VA 1F2CA 1ITOA 1EWPA 2OP3A 4P6GA 3WXGA 2DCCA 3GCBA 1ICFA 3BB7A 4D8IA 5CVOB 2J7QC 4D8EA 1QDQA 5EZSA 3D6SA 2AYNA 2YJCA 5E6JA 1PIPA 1GLOA 3I06A 2BTWA 2WBFX 1PPPA 3IUTA 1JQPA 2FT2A 5EF4A 2O6XA 3IMAA 1AU3A 3P5VA 3CH3X 4BS6A 4PP1A 1AYWA 3P5WA 2G7YA 2GHUA 1VJVA 1IWDA 4I04A 3PSEA 4OEMA 4CDFB 1EWLA 3PT2A 3S3QA 2R6NA 2HHNA 4HXDB 3K9MA 5EZQA 3KW9A 1YZBA 3MHHA 4FK5A 3WXFA 3BOWA 5J94A 1YALA 3PRPA 2FRQA 2E01A 1ME4A 1U9XA 3KWBX 4FIPA 1XKGA 4MZSA 1AIMA 9PAPA 2XU1A 4PADA 2OULA 1NL6A 2PREA 3KFQA 3NHEA 2AU1A 2AYOA 1AU0A 4XUIA 3KX1A 1NPZA 1PADA 4ZUXU 3H89A 4MZOA 3HHIA 2PNSA 2Y5BA 4P16A 4YYQA 1U9WA 3BPFA 2XU5A 5CVMA 2E03A 3PRMA 3BPMA 4IP3A 3O0UA 2CIOA 1NLJA 3OF8A 3P5XA 2R9NA 2P0RA 1CSBB 1PPNA 1U9QX 2FUDA 4REZA 5KO3A 1FH0A 2R9OA 2HH5A 4YYVA 3KKUA 4BOQA 3S3RA 3IV2A 5F02A 3OQCA 4G54A 2BDLA 1QOLA 2G8EA 3E1ZB 4MM3B 4OVZA 4X6JA 3IFUA 1ME3A 1BQIA 4W5CA 4IUMA 4YYRA 1MDWA 3QT4A 2AIMA 3BC3A 2UZJA 2ACTA 4N8WA 4Q8HA 2VHFA 1NB3A 2Y6EA 1CTEA 4YVAA 3N3GA 1ATKA 5CVNB 5K16A 3W31A 2AS8A 2NQDB 4OW0A 3ERVA 3PHUA 1O0EA 3OVZA 3LFYA 2YJ8A 1THEA 4BOPA 1AYVA 1EWMA 4PI3A 4BOZA 2FE8A 2BDZA 4CDCB 4W5BA 1PPDA 4PP2E 1U5IA 5FPWA 3E9SA 1U9VA 3QJ3A 2CB5A 1EWOA 4BS5A 2PADA 4QBBA 2DZYA 4XR7A 4OVZB 3TMPA 3KSEA 4DMXA 3RNVA 4CZWA 3I3TA 1F29A 3ZNHA 2AGAA 3PNRA 2NQAA 4QRVA 5EGWA 3F5VA 2PBHA 1KHQA 1PXVA 2HWKA 3AI8A 7PCKA 3WXEA 5CHVA 2XU4A 3LXSA 1GCBA 1PCIA 1X9YA 2BU3A 3H7DA 1KXRA 3TRKA 1PBHA 4RF0A 3HD3A 2R9FA 2P7UA 4RY2A 1CS8A 1ZCMA 5PADA 3OISA 2YJBA 4QH6A 4YV8A 3B21A 3V6EA 2E00A 4A5UA 1YVBA 1CVZA 1YK8A 2HXZA 2G6DA 3MHSA 2R9MA 2DZZA 4PT5A 4W4UA 2GFOA 4P6EA 1CPJA 3QSDA 1NB5A 1UKFA 1AYUA 2ATOA 1MIRA 2IBIA 3BY4A 4CDDB 4YYSA 1MS6A 4HWYA 1TU6A 3U8EA 4OELA 3PHXA 4I07A 2ARYA 1Y08A 4BOUA 4YYWA 2DC9A 1A6RA 1F2AA 1VSNA 3IHPA 3P5UA 5CHTA 3F75A 5JA7A 2B1NA 3BBAA 2E02A 3V6CA 2G8JA 3N4CA 1CQDA 2DC8A 1ZIVA 4BPVA 1AU2A 1BP4A 2DOSA 4N4ZA 4Q8GA 4GUAA 1TL9A 5JH3A 3RVVA 2JQFR 2HD5A 1KFUL 4R3DA 3K8UA 4RF1A 2DC6A 3MTNA 2AUXA 1GMYA 4CDEB 3N3KA 3C0RA 2YJ9A 1BGOA 2DJGB 3TNXA 2DCAA 4WURA 3KWZA 4BQVA 2FO5A 1MHWA 3PHWA 5JZEA 3H8BA 3O1GA 2J7QA 4QRXA 4AXMA 1SNKA 1SP4B 3MJ5A 1EF7A 1YK7A 4M0WA 3OF9A 6PADA 2XU3A 2H7JA 1Q6KA 3K24A 2DCDA 4ZTBA 5A24A 3CH2X 1TLOA 3PBHA 2FQ9A 4X6IA 3M99A 1M6DA 1STFE 2F7DA 2VHSA 1QXPA 8PCHA 4I05A 3H8CA 1DKIA 3USVA 4AXLA 2YJ2A 4KLBA 4YYUA 3W30A 4BOSA 3BCNA 1QMYA 3RVXA 4DMYA 4QRGA 3IEJA 3C9EA 3OVXA 3IOQA 1F2BA 3O65A 1AECA 3HHAA 3CBJA 4BSQA 2DJFB 3MTVA 2AVWA 3B79A 1MEMA 3PDFA 2B1MA 1KFXL 1YT7A 3CBKA 2IPPB 2FRAA 2OZ2A 2P86A 1GECE 2FYEA 4MSXA 4RNAA 1DEUA 2C0YA 1NQCA 2FTDA 1MEGA 4MI7A 4N79A 1DF0A 2NQGA 3DF0A 3HWNA 4X6HA 1CJLA 2DCBA 2BTWB 2JTCA 2DC7A 2NQIA 2Z84A 1BY8A 1CB5A 1K3BB 2AUZA 4RKXA
chains in the Genus database with same CATH topology
1PE6A 3MORA 4WA6A 4BGFA 3H6SA 2BSZA 4FJCA 1CV8A 3BWKA 1HUCB 1AU4A 3ZUAA 1KHPA 2R9CA 1PPOA 3PW3A 3RVWA 2F1GA 2JQGR 1POPA 1Y4HA 4K7CA 1S4VA 1F2CA 1ITOA 1EWPA 2OP3A 4P6GA 3WXGA 2DCCA 3GCBA 1ICFA 5CVOB 1QDQA 3D6SA 2AYNA 2YJCA 1PIPA 1GLOA 3I06A 2WBFX 1PPPA 3IUTA 1JQPA 2FT2A 5EF4A 1W4TA 2O6XA 3IMAA 1AU3A 3P5VA 3CH3X 4BS6A 4PP1A 1AYWA 3P5WA 2G7YA 2GHUA 2VFBA 1VJVA 1IWDA 4I04A 4OEMA 4CDFB 1EWLA 3S3QA 2R6NA 2HHNA 3K9MA 3KW9A 3MHHA 4FK5A 3WXFA 3BOWA 5J94A 1YALA 2FRQA 2E01A 1ME4A 1U9XA 3KWBX 4FIPA 1XKGA 4MZSA 1AIMA 9PAPA 2XU1A 4PADA 2OULA 1NL6A 2PREA 1GX3A 3KFQA 3NHEA 2AU1A 2AYOA 1AU0A 4XUIA 3KX1A 1NPZA 1PADA 4ZUXU 3H89A 4MZOA 3HHIA 2PNSA 2Y5BA 4YYQA 1U9WA 3BPFA 2XU5A 5CVMA 2E03A 3BPMA 3O0UA 2CIOA 1NLJA 3OF8A 3P5XA 2R9NA 2P0RA 1CSBB 1PPNA 1U9QX 2FUDA 1FH0A 2R9OA 2HH5A 4YYVA 3KKUA 3S3RA 3IV2A 5F02A 4G54A 2BDLA 1QOLA 2G8EA 3E1ZB 4X6JA 1ME3A 1BQIA 4W5CA 4YYRA 1MDWA 3QT4A 2AIMA 3BC3A 1W5RA 2ACTA 4N8WA 4Q8HA 2VHFA 1NB3A 2Y6EA 1CTEA 4YVAA 3N3GA 1ATKA 5CVNB 5K16A 2AS8A 2NQDB 3ERVA 1O0EA 3OVZA 3LFYA 2YJ8A 1THEA 2VFCA 1AYVA 1EWMA 4PI3A 2BDZA 4CDCB 4W5BA 1PPDA 4PP2E 4GUZA 1U5IA 5FPWA 1U9VA 3QJ3A 2CB5A 1EWOA 4BS5A 2PADA 4QBBA 2DZYA 4XR7A 3KSEA 4DMXA 4CZWA 3I3TA 1F29A 3PNRA 2NQAA 4QRVA 5EGWA 3F5VA 2PBHA 1KHQA 1PXVA 3AI8A 7PCKA 3WXEA 5CHVA 2XU4A 3LXSA 1GCBA 1PCIA 1X9YA 3H7DA 1KXRA 1PBHA 3HD3A 2R9FA 2P7UA 4RY2A 1CS8A 1ZCMA 5PADA 3OISA 2YJBA 4QH6A 4YV8A 3V6EA 2E00A 1YVBA 1CVZA 1YK8A 2HXZA 2G6DA 3MHSA 2R9MA 2DZZA 4W4UA 2GFOA 4P6EA 1CPJA 3QSDA 1NB5A 1AYUA 2ATOA 1W6FA 1MIRA 2IBIA 4CDDB 4YYSA 1MS6A 4HWYA 1TU6A 3U8EA 4OELA 4I07A 2ARYA 1Y08A 4YYWA 2DC9A 1A6RA 1F2AA 1VSNA 3IHPA 3P5UA 5CHTA 3F75A 5JA7A 2B1NA 2E02A 3V6CA 2G8JA 3N4CA 1CQDA 2DC8A 1ZIVA 4BPVA 1AU2A 4N4ZA 1BP4A 4Q8GA 1E2TA 1TL9A 5JH3A 3RVVA 2JQFR 2HD5A 1KFUL 3D9WA 3K8UA 2DC6A 3MTNA 2AUXA 1GMYA 4CDEB 3N3KA 2YJ9A 1BGOA 2DJGB 3TNXA 2DCAA 3KWZA 4BQVA 2FO5A 1MHWA 3H8BA 3O1GA 4QRXA 4AXMA 1SNKA 1SP4B 1EF7A 1YK7A 3OF9A 6PADA 2XU3A 2H7JA 1Q6KA 3K24A 2DCDA 4NV7A 5A24A 3CH2X 1TLOA 3PBHA 2FQ9A 4X6IA 3M99A 1M6DA 1STFE 2F7DA 2VHSA 1QXPA 8PCHA 4I05A 3H8CA 3USVA 4AXLA 2YJ2A 4KLBA 4YYUA 3BCNA 1QMYA 3RVXA 3LTWA 4DMYA 4QRGA 3IEJA 3C9EA 3OVXA 3IOQA 1F2BA 1AECA 3HHAA 3CBJA 4BSQA 2DJFB 2AVWA 3B79A 1MEMA 3PDFA 2B1MA 1KFXL 4C5PA 1YT7A 3CBKA 2IPPB 2FRAA 2OZ2A 2P86A 1GECE 2FYEA 4MSXA 4B55A 1DEUA 2C0YA 1NQCA 2FTDA 1MEGA 4NV8A 4N79A 1DF0A 2NQGA 3DF0A 3HWNA 4X6HA 1CJLA 2DCBA 2DC7A 2NQIA 1BY8A 1CB5A 1K3BB 2AUZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PE6 A;  3MOR A;  4WA6 A;  3H6S A;  4FJC A;  1CV8 A;  3BWK A;  1HUC B;  1AU4 A;  3ZUA A;  1KHP A;  2R9C A;  1PPO A;  3PW3 A;  3RVW A;  2F1G A;  2JQG R;  1POP A;  1Y4H A;  4K7C A;  1S4V A;  1F2C A;  1ITO A;  1EWP A;  2OP3 A;  4P6G A;  3WXG A;  2DCC A;  3GCB A;  1ICF A;  5CVO B;  1QDQ A;  3D6S A;  2AYN A;  2YJC A;  1PIP A;  1GLO A;  3I06 A;  2WBF X;  1PPP A;  3IUT A;  1JQP A;  2FT2 A;  5EF4 A;  2O6X A;  3IMA A;  1AU3 A;  3P5V A;  3CH3 X;  4BS6 A;  4PP1 A;  1AYW A;  3P5W A;  2G7Y A;  2GHU A;  1VJV A;  1IWD A;  4I04 A;  4OEM A;  4CDF B;  1EWL A;  3S3Q A;  2R6N A;  2HHN A;  3K9M A;  3KW9 A;  3MHH A;  4FK5 A;  3WXF A;  3BOW A;  5J94 A;  1YAL A;  2FRQ A;  2E01 A;  1ME4 A;  1U9X A;  3KWB X;  4FIP A;  1XKG A;  4MZS A;  1AIM A;  9PAP A;  2XU1 A;  4PAD A;  2OUL A;  1NL6 A;  2PRE A;  3KFQ A;  3NHE A;  2AU1 A;  2AYO A;  1AU0 A;  4XUI A;  3KX1 A;  1NPZ A;  1PAD A;  4ZUX U;  3H89 A;  4MZO A;  3HHI A;  2PNS A;  2Y5B A;  4YYQ A;  1U9W A;  3BPF A;  2XU5 A;  5CVM A;  2E03 A;  3BPM A;  3O0U A;  2CIO A;  1NLJ A;  3OF8 A;  3P5X A;  2R9N A;  2P0R A;  1CSB B;  1PPN A;  1U9Q X;  2FUD A;  1FH0 A;  2R9O A;  2HH5 A;  4YYV A;  3KKU A;  3S3R A;  3IV2 A;  5F02 A;  4G54 A;  2BDL A;  1QOL A;  2G8E A;  3E1Z B;  4X6J A;  1ME3 A;  1BQI A;  4W5C A;  4YYR A;  1MDW A;  3QT4 A;  2AIM A;  3BC3 A;  2ACT A;  4N8W A;  4Q8H A;  2VHF A;  1NB3 A;  2Y6E A;  1CTE A;  4YVA A;  3N3G A;  1ATK A;  5CVN B;  5K16 A;  2AS8 A;  2NQD B;  3ERV A;  1O0E A;  3OVZ A;  3LFY A;  2YJ8 A;  1THE A;  1AYV A;  1EWM A;  4PI3 A;  2BDZ A;  4CDC B;  4W5B A;  1PPD A;  4PP2 E;  1U5I A;  5FPW A;  1U9V A;  3QJ3 A;  2CB5 A;  1EWO A;  4BS5 A;  2PAD A;  4QBB A;  2DZY A;  4XR7 A;  3KSE A;  4DMX A;  4CZW A;  3I3T A;  1F29 A;  3PNR A;  2NQA A;  4QRV A;  5EGW A;  3F5V A;  2PBH A;  1KHQ A;  1PXV A;  3AI8 A;  7PCK A;  3WXE A;  5CHV A;  2XU4 A;  3LXS A;  1GCB A;  1PCI A;  1X9Y A;  3H7D A;  1KXR A;  1PBH A;  3HD3 A;  2R9F A;  2P7U A;  4RY2 A;  1CS8 A;  1ZCM A;  5PAD A;  3OIS A;  2YJB A;  4QH6 A;  4YV8 A;  3V6E A;  2E00 A;  1YVB A;  1CVZ A;  1YK8 A;  2HXZ A;  2G6D A;  3MHS A;  2R9M A;  2DZZ A;  4W4U A;  2GFO A;  4P6E A;  1CPJ A;  3QSD A;  1NB5 A;  1AYU A;  2ATO A;  1MIR A;  2IBI A;  4CDD B;  4YYS A;  1MS6 A;  4HWY A;  1TU6 A;  3U8E A;  4OEL A;  4I07 A;  2ARY A;  1Y08 A;  4YYW A;  2DC9 A;  1A6R A;  1F2A A;  1VSN A;  3IHP A;  3P5U A;  5CHT A;  3F75 A;  5JA7 A;  2B1N A;  2E02 A;  3V6C A;  2G8J A;  3N4C A;  1CQD A;  2DC8 A;  1ZIV A;  4BPV A;  1AU2 A;  4N4Z A;  1BP4 A;  4Q8G A;  1TL9 A;  5JH3 A;  3RVV A;  2JQF R;  2HD5 A;  1KFU L;  3K8U A;  2DC6 A;  3MTN A;  2AUX A;  1GMY A;  4CDE B;  3N3K A;  2YJ9 A;  1BGO A;  2DJG B;  3TNX A;  2DCA A;  3KWZ A;  4BQV A;  2FO5 A;  1MHW A;  3H8B A;  3O1G A;  4QRX A;  4AXM A;  1SNK A;  1SP4 B;  1EF7 A;  1YK7 A;  3OF9 A;  6PAD A;  2XU3 A;  2H7J A;  1Q6K A;  3K24 A;  2DCD A;  5A24 A;  3CH2 X;  1TLO A;  3PBH A;  2FQ9 A;  4X6I A;  3M99 A;  1M6D A;  1STF E;  2F7D A;  2VHS A;  1QXP A;  8PCH A;  4I05 A;  3H8C A;  3USV A;  4AXL A;  2YJ2 A;  4KLB A;  4YYU A;  3BCN A;  1QMY A;  3RVX A;  4DMY A;  4QRG A;  3IEJ A;  3C9E A;  3OVX A;  3IOQ A;  1F2B A;  1AEC A;  3HHA A;  3CBJ A;  4BSQ A;  2DJF B;  2AVW A;  3B79 A;  1MEM A;  3PDF A;  2B1M A;  1KFX L;  1YT7 A;  3CBK A;  2IPP B;  2FRA A;  2OZ2 A;  2P86 A;  1GEC E;  2FYE A;  4MSX A;  1DEU A;  2C0Y A;  1NQC A;  2FTD A;  1MEG A;  4N79 A;  1DF0 A;  2NQG A;  3DF0 A;  3HWN A;  4X6H A;  1CJL A;  2DCB A;  2DC7 A;  2NQI A;  1BY8 A;  1CB5 A;  1K3B B;  2AUZ A; 
#chains in the Genus database with same CATH topology
 1PE6 A;  3MOR A;  4WA6 A;  3H6S A;  4XZX A;  4FJC A;  1PVJ A;  1CV8 A;  3BWK A;  1HUC B;  1AU4 A;  3MP2 A;  3ZUA A;  1KHP A;  2R9C A;  1PPO A;  3PW3 A;  3RVW A;  2F1G A;  2JRI A;  2JQG R;  1POP A;  1Y4H A;  4D8B A;  4K7C A;  1S4V A;  1F2C A;  1ITO A;  1EWP A;  2OP3 A;  4P6G A;  3WXG A;  2DCC A;  3GCB A;  1ICF A;  3BB7 A;  4D8I A;  5CVO B;  2J7Q C;  4D8E A;  1QDQ A;  5EZS A;  3D6S A;  2AYN A;  2YJC A;  5E6J A;  1PIP A;  1GLO A;  3I06 A;  2BTW A;  2WBF X;  1PPP A;  3IUT A;  1JQP A;  2FT2 A;  5EF4 A;  2O6X A;  3IMA A;  1AU3 A;  3P5V A;  3CH3 X;  4BS6 A;  4PP1 A;  1AYW A;  3P5W A;  2G7Y A;  2GHU A;  1VJV A;  1IWD A;  4I04 A;  3PSE A;  4OEM A;  4CDF B;  1EWL A;  3PT2 A;  3S3Q A;  2R6N A;  2HHN A;  4HXD B;  3K9M A;  5EZQ A;  3KW9 A;  1YZB A;  3MHH A;  4FK5 A;  3WXF A;  3BOW A;  5J94 A;  1YAL A;  3PRP A;  2FRQ A;  2E01 A;  1ME4 A;  1U9X A;  3KWB X;  4FIP A;  1XKG A;  4MZS A;  1AIM A;  9PAP A;  2XU1 A;  4PAD A;  2OUL A;  1NL6 A;  2PRE A;  3KFQ A;  3NHE A;  2AU1 A;  2AYO A;  1AU0 A;  4XUI A;  3KX1 A;  1NPZ A;  1PAD A;  4ZUX U;  3H89 A;  4MZO A;  3HHI A;  2PNS A;  2Y5B A;  4P16 A;  4YYQ A;  1U9W A;  3BPF A;  2XU5 A;  5CVM A;  2E03 A;  3PRM A;  3BPM A;  4IP3 A;  3O0U A;  2CIO A;  1NLJ A;  3OF8 A;  3P5X A;  2R9N A;  2P0R A;  1CSB B;  1PPN A;  1U9Q X;  2FUD A;  4REZ A;  5KO3 A;  1FH0 A;  2R9O A;  2HH5 A;  4YYV A;  3KKU A;  4BOQ A;  3S3R A;  3IV2 A;  5F02 A;  3OQC A;  4G54 A;  2BDL A;  1QOL A;  2G8E A;  3E1Z B;  4MM3 B;  4OVZ A;  4X6J A;  3IFU A;  1ME3 A;  1BQI A;  4W5C A;  4IUM A;  4YYR A;  1MDW A;  3QT4 A;  2AIM A;  3BC3 A;  2UZJ A;  2ACT A;  4N8W A;  4Q8H A;  2VHF A;  1NB3 A;  2Y6E A;  1CTE A;  4YVA A;  3N3G A;  1ATK A;  5CVN B;  5K16 A;  3W31 A;  2AS8 A;  2NQD B;  4OW0 A;  3ERV A;  3PHU A;  1O0E A;  3OVZ A;  3LFY A;  2YJ8 A;  1THE A;  4BOP A;  1AYV A;  1EWM A;  4PI3 A;  4BOZ A;  2FE8 A;  2BDZ A;  4CDC B;  4W5B A;  1PPD A;  4PP2 E;  1U5I A;  5FPW A;  3E9S A;  1U9V A;  3QJ3 A;  2CB5 A;  1EWO A;  4BS5 A;  2PAD A;  4QBB A;  2DZY A;  4XR7 A;  4OVZ B;  3TMP A;  3KSE A;  4DMX A;  3RNV A;  4CZW A;  3I3T A;  1F29 A;  3ZNH A;  2AGA A;  3PNR A;  2NQA A;  4QRV A;  5EGW A;  3F5V A;  2PBH A;  1KHQ A;  1PXV A;  2HWK A;  3AI8 A;  7PCK A;  3WXE A;  5CHV A;  2XU4 A;  3LXS A;  1GCB A;  1PCI A;  1X9Y A;  2BU3 A;  3H7D A;  1KXR A;  3TRK A;  1PBH A;  4RF0 A;  3HD3 A;  2R9F A;  2P7U A;  4RY2 A;  1CS8 A;  1ZCM A;  5PAD A;  3OIS A;  2YJB A;  4QH6 A;  4YV8 A;  3B21 A;  3V6E A;  2E00 A;  4A5U A;  1YVB A;  1CVZ A;  1YK8 A;  2HXZ A;  2G6D A;  3MHS A;  2R9M A;  2DZZ A;  4PT5 A;  4W4U A;  2GFO A;  4P6E A;  1CPJ A;  3QSD A;  1NB5 A;  1UKF A;  1AYU A;  2ATO A;  1MIR A;  2IBI A;  3BY4 A;  4CDD B;  4YYS A;  1MS6 A;  4HWY A;  1TU6 A;  3U8E A;  4OEL A;  3PHX A;  4I07 A;  2ARY A;  1Y08 A;  4BOU A;  4YYW A;  2DC9 A;  1A6R A;  1F2A A;  1VSN A;  3IHP A;  3P5U A;  5CHT A;  3F75 A;  5JA7 A;  2B1N A;  3BBA A;  2E02 A;  3V6C A;  2G8J A;  3N4C A;  1CQD A;  2DC8 A;  1ZIV A;  4BPV A;  1AU2 A;  1BP4 A;  2DOS A;  4N4Z A;  4Q8G A;  4GUA A;  1TL9 A;  5JH3 A;  3RVV A;  2JQF R;  2HD5 A;  1KFU L;  4R3D A;  3K8U A;  4RF1 A;  2DC6 A;  3MTN A;  2AUX A;  1GMY A;  4CDE B;  3N3K A;  3C0R A;  2YJ9 A;  1BGO A;  2DJG B;  3TNX A;  2DCA A;  4WUR A;  3KWZ A;  4BQV A;  2FO5 A;  1MHW A;  3PHW A;  5JZE A;  3H8B A;  3O1G A;  2J7Q A;  4QRX A;  4AXM A;  1SNK A;  1SP4 B;  3MJ5 A;  1EF7 A;  1YK7 A;  4M0W A;  3OF9 A;  6PAD A;  2XU3 A;  2H7J A;  1Q6K A;  3K24 A;  2DCD A;  4ZTB A;  5A24 A;  3CH2 X;  1TLO A;  3PBH A;  2FQ9 A;  4X6I A;  3M99 A;  1M6D A;  1STF E;  2F7D A;  2VHS A;  1QXP A;  8PCH A;  4I05 A;  3H8C A;  1DKI A;  3USV A;  4AXL A;  2YJ2 A;  4KLB A;  4YYU A;  3W30 A;  4BOS A;  3BCN A;  1QMY A;  3RVX A;  4DMY A;  4QRG A;  3IEJ A;  3C9E A;  3OVX A;  3IOQ A;  1F2B A;  3O65 A;  1AEC A;  3HHA A;  3CBJ A;  4BSQ A;  2DJF B;  3MTV A;  2AVW A;  3B79 A;  1MEM A;  3PDF A;  2B1M A;  1KFX L;  1YT7 A;  3CBK A;  2IPP B;  2FRA A;  2OZ2 A;  2P86 A;  1GEC E;  2FYE A;  4MSX A;  4RNA A;  1DEU A;  2C0Y A;  1NQC A;  2FTD A;  1MEG A;  4MI7 A;  4N79 A;  1DF0 A;  2NQG A;  3DF0 A;  3HWN A;  4X6H A;  1CJL A;  2DCB A;  2BTW B;  2JTC A;  2DC7 A;  2NQI A;  2Z84 A;  1BY8 A;  1CB5 A;  1K3B B;  2AUZ A;  4RKX A; 
#chains in the Genus database with same CATH homology
 1PE6 A;  3MOR A;  4WA6 A;  4BGF A;  3H6S A;  2BSZ A;  4FJC A;  1CV8 A;  3BWK A;  1HUC B;  1AU4 A;  3ZUA A;  1KHP A;  2R9C A;  1PPO A;  3PW3 A;  3RVW A;  2F1G A;  2JQG R;  1POP A;  1Y4H A;  4K7C A;  1S4V A;  1F2C A;  1ITO A;  1EWP A;  2OP3 A;  4P6G A;  3WXG A;  2DCC A;  3GCB A;  1ICF A;  5CVO B;  1QDQ A;  3D6S A;  2AYN A;  2YJC A;  1PIP A;  1GLO A;  3I06 A;  2WBF X;  1PPP A;  3IUT A;  1JQP A;  2FT2 A;  5EF4 A;  1W4T A;  2O6X A;  3IMA A;  1AU3 A;  3P5V A;  3CH3 X;  4BS6 A;  4PP1 A;  1AYW A;  3P5W A;  2G7Y A;  2GHU A;  2VFB A;  1VJV A;  1IWD A;  4I04 A;  4OEM A;  4CDF B;  1EWL A;  3S3Q A;  2R6N A;  2HHN A;  3K9M A;  3KW9 A;  3MHH A;  4FK5 A;  3WXF A;  3BOW A;  5J94 A;  1YAL A;  2FRQ A;  2E01 A;  1ME4 A;  1U9X A;  3KWB X;  4FIP A;  1XKG A;  4MZS A;  1AIM A;  9PAP A;  2XU1 A;  4PAD A;  2OUL A;  1NL6 A;  2PRE A;  1GX3 A;  3KFQ A;  3NHE A;  2AU1 A;  2AYO A;  1AU0 A;  4XUI A;  3KX1 A;  1NPZ A;  1PAD A;  4ZUX U;  3H89 A;  4MZO A;  3HHI A;  2PNS A;  2Y5B A;  4YYQ A;  1U9W A;  3BPF A;  2XU5 A;  5CVM A;  2E03 A;  3BPM A;  3O0U A;  2CIO A;  1NLJ A;  3OF8 A;  3P5X A;  2R9N A;  2P0R A;  1CSB B;  1PPN A;  1U9Q X;  2FUD A;  1FH0 A;  2R9O A;  2HH5 A;  4YYV A;  3KKU A;  3S3R A;  3IV2 A;  5F02 A;  4G54 A;  2BDL A;  1QOL A;  2G8E A;  3E1Z B;  4X6J A;  1ME3 A;  1BQI A;  4W5C A;  4YYR A;  1MDW A;  3QT4 A;  2AIM A;  3BC3 A;  1W5R A;  2ACT A;  4N8W A;  4Q8H A;  2VHF A;  1NB3 A;  2Y6E A;  1CTE A;  4YVA A;  3N3G A;  1ATK A;  5CVN B;  5K16 A;  2AS8 A;  2NQD B;  3ERV A;  1O0E A;  3OVZ A;  3LFY A;  2YJ8 A;  1THE A;  2VFC A;  1AYV A;  1EWM A;  4PI3 A;  2BDZ A;  4CDC B;  4W5B A;  1PPD A;  4PP2 E;  4GUZ A;  1U5I A;  5FPW A;  1U9V A;  3QJ3 A;  2CB5 A;  1EWO A;  4BS5 A;  2PAD A;  4QBB A;  2DZY A;  4XR7 A;  3KSE A;  4DMX A;  4CZW A;  3I3T A;  1F29 A;  3PNR A;  2NQA A;  4QRV A;  5EGW A;  3F5V A;  2PBH A;  1KHQ A;  1PXV A;  3AI8 A;  7PCK A;  3WXE A;  5CHV A;  2XU4 A;  3LXS A;  1GCB A;  1PCI A;  1X9Y A;  3H7D A;  1KXR A;  1PBH A;  3HD3 A;  2R9F A;  2P7U A;  4RY2 A;  1CS8 A;  1ZCM A;  5PAD A;  3OIS A;  2YJB A;  4QH6 A;  4YV8 A;  3V6E A;  2E00 A;  1YVB A;  1CVZ A;  1YK8 A;  2HXZ A;  2G6D A;  3MHS A;  2R9M A;  2DZZ A;  4W4U A;  2GFO A;  4P6E A;  1CPJ A;  3QSD A;  1NB5 A;  1AYU A;  2ATO A;  1W6F A;  1MIR A;  2IBI A;  4CDD B;  4YYS A;  1MS6 A;  4HWY A;  1TU6 A;  3U8E A;  4OEL A;  4I07 A;  2ARY A;  1Y08 A;  4YYW A;  2DC9 A;  1A6R A;  1F2A A;  1VSN A;  3IHP A;  3P5U A;  5CHT A;  3F75 A;  5JA7 A;  2B1N A;  2E02 A;  3V6C A;  2G8J A;  3N4C A;  1CQD A;  2DC8 A;  1ZIV A;  4BPV A;  1AU2 A;  4N4Z A;  1BP4 A;  4Q8G A;  1E2T A;  1TL9 A;  5JH3 A;  3RVV A;  2JQF R;  2HD5 A;  1KFU L;  3D9W A;  3K8U A;  2DC6 A;  3MTN A;  2AUX A;  1GMY A;  4CDE B;  3N3K A;  2YJ9 A;  1BGO A;  2DJG B;  3TNX A;  2DCA A;  3KWZ A;  4BQV A;  2FO5 A;  1MHW A;  3H8B A;  3O1G A;  4QRX A;  4AXM A;  1SNK A;  1SP4 B;  1EF7 A;  1YK7 A;  3OF9 A;  6PAD A;  2XU3 A;  2H7J A;  1Q6K A;  3K24 A;  2DCD A;  4NV7 A;  5A24 A;  3CH2 X;  1TLO A;  3PBH A;  2FQ9 A;  4X6I A;  3M99 A;  1M6D A;  1STF E;  2F7D A;  2VHS A;  1QXP A;  8PCH A;  4I05 A;  3H8C A;  3USV A;  4AXL A;  2YJ2 A;  4KLB A;  4YYU A;  3BCN A;  1QMY A;  3RVX A;  3LTW A;  4DMY A;  4QRG A;  3IEJ A;  3C9E A;  3OVX A;  3IOQ A;  1F2B A;  1AEC A;  3HHA A;  3CBJ A;  4BSQ A;  2DJF B;  2AVW A;  3B79 A;  1MEM A;  3PDF A;  2B1M A;  1KFX L;  4C5P A;  1YT7 A;  3CBK A;  2IPP B;  2FRA A;  2OZ2 A;  2P86 A;  1GEC E;  2FYE A;  4MSX A;  4B55 A;  1DEU A;  2C0Y A;  1NQC A;  2FTD A;  1MEG A;  4NV8 A;  4N79 A;  1DF0 A;  2NQG A;  3DF0 A;  3HWN A;  4X6H A;  1CJL A;  2DCB A;  2DC7 A;  2NQI A;  1BY8 A;  1CB5 A;  1K3B B;  2AUZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...