2FRAA

Human cathepsin s with cra-27934, a nitrile inhibitor
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
217
structure length
217
Chain Sequence
b'LPDSVDWREKGCVTEVKYQGSCGACWAFSAVGALEAQLKLKTGKLVSLSAQNLVDCSTEKYGNKGCNGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYDSKYRAATCSKYTELPYGREDVLKEAVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSWGHNFGEEGYIRMARNKGNHCGIASFPSYPEI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cathepsin S
publication title Human Cathepsin S with CRA-27934, a Nitrile Inhibitor
rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 66
structure length 217
sequence length 217
chains with identical sequence B
ec nomenclature ec 3.4.22.27: Cathepsin S.
pdb deposition date 2006-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2fraA00
1ZIVA 2XU5A 1HUCB 1VSNA 3HHAA 3P5VA 4FJCA 4AXLA 3LFYA 5J94A 2NQGA 4X6JA 2R9MA 3KWZA 1MEMA 2FO5A 2IPPB 4QH6A 2HH5A 4P6GA 3V6CA 1MEGA 1PXVA 2R9CA 4WA6A 3NHEA 5EGWA 4HWYA 1GLOA 1X9YA 2DCCA 2DC6A 3S3RA 3K24A 4YYQA 1PPDA 5CVMA 3QJ3A 1CS8A 3F75A 3CH3X 2PNSA 4MSXA 2DC9A 3I3TA 3MHSA 4XR7A 2FRQA 4CDCB 3LXSA 2B1MA 3BWKA 3O0UA 4DMXA 1CSBB 2HXZA 4QRVA 8PCHA 5A24A 1U9QX 3H7DA 4FK5A 2DC8A 3PNRA 3N3GA 4PP2E 2XU3A 1AIMA 3QSDA 1NL6A 2OULA 1ME4A 3F5VA 3ERVA 3BC3A 1BP4A 1AU4A 4W4UA 3PBHA 2HD5A 5F02A 1AU2A 1PPOA 5FPWA 1A6RA 1NPZA 1PCIA 3PW3A 2BDZA 3H8CA 1F29A 2G7YA 2AIMA 2F7DA 2Y5BA 2PADA 3IEJA 2G8EA 1KXRA 1ZCMA 1DF0A 3KWBX 2R9OA 1NLJA 2IBIA 3KX1A 2OZ2A 2XU4A 3KSEA 4Q8GA 2FUDA 1BGOA 1Y08A 1POPA 1MDWA 2JQGR 3AI8A 2E03A 5K16A 2G8JA 2CIOA 4QBBA 2WBFX 2YJ2A 4YYRA 3KFQA 7PCKA 2E00A 1CPJA 1ICFA 4OEMA 3E1ZB 2DC7A 1MHWA 1PPNA 1EWPA 4PADA 1KFUL 2B1NA 4BQVA 5JH3A 5CVNB 1SNKA 3P5XA 4CZWA 1EWLA 1Y4HA 3HHIA 3IOQA 1PBHA 1DEUA 2AYNA 4MZOA 4BS6A 1KHQA 2VHFA 1NB3A 4P6EA 1GECE 1ATKA 2G6DA 3WXFA 3DF0A 1IWDA 4N4ZA 3RVWA 2ACTA 3RVVA 2AYOA 3KKUA 1S4VA 1SP4B 4BPVA 1YVBA 1THEA 1AYWA 4YYVA 1YK8A 2ARYA 1GMYA 4QRGA 1YALA 3IV2A 4I05A 1CTEA 1VJVA 3RVXA 4XUIA 4YV8A 4I07A 4CDEB 3HD3A 2YJBA 3C9EA 2JQFR 5EF4A 1CJLA 2C0YA 1TL9A 1PE6A 4AXMA 4YYWA 5CHVA 4PI3A 5CHTA 2DJFB 4PP1A 1ME3A 3OF8A 2OP3A 2CB5A 1NQCA 3H8BA 1KHPA 4FIPA 3BOWA 6PADA 2NQAA 3CBKA 3IUTA 4I04A 2YJ8A 4YVAA 2R9FA 3H6SA 1ITOA 3N4CA 2ATOA 1YK7A 3OISA 1U5IA 2DZYA 2AS8A 2HHNA 1F2AA 2FTDA 1U9XA 3H89A 1QOLA 4OELA 1AECA 3CH2X 3OVXA 3I06A 1CV8A 3HWNA 1U9VA 4CDFB 2AU1A 2AVWA 4X6IA 2DCDA 1FH0A 3MORA 1CB5A 1QXPA 2FYEA 3OVZA 4BSQA 1AYVA 2GFOA 2NQIA 4DMYA 1PADA 3P5UA 1PIPA 4CDDB 1Q6KA 3QT4A 3MTNA 2DCBA 2R6NA 3BCNA 2H7JA 3TNXA 4MZSA 2PBHA 2P7UA 1CVZA 3PDFA 3N3KA 3V6EA 3MHHA 2Y6EA 3M99A 1PPPA 1YT7A 2E02A 1KFXL 3OF9A 4W5CA 1EWOA 2GHUA 3WXGA 2P86A 1F2CA 4RY2A 4Q8HA 2BDLA 1BY8A 1CQDA 1EWMA 3CBJA 4N79A 5PADA 2E01A 1GCBA 3BPFA 1NB5A 1QMYA 1EF7A 3KW9A 1AU0A 1JQPA 2DZZA 3D6SA 3K8UA 2AUZA 4ZUXU 1F2BA 2FT2A 1K3BB 3P5WA 1U9WA 2DJGB 2FQ9A 3BPMA 2FRAA 3O1GA 4KLBA 1TLOA 1BQIA 1AU3A 5CVOB 2NQDB 1MS6A 2DCAA 2AUXA 3S3QA 2XU1A 3K9MA 9PAPA 3U8EA 4YYSA 4G54A 4W5BA 3USVA 2YJ9A 2VHSA 1QDQA 5JA7A 2O6XA 3IMAA 1AYUA 3WXEA 4K7CA 1O0EA 4YYUA 4X6HA 2P0RA 3B79A 2YJCA 1TU6A 3IHPA 4QRXA 4BS5A 1MIRA 1STFE 3ZUAA 2F1GA 2R9NA 2PREA 1XKGA 1M6DA 4N8WA 3GCBA
chains in the Genus database with same CATH superfamily
1ZIVA 2XU5A 1HUCB 1VSNA 3HHAA 3P5VA 4FJCA 4AXLA 3LFYA 5J94A 2NQGA 4X6JA 2R9MA 3KWZA 1MEMA 2FO5A 2IPPB 4OVZB 3PRPA 4QH6A 2HH5A 4P6GA 3BBAA 3V6CA 1MEGA 1PXVA 2R9CA 4WA6A 3NHEA 5EGWA 4HWYA 1GLOA 1X9YA 2DCCA 2DC6A 3BB7A 3S3RA 3K24A 4YYQA 5EZQA 1PPDA 5CVMA 3QJ3A 4REZA 1CS8A 3F75A 3CH3X 2PNSA 4MSXA 2DC9A 3I3TA 3E9SA 3MHSA 4XR7A 2FRQA 2HWKA 4CDCB 3LXSA 2B1MA 3BWKA 3O0UA 4DMXA 1CSBB 4RF1A 2HXZA 4QRVA 8PCHA 3IFUA 5A24A 1U9QX 3H7DA 4FK5A 2DC8A 3PNRA 3N3GA 4PP2E 2XU3A 1AIMA 3QSDA 1NL6A 2OULA 1ME4A 3F5VA 3ERVA 3BC3A 1BP4A 1AU4A 4W4UA 3PBHA 4D8BA 2HD5A 4R3DA 5F02A 1AU2A 4OW0A 1PPOA 5FPWA 1A6RA 1NPZA 1PCIA 2FE8A 3PT2A 3PW3A 2BDZA 3H8CA 1F29A 2G7YA 2AIMA 3W31A 2F7DA 2Y5BA 2PADA 3IEJA 2G8EA 1KXRA 3PHUA 1ZCMA 1DF0A 3KWBX 2R9OA 1NLJA 2IBIA 3KX1A 2OZ2A 2XU4A 3KSEA 4Q8GA 2FUDA 2BTWA 1BGOA 1Y08A 1POPA 1MDWA 4D8EA 2JQGR 3AI8A 2E03A 5K16A 2G8JA 2CIOA 4QBBA 3MTVA 2WBFX 2YJ2A 4YYRA 3KFQA 4GUAA 7PCKA 2E00A 1CPJA 1ICFA 4OEMA 3E1ZB 4WURA 2DC7A 1MHWA 1PPNA 1EWPA 4PADA 3PRMA 1KFUL 4IUMA 2B1NA 4BQVA 5JH3A 5CVNB 1SNKA 3P5XA 4BOZA 4CZWA 1EWLA 1Y4HA 3HHIA 3IOQA 2J7QA 1PBHA 1DEUA 2AYNA 4MZOA 4BS6A 1KHQA 2VHFA 4BOSA 4PT5A 1NB3A 4P6EA 1GECE 1ATKA 2G6DA 3WXFA 3DF0A 4D8IA 1IWDA 4N4ZA 3RVWA 2ACTA 3RVVA 2AYOA 3KKUA 5E6JA 1S4VA 1SP4B 4BPVA 3TRKA 1YVBA 4A5UA 1THEA 1AYWA 4IP3A 4YYVA 1YK8A 2ARYA 1GMYA 4QRGA 1YALA 3IV2A 4I05A 1CTEA 1VJVA 4HXDB 3C0RA 3RVXA 4XUIA 4YV8A 4I07A 4CDEB 4ZTBA 3HD3A 4BOUA 2YJBA 3C9EA 2JQFR 4MM3B 1UKFA 5EF4A 1CJLA 2C0YA 1TL9A 1PE6A 4AXMA 4YYWA 5CHVA 4PI3A 5CHTA 2DJFB 4PP1A 1ME3A 3OF8A 2OP3A 2CB5A 1NQCA 4RKXA 3H8BA 1KHPA 4FIPA 3BOWA 6PADA 2NQAA 3CBKA 3IUTA 4I04A 2YJ8A 4YVAA 2R9FA 3H6SA 1ITOA 3N4CA 2ATOA 1YK7A 3OISA 1U5IA 2DOSA 3PHWA 2DZYA 2AS8A 3ZNHA 2BTWB 2HHNA 1F2AA 2FTDA 1U9XA 3MP2A 2JRIA 3H89A 1QOLA 4OELA 1AECA 3CH2X 3OVXA 3I06A 1CV8A 4P16A 3HWNA 1U9VA 4CDFB 2AU1A 2AVWA 4X6IA 2DCDA 1FH0A 3MORA 1CB5A 1QXPA 2FYEA 3OVZA 4BSQA 1AYVA 5JZEA 3OQCA 2GFOA 2NQIA 3O65A 4DMYA 1PADA 4RF0A 3P5UA 4BOPA 1PIPA 4CDDB 1Q6KA 3QT4A 3MTNA 2DCBA 2R6NA 3BCNA 2H7JA 2Z84A 3TNXA 4MZSA 2PBHA 2P7UA 1CVZA 3PDFA 4MI7A 3N3KA 3V6EA 3MHHA 2Y6EA 3M99A 1PPPA 1YT7A 2E02A 4OVZA 1KFXL 3OF9A 4W5CA 1EWOA 2GHUA 3WXGA 2P86A 1F2CA 4RY2A 2AGAA 3B21A 4Q8HA 2BDLA 1BY8A 1CQDA 1EWMA 3CBJA 3RNVA 4N79A 5PADA 3MJ5A 2E01A 1GCBA 3BPFA 1NB5A 1QMYA 1EF7A 3KW9A 1AU0A 1JQPA 2DZZA 1YZBA 2UZJA 3D6SA 3PHXA 3K8UA 2AUZA 4ZUXU 1F2BA 2FT2A 1K3BB 3P5WA 1U9WA 2DJGB 4M0WA 2FQ9A 3BPMA 1DKIA 1PVJA 2FRAA 3O1GA 3PSEA 4KLBA 1TLOA 1BQIA 1AU3A 5CVOB 3TMPA 2NQDB 1MS6A 2DCAA 2AUXA 3S3QA 2BU3A 4BOQA 2XU1A 3K9MA 9PAPA 3U8EA 4YYSA 4G54A 4W5BA 3USVA 2YJ9A 2VHSA 1QDQA 4XZXA 5JA7A 2O6XA 3IMAA 5EZSA 1AYUA 3W30A 5KO3A 3WXEA 4K7CA 2JTCA 1O0EA 4YYUA 4X6HA 2P0RA 3B79A 2YJCA 2J7QC 1TU6A 3BY4A 4RNAA 3IHPA 4QRXA 4BS5A 1MIRA 1STFE 3ZUAA 2F1GA 2R9NA 2PREA 1XKGA 1M6DA 4N8WA 3GCBA
chains in the Genus database with same CATH topology
1ZIVA 2XU5A 1HUCB 1VSNA 3HHAA 3P5VA 4FJCA 4AXLA 3LFYA 5J94A 2NQGA 4X6JA 2R9MA 3KWZA 1MEMA 2FO5A 2IPPB 4QH6A 2HH5A 4P6GA 3V6CA 1MEGA 1PXVA 2R9CA 4WA6A 3NHEA 5EGWA 4HWYA 1GLOA 1X9YA 2DCCA 2DC6A 3S3RA 3K24A 4YYQA 1PPDA 5CVMA 3QJ3A 3D9WA 1CS8A 3F75A 3CH3X 2PNSA 4MSXA 2DC9A 3I3TA 3MHSA 4XR7A 2FRQA 4CDCB 3LXSA 2B1MA 3BWKA 3O0UA 4DMXA 1CSBB 2HXZA 4QRVA 8PCHA 5A24A 1U9QX 3H7DA 4FK5A 2DC8A 3PNRA 3N3GA 4PP2E 2XU3A 1AIMA 3QSDA 1NL6A 2OULA 1ME4A 3F5VA 3ERVA 3BC3A 1BP4A 1AU4A 4W4UA 3PBHA 4BGFA 2HD5A 5F02A 1AU2A 1PPOA 5FPWA 1A6RA 1NPZA 1PCIA 3PW3A 2BDZA 3H8CA 1F29A 2G7YA 2AIMA 2F7DA 2Y5BA 2PADA 3IEJA 2G8EA 1KXRA 1ZCMA 1DF0A 3KWBX 2R9OA 1NLJA 2IBIA 3KX1A 2OZ2A 2XU4A 3LTWA 3KSEA 4Q8GA 2FUDA 1BGOA 1Y08A 1POPA 1MDWA 2JQGR 3AI8A 2E03A 5K16A 2G8JA 2CIOA 4QBBA 2WBFX 2YJ2A 1W6FA 4YYRA 3KFQA 7PCKA 2E00A 1CPJA 1ICFA 4OEMA 3E1ZB 2DC7A 1MHWA 1PPNA 1EWPA 4PADA 1KFUL 2B1NA 4BQVA 5JH3A 5CVNB 1SNKA 3P5XA 4CZWA 1EWLA 1Y4HA 3HHIA 3IOQA 1PBHA 1DEUA 2AYNA 4MZOA 4BS6A 1KHQA 2VHFA 1NB3A 4P6EA 1GECE 1ATKA 2G6DA 3WXFA 3DF0A 1IWDA 4N4ZA 3RVWA 2ACTA 3RVVA 2AYOA 3KKUA 1S4VA 1SP4B 4BPVA 1YVBA 1THEA 1AYWA 4YYVA 1YK8A 2ARYA 1GMYA 4QRGA 1YALA 3IV2A 4I05A 1CTEA 1VJVA 3RVXA 4XUIA 4YV8A 4I07A 4CDEB 3HD3A 2YJBA 4B55A 3C9EA 2JQFR 5EF4A 1CJLA 2C0YA 1TL9A 1PE6A 4AXMA 4YYWA 5CHVA 4PI3A 5CHTA 2DJFB 4PP1A 1ME3A 3OF8A 2OP3A 2CB5A 1NQCA 3H8BA 1KHPA 4FIPA 3BOWA 6PADA 2NQAA 3CBKA 3IUTA 4I04A 2YJ8A 4YVAA 2R9FA 3H6SA 1ITOA 3N4CA 2ATOA 1YK7A 3OISA 1U5IA 2DZYA 2AS8A 2HHNA 2VFCA 1F2AA 2FTDA 1U9XA 3H89A 1QOLA 4OELA 1AECA 3CH2X 3OVXA 3I06A 1CV8A 3HWNA 1U9VA 4C5PA 4CDFB 2AU1A 2AVWA 4X6IA 2DCDA 1FH0A 3MORA 1CB5A 1QXPA 2FYEA 3OVZA 4BSQA 1AYVA 4NV7A 2GFOA 2NQIA 4DMYA 1PADA 3P5UA 1PIPA 4CDDB 1Q6KA 3QT4A 3MTNA 2DCBA 2R6NA 3BCNA 2H7JA 3TNXA 4MZSA 2PBHA 2P7UA 1CVZA 3PDFA 3N3KA 3V6EA 3MHHA 2Y6EA 1W4TA 3M99A 1PPPA 1W5RA 1YT7A 2E02A 1KFXL 3OF9A 4W5CA 1EWOA 2GHUA 3WXGA 2P86A 1F2CA 4RY2A 4Q8HA 2BDLA 1BY8A 1CQDA 1EWMA 3CBJA 4N79A 5PADA 2E01A 1GCBA 3BPFA 1NB5A 1QMYA 1EF7A 3KW9A 1AU0A 1JQPA 2DZZA 3D6SA 3K8UA 1GX3A 2AUZA 4ZUXU 1F2BA 2FT2A 1K3BB 3P5WA 1U9WA 2DJGB 2FQ9A 3BPMA 2FRAA 3O1GA 4KLBA 1TLOA 1BQIA 1AU3A 5CVOB 2NQDB 1MS6A 2DCAA 2AUXA 3S3QA 2BSZA 2XU1A 3K9MA 9PAPA 3U8EA 4YYSA 4G54A 4W5BA 3USVA 2YJ9A 2VHSA 1QDQA 5JA7A 2O6XA 3IMAA 1AYUA 2VFBA 3WXEA 4K7CA 1O0EA 4YYUA 4X6HA 2P0RA 3B79A 2YJCA 1TU6A 3IHPA 4NV8A 4QRXA 4BS5A 1MIRA 1STFE 3ZUAA 2F1GA 1E2TA 2R9NA 2PREA 4GUZA 1XKGA 1M6DA 4N8WA 3GCBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZIV A;  2XU5 A;  1HUC B;  1VSN A;  3HHA A;  3P5V A;  4FJC A;  4AXL A;  3LFY A;  5J94 A;  2NQG A;  4X6J A;  2R9M A;  3KWZ A;  1MEM A;  2FO5 A;  2IPP B;  4QH6 A;  2HH5 A;  4P6G A;  3V6C A;  1MEG A;  1PXV A;  2R9C A;  4WA6 A;  3NHE A;  5EGW A;  4HWY A;  1GLO A;  1X9Y A;  2DCC A;  2DC6 A;  3S3R A;  3K24 A;  4YYQ A;  1PPD A;  5CVM A;  3QJ3 A;  1CS8 A;  3F75 A;  3CH3 X;  2PNS A;  4MSX A;  2DC9 A;  3I3T A;  3MHS A;  4XR7 A;  2FRQ A;  4CDC B;  3LXS A;  2B1M A;  3BWK A;  3O0U A;  4DMX A;  1CSB B;  2HXZ A;  4QRV A;  8PCH A;  5A24 A;  1U9Q X;  3H7D A;  4FK5 A;  2DC8 A;  3PNR A;  3N3G A;  4PP2 E;  2XU3 A;  1AIM A;  3QSD A;  1NL6 A;  2OUL A;  1ME4 A;  3F5V A;  3ERV A;  3BC3 A;  1BP4 A;  1AU4 A;  4W4U A;  3PBH A;  2HD5 A;  5F02 A;  1AU2 A;  1PPO A;  5FPW A;  1A6R A;  1NPZ A;  1PCI A;  3PW3 A;  2BDZ A;  3H8C A;  1F29 A;  2G7Y A;  2AIM A;  2F7D A;  2Y5B A;  2PAD A;  3IEJ A;  2G8E A;  1KXR A;  1ZCM A;  1DF0 A;  3KWB X;  2R9O A;  1NLJ A;  2IBI A;  3KX1 A;  2OZ2 A;  2XU4 A;  3KSE A;  4Q8G A;  2FUD A;  1BGO A;  1Y08 A;  1POP A;  1MDW A;  2JQG R;  3AI8 A;  2E03 A;  5K16 A;  2G8J A;  2CIO A;  4QBB A;  2WBF X;  2YJ2 A;  4YYR A;  3KFQ A;  7PCK A;  2E00 A;  1CPJ A;  1ICF A;  4OEM A;  3E1Z B;  2DC7 A;  1MHW A;  1PPN A;  1EWP A;  4PAD A;  1KFU L;  2B1N A;  4BQV A;  5JH3 A;  5CVN B;  1SNK A;  3P5X A;  4CZW A;  1EWL A;  1Y4H A;  3HHI A;  3IOQ A;  1PBH A;  1DEU A;  2AYN A;  4MZO A;  4BS6 A;  1KHQ A;  2VHF A;  1NB3 A;  4P6E A;  1GEC E;  1ATK A;  2G6D A;  3WXF A;  3DF0 A;  1IWD A;  4N4Z A;  3RVW A;  2ACT A;  3RVV A;  2AYO A;  3KKU A;  1S4V A;  1SP4 B;  4BPV A;  1YVB A;  1THE A;  1AYW A;  4YYV A;  1YK8 A;  2ARY A;  1GMY A;  4QRG A;  1YAL A;  3IV2 A;  4I05 A;  1CTE A;  1VJV A;  3RVX A;  4XUI A;  4YV8 A;  4I07 A;  4CDE B;  3HD3 A;  2YJB A;  3C9E A;  2JQF R;  5EF4 A;  1CJL A;  2C0Y A;  1TL9 A;  1PE6 A;  4AXM A;  4YYW A;  5CHV A;  4PI3 A;  5CHT A;  2DJF B;  4PP1 A;  1ME3 A;  3OF8 A;  2OP3 A;  2CB5 A;  1NQC A;  3H8B A;  1KHP A;  4FIP A;  3BOW A;  6PAD A;  2NQA A;  3CBK A;  3IUT A;  4I04 A;  2YJ8 A;  4YVA A;  2R9F A;  3H6S A;  1ITO A;  3N4C A;  2ATO A;  1YK7 A;  3OIS A;  1U5I A;  2DZY A;  2AS8 A;  2HHN A;  1F2A A;  2FTD A;  1U9X A;  3H89 A;  1QOL A;  4OEL A;  1AEC A;  3CH2 X;  3OVX A;  3I06 A;  1CV8 A;  3HWN A;  1U9V A;  4CDF B;  2AU1 A;  2AVW A;  4X6I A;  2DCD A;  1FH0 A;  3MOR A;  1CB5 A;  1QXP A;  2FYE A;  3OVZ A;  4BSQ A;  1AYV A;  2GFO A;  2NQI A;  4DMY A;  1PAD A;  3P5U A;  1PIP A;  4CDD B;  1Q6K A;  3QT4 A;  3MTN A;  2DCB A;  2R6N A;  3BCN A;  2H7J A;  3TNX A;  4MZS A;  2PBH A;  2P7U A;  1CVZ A;  3PDF A;  3N3K A;  3V6E A;  3MHH A;  2Y6E A;  3M99 A;  1PPP A;  1YT7 A;  2E02 A;  1KFX L;  3OF9 A;  4W5C A;  1EWO A;  2GHU A;  3WXG A;  2P86 A;  1F2C A;  4RY2 A;  4Q8H A;  2BDL A;  1BY8 A;  1CQD A;  1EWM A;  3CBJ A;  4N79 A;  5PAD A;  2E01 A;  1GCB A;  3BPF A;  1NB5 A;  1QMY A;  1EF7 A;  3KW9 A;  1AU0 A;  1JQP A;  2DZZ A;  3D6S A;  3K8U A;  2AUZ A;  4ZUX U;  1F2B A;  2FT2 A;  1K3B B;  3P5W A;  1U9W A;  2DJG B;  2FQ9 A;  3BPM A;  2FRA A;  3O1G A;  4KLB A;  1TLO A;  1BQI A;  1AU3 A;  5CVO B;  2NQD B;  1MS6 A;  2DCA A;  2AUX A;  3S3Q A;  2XU1 A;  3K9M A;  9PAP A;  3U8E A;  4YYS A;  4G54 A;  4W5B A;  3USV A;  2YJ9 A;  2VHS A;  1QDQ A;  5JA7 A;  2O6X A;  3IMA A;  1AYU A;  3WXE A;  4K7C A;  1O0E A;  4YYU A;  4X6H A;  2P0R A;  3B79 A;  2YJC A;  1TU6 A;  3IHP A;  4QRX A;  4BS5 A;  1MIR A;  1STF E;  3ZUA A;  2F1G A;  2R9N A;  2PRE A;  1XKG A;  1M6D A;  4N8W A;  3GCB A; 
#chains in the Genus database with same CATH topology
 1ZIV A;  2XU5 A;  1HUC B;  1VSN A;  3HHA A;  3P5V A;  4FJC A;  4AXL A;  3LFY A;  5J94 A;  2NQG A;  4X6J A;  2R9M A;  3KWZ A;  1MEM A;  2FO5 A;  2IPP B;  4OVZ B;  3PRP A;  4QH6 A;  2HH5 A;  4P6G A;  3BBA A;  3V6C A;  1MEG A;  1PXV A;  2R9C A;  4WA6 A;  3NHE A;  5EGW A;  4HWY A;  1GLO A;  1X9Y A;  2DCC A;  2DC6 A;  3BB7 A;  3S3R A;  3K24 A;  4YYQ A;  5EZQ A;  1PPD A;  5CVM A;  3QJ3 A;  4REZ A;  1CS8 A;  3F75 A;  3CH3 X;  2PNS A;  4MSX A;  2DC9 A;  3I3T A;  3E9S A;  3MHS A;  4XR7 A;  2FRQ A;  2HWK A;  4CDC B;  3LXS A;  2B1M A;  3BWK A;  3O0U A;  4DMX A;  1CSB B;  4RF1 A;  2HXZ A;  4QRV A;  8PCH A;  3IFU A;  5A24 A;  1U9Q X;  3H7D A;  4FK5 A;  2DC8 A;  3PNR A;  3N3G A;  4PP2 E;  2XU3 A;  1AIM A;  3QSD A;  1NL6 A;  2OUL A;  1ME4 A;  3F5V A;  3ERV A;  3BC3 A;  1BP4 A;  1AU4 A;  4W4U A;  3PBH A;  4D8B A;  2HD5 A;  4R3D A;  5F02 A;  1AU2 A;  4OW0 A;  1PPO A;  5FPW A;  1A6R A;  1NPZ A;  1PCI A;  2FE8 A;  3PT2 A;  3PW3 A;  2BDZ A;  3H8C A;  1F29 A;  2G7Y A;  2AIM A;  3W31 A;  2F7D A;  2Y5B A;  2PAD A;  3IEJ A;  2G8E A;  1KXR A;  3PHU A;  1ZCM A;  1DF0 A;  3KWB X;  2R9O A;  1NLJ A;  2IBI A;  3KX1 A;  2OZ2 A;  2XU4 A;  3KSE A;  4Q8G A;  2FUD A;  2BTW A;  1BGO A;  1Y08 A;  1POP A;  1MDW A;  4D8E A;  2JQG R;  3AI8 A;  2E03 A;  5K16 A;  2G8J A;  2CIO A;  4QBB A;  3MTV A;  2WBF X;  2YJ2 A;  4YYR A;  3KFQ A;  4GUA A;  7PCK A;  2E00 A;  1CPJ A;  1ICF A;  4OEM A;  3E1Z B;  4WUR A;  2DC7 A;  1MHW A;  1PPN A;  1EWP A;  4PAD A;  3PRM A;  1KFU L;  4IUM A;  2B1N A;  4BQV A;  5JH3 A;  5CVN B;  1SNK A;  3P5X A;  4BOZ A;  4CZW A;  1EWL A;  1Y4H A;  3HHI A;  3IOQ A;  2J7Q A;  1PBH A;  1DEU A;  2AYN A;  4MZO A;  4BS6 A;  1KHQ A;  2VHF A;  4BOS A;  4PT5 A;  1NB3 A;  4P6E A;  1GEC E;  1ATK A;  2G6D A;  3WXF A;  3DF0 A;  4D8I A;  1IWD A;  4N4Z A;  3RVW A;  2ACT A;  3RVV A;  2AYO A;  3KKU A;  5E6J A;  1S4V A;  1SP4 B;  4BPV A;  3TRK A;  1YVB A;  4A5U A;  1THE A;  1AYW A;  4IP3 A;  4YYV A;  1YK8 A;  2ARY A;  1GMY A;  4QRG A;  1YAL A;  3IV2 A;  4I05 A;  1CTE A;  1VJV A;  4HXD B;  3C0R A;  3RVX A;  4XUI A;  4YV8 A;  4I07 A;  4CDE B;  4ZTB A;  3HD3 A;  4BOU A;  2YJB A;  3C9E A;  2JQF R;  4MM3 B;  1UKF A;  5EF4 A;  1CJL A;  2C0Y A;  1TL9 A;  1PE6 A;  4AXM A;  4YYW A;  5CHV A;  4PI3 A;  5CHT A;  2DJF B;  4PP1 A;  1ME3 A;  3OF8 A;  2OP3 A;  2CB5 A;  1NQC A;  4RKX A;  3H8B A;  1KHP A;  4FIP A;  3BOW A;  6PAD A;  2NQA A;  3CBK A;  3IUT A;  4I04 A;  2YJ8 A;  4YVA A;  2R9F A;  3H6S A;  1ITO A;  3N4C A;  2ATO A;  1YK7 A;  3OIS A;  1U5I A;  2DOS A;  3PHW A;  2DZY A;  2AS8 A;  3ZNH A;  2BTW B;  2HHN A;  1F2A A;  2FTD A;  1U9X A;  3MP2 A;  2JRI A;  3H89 A;  1QOL A;  4OEL A;  1AEC A;  3CH2 X;  3OVX A;  3I06 A;  1CV8 A;  4P16 A;  3HWN A;  1U9V A;  4CDF B;  2AU1 A;  2AVW A;  4X6I A;  2DCD A;  1FH0 A;  3MOR A;  1CB5 A;  1QXP A;  2FYE A;  3OVZ A;  4BSQ A;  1AYV A;  5JZE A;  3OQC A;  2GFO A;  2NQI A;  3O65 A;  4DMY A;  1PAD A;  4RF0 A;  3P5U A;  4BOP A;  1PIP A;  4CDD B;  1Q6K A;  3QT4 A;  3MTN A;  2DCB A;  2R6N A;  3BCN A;  2H7J A;  2Z84 A;  3TNX A;  4MZS A;  2PBH A;  2P7U A;  1CVZ A;  3PDF A;  4MI7 A;  3N3K A;  3V6E A;  3MHH A;  2Y6E A;  3M99 A;  1PPP A;  1YT7 A;  2E02 A;  4OVZ A;  1KFX L;  3OF9 A;  4W5C A;  1EWO A;  2GHU A;  3WXG A;  2P86 A;  1F2C A;  4RY2 A;  2AGA A;  3B21 A;  4Q8H A;  2BDL A;  1BY8 A;  1CQD A;  1EWM A;  3CBJ A;  3RNV A;  4N79 A;  5PAD A;  3MJ5 A;  2E01 A;  1GCB A;  3BPF A;  1NB5 A;  1QMY A;  1EF7 A;  3KW9 A;  1AU0 A;  1JQP A;  2DZZ A;  1YZB A;  2UZJ A;  3D6S A;  3PHX A;  3K8U A;  2AUZ A;  4ZUX U;  1F2B A;  2FT2 A;  1K3B B;  3P5W A;  1U9W A;  2DJG B;  4M0W A;  2FQ9 A;  3BPM A;  1DKI A;  1PVJ A;  2FRA A;  3O1G A;  3PSE A;  4KLB A;  1TLO A;  1BQI A;  1AU3 A;  5CVO B;  3TMP A;  2NQD B;  1MS6 A;  2DCA A;  2AUX A;  3S3Q A;  2BU3 A;  4BOQ A;  2XU1 A;  3K9M A;  9PAP A;  3U8E A;  4YYS A;  4G54 A;  4W5B A;  3USV A;  2YJ9 A;  2VHS A;  1QDQ A;  4XZX A;  5JA7 A;  2O6X A;  3IMA A;  5EZS A;  1AYU A;  3W30 A;  5KO3 A;  3WXE A;  4K7C A;  2JTC A;  1O0E A;  4YYU A;  4X6H A;  2P0R A;  3B79 A;  2YJC A;  2J7Q C;  1TU6 A;  3BY4 A;  4RNA A;  3IHP A;  4QRX A;  4BS5 A;  1MIR A;  1STF E;  3ZUA A;  2F1G A;  2R9N A;  2PRE A;  1XKG A;  1M6D A;  4N8W A;  3GCB A; 
#chains in the Genus database with same CATH homology
 1ZIV A;  2XU5 A;  1HUC B;  1VSN A;  3HHA A;  3P5V A;  4FJC A;  4AXL A;  3LFY A;  5J94 A;  2NQG A;  4X6J A;  2R9M A;  3KWZ A;  1MEM A;  2FO5 A;  2IPP B;  4QH6 A;  2HH5 A;  4P6G A;  3V6C A;  1MEG A;  1PXV A;  2R9C A;  4WA6 A;  3NHE A;  5EGW A;  4HWY A;  1GLO A;  1X9Y A;  2DCC A;  2DC6 A;  3S3R A;  3K24 A;  4YYQ A;  1PPD A;  5CVM A;  3QJ3 A;  3D9W A;  1CS8 A;  3F75 A;  3CH3 X;  2PNS A;  4MSX A;  2DC9 A;  3I3T A;  3MHS A;  4XR7 A;  2FRQ A;  4CDC B;  3LXS A;  2B1M A;  3BWK A;  3O0U A;  4DMX A;  1CSB B;  2HXZ A;  4QRV A;  8PCH A;  5A24 A;  1U9Q X;  3H7D A;  4FK5 A;  2DC8 A;  3PNR A;  3N3G A;  4PP2 E;  2XU3 A;  1AIM A;  3QSD A;  1NL6 A;  2OUL A;  1ME4 A;  3F5V A;  3ERV A;  3BC3 A;  1BP4 A;  1AU4 A;  4W4U A;  3PBH A;  4BGF A;  2HD5 A;  5F02 A;  1AU2 A;  1PPO A;  5FPW A;  1A6R A;  1NPZ A;  1PCI A;  3PW3 A;  2BDZ A;  3H8C A;  1F29 A;  2G7Y A;  2AIM A;  2F7D A;  2Y5B A;  2PAD A;  3IEJ A;  2G8E A;  1KXR A;  1ZCM A;  1DF0 A;  3KWB X;  2R9O A;  1NLJ A;  2IBI A;  3KX1 A;  2OZ2 A;  2XU4 A;  3LTW A;  3KSE A;  4Q8G A;  2FUD A;  1BGO A;  1Y08 A;  1POP A;  1MDW A;  2JQG R;  3AI8 A;  2E03 A;  5K16 A;  2G8J A;  2CIO A;  4QBB A;  2WBF X;  2YJ2 A;  1W6F A;  4YYR A;  3KFQ A;  7PCK A;  2E00 A;  1CPJ A;  1ICF A;  4OEM A;  3E1Z B;  2DC7 A;  1MHW A;  1PPN A;  1EWP A;  4PAD A;  1KFU L;  2B1N A;  4BQV A;  5JH3 A;  5CVN B;  1SNK A;  3P5X A;  4CZW A;  1EWL A;  1Y4H A;  3HHI A;  3IOQ A;  1PBH A;  1DEU A;  2AYN A;  4MZO A;  4BS6 A;  1KHQ A;  2VHF A;  1NB3 A;  4P6E A;  1GEC E;  1ATK A;  2G6D A;  3WXF A;  3DF0 A;  1IWD A;  4N4Z A;  3RVW A;  2ACT A;  3RVV A;  2AYO A;  3KKU A;  1S4V A;  1SP4 B;  4BPV A;  1YVB A;  1THE A;  1AYW A;  4YYV A;  1YK8 A;  2ARY A;  1GMY A;  4QRG A;  1YAL A;  3IV2 A;  4I05 A;  1CTE A;  1VJV A;  3RVX A;  4XUI A;  4YV8 A;  4I07 A;  4CDE B;  3HD3 A;  2YJB A;  4B55 A;  3C9E A;  2JQF R;  5EF4 A;  1CJL A;  2C0Y A;  1TL9 A;  1PE6 A;  4AXM A;  4YYW A;  5CHV A;  4PI3 A;  5CHT A;  2DJF B;  4PP1 A;  1ME3 A;  3OF8 A;  2OP3 A;  2CB5 A;  1NQC A;  3H8B A;  1KHP A;  4FIP A;  3BOW A;  6PAD A;  2NQA A;  3CBK A;  3IUT A;  4I04 A;  2YJ8 A;  4YVA A;  2R9F A;  3H6S A;  1ITO A;  3N4C A;  2ATO A;  1YK7 A;  3OIS A;  1U5I A;  2DZY A;  2AS8 A;  2HHN A;  2VFC A;  1F2A A;  2FTD A;  1U9X A;  3H89 A;  1QOL A;  4OEL A;  1AEC A;  3CH2 X;  3OVX A;  3I06 A;  1CV8 A;  3HWN A;  1U9V A;  4C5P A;  4CDF B;  2AU1 A;  2AVW A;  4X6I A;  2DCD A;  1FH0 A;  3MOR A;  1CB5 A;  1QXP A;  2FYE A;  3OVZ A;  4BSQ A;  1AYV A;  4NV7 A;  2GFO A;  2NQI A;  4DMY A;  1PAD A;  3P5U A;  1PIP A;  4CDD B;  1Q6K A;  3QT4 A;  3MTN A;  2DCB A;  2R6N A;  3BCN A;  2H7J A;  3TNX A;  4MZS A;  2PBH A;  2P7U A;  1CVZ A;  3PDF A;  3N3K A;  3V6E A;  3MHH A;  2Y6E A;  1W4T A;  3M99 A;  1PPP A;  1W5R A;  1YT7 A;  2E02 A;  1KFX L;  3OF9 A;  4W5C A;  1EWO A;  2GHU A;  3WXG A;  2P86 A;  1F2C A;  4RY2 A;  4Q8H A;  2BDL A;  1BY8 A;  1CQD A;  1EWM A;  3CBJ A;  4N79 A;  5PAD A;  2E01 A;  1GCB A;  3BPF A;  1NB5 A;  1QMY A;  1EF7 A;  3KW9 A;  1AU0 A;  1JQP A;  2DZZ A;  3D6S A;  3K8U A;  1GX3 A;  2AUZ A;  4ZUX U;  1F2B A;  2FT2 A;  1K3B B;  3P5W A;  1U9W A;  2DJG B;  2FQ9 A;  3BPM A;  2FRA A;  3O1G A;  4KLB A;  1TLO A;  1BQI A;  1AU3 A;  5CVO B;  2NQD B;  1MS6 A;  2DCA A;  2AUX A;  3S3Q A;  2BSZ A;  2XU1 A;  3K9M A;  9PAP A;  3U8E A;  4YYS A;  4G54 A;  4W5B A;  3USV A;  2YJ9 A;  2VHS A;  1QDQ A;  5JA7 A;  2O6X A;  3IMA A;  1AYU A;  2VFB A;  3WXE A;  4K7C A;  1O0E A;  4YYU A;  4X6H A;  2P0R A;  3B79 A;  2YJC A;  1TU6 A;  3IHP A;  4NV8 A;  4QRX A;  4BS5 A;  1MIR A;  1STF E;  3ZUA A;  2F1G A;  1E2T A;  2R9N A;  2PRE A;  4GUZ A;  1XKG A;  1M6D A;  4N8W A;  3GCB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...