2FRAA

Human cathepsin s with cra-27934, a nitrile inhibitor
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
217
structure length
217
Chain Sequence
LPDSVDWREKGCVTEVKYQGSCGACWAFSAVGALEAQLKLKTGKLVSLSAQNLVDCSTEKYGNKGCNGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYDSKYRAATCSKYTELPYGREDVLKEAVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSWGHNFGEEGYIRMARNKGNHCGIASFPSYPEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords cathepsin S
publication title Human Cathepsin S with CRA-27934, a Nitrile Inhibitor
rcsb
source organism Homo sapiens
total genus 66
structure length 217
sequence length 217
chains with identical sequence B
ec nomenclature ec 3.4.22.27: Cathepsin S.
pdb deposition date 2006-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2fraA00
6PADA 2YJ2A 4OEMA 1NPZA 5PADA 4YVAA 1YALA 1PADA 1ME3A 5CVMA 3MTNA 1NB5A 2AVWA 3V6CA 3WXFA 4W4UA 5CHVA 4QRGA 2Y5BA 4QRVA 1AYWA 3HWNA 1A6RA 3QT4A 3RVXA 1PE6A 3KWBX 1F29A 4QBBA 3KW9A 3N3GA 3ZUAA 2DJGB 4XR7A 4G54A 1F2AA 3P5VA 2F1GA 2R9CA 1PCIA 3K24A 4N4ZA 1AYUA 4N8WA 2YJBA 1NLJA 2HH5A 2FUDA 1CS8A 1PPDA 1ATKA 3PNRA 2G7YA 3KFQA 3HHIA 4P6GA 3CBKA 1F2BA 1TL9A 1QMYA 1M6DA 2AU1A 3P5WA 1CSBB 4CDDB 2JQFR 3QSDA 1AU0A 2B1NA 3OVZA 1EWPA 1FH0A 3U8EA 1GLOA 1DF0A 5CHTA 2AUZA 1BGOA 2R9MA 5F02A 1KXRA 2FT2A 4I05A 3K8UA 5JH3A 3B79A 1QXPA 2AYNA 1PBHA 3BPMA 4CDCB 4Q8HA 3IEJA 3HD3A 2YJ8A 4X6HA 3S3QA 3QJ3A 1Y4HA 1AECA 1MIRA 2E00A 1PPPA 2AIMA 3F5VA 3M99A 2G6DA 3KKUA 3PW3A 2P0RA 1ZIVA 1TLOA 1U9WA 3C9EA 4YYWA 3TNXA 2NQGA 2DC7A 4YYUA 3KSEA 3I3TA 2P7UA 4FJCA 2H7JA 4YYVA 5JA7A 4MSXA 1MDWA 4BPVA 3BC3A 4K7CA 9PAPA 1EWOA 1KHPA 2B1MA 8PCHA 2R6NA 4YYRA 3IHPA 1U9QX 1EF7A 4W5BA 4OELA 5EF4A 2XU5A 3CBJA 2DZYA 3I06A 2CIOA 3USVA 3RVVA 2DCAA 3GCBA 1AU4A 3NHEA 2F7DA 4MZOA 1EWLA 1YK8A 3BWKA 4MZSA 3IOQA 4YV8A 4HWYA 1YVBA 3AI8A 1AU3A 1XKGA 3H89A 2Y6EA 3ERVA 2BDLA 2CB5A 1U5IA 4BS5A 4W5CA 2DCCA 1MEGA 1Q6KA 3OVXA 1MHWA 1JQPA 4DMXA 2DZZA 4QH6A 2G8EA 1U9XA 2OZ2A 2R9FA 1KHQA 3MHHA 1AU2A 1KFXL 2HXZA 4RY2A 3N4CA 4PP1A 3O0UA 1YK7A 2OP3A 1PPNA 3OISA 3CH2X 5EGWA 4I04A 1PIPA 2IBIA 1YT7A 2YJ9A 1Y08A 2DC6A 1ME4A 2C0YA 1CTEA 1GECE 3H8CA 1DEUA 4QRXA 1GCBA 3E1ZB 2FO5A 2ARYA 2VHSA 3KWZA 2PNSA 1K3BB 4PP2E 3KX1A 2DC8A 1CPJA 1QOLA 3IV2A 5K16A 2HHNA 1VSNA 1HUCB 4YYSA 4X6JA 1CJLA 4P6EA 5J94A 3HHAA 2YJCA 2G8JA 1F2CA 2R9NA 1PPOA 1SNKA 1NQCA 2FRQA 3S3RA 2FQ9A 3WXGA 4BQVA 3OF8A 2GHUA 3BCNA 1X9YA 2NQAA 2JQGR 2GFOA 4YYQA 3PBHA 3H8BA 3IUTA 1STFE 1PXVA 2PADA 2OULA 4AXLA 2VHFA 1SP4B 2AYOA 3D6SA 2PREA 1BQIA 1NL6A 3H6SA 4BSQA 2DCBA 2FRAA 7PCKA 2NQDB 2XU3A 4BS6A 1AIMA 2IPPB 1GMYA 2WBFX 2E03A 3MHSA 4KLBA 1QDQA 3K9MA 4FK5A 3N3KA 3DF0A 2HD5A 3RVWA 3MORA 1AYVA 3F75A 4I07A 3LXSA 1CVZA 3V6EA 2DJFB 3BPFA 3OF9A 4ZUXU 3WXEA 2ACTA 3IMAA 1THEA 1POPA 4DMYA 2XU1A 4FIPA 1ITOA 1MEMA 2P86A 1KFUL 4CDFB 2NQIA 4CZWA 3LFYA 4PADA 4XUIA 3PDFA 1EWMA 5CVNB 1ICFA 5CVOB 2DC9A 1O0EA 5A24A 2R9OA 2XU4A 2ATOA 1VJVA 4CDEB 1S4VA 1U9VA 4X6IA 2O6XA 4WA6A 4N79A 2FYEA 1CB5A 1TU6A 3P5XA 2BDZA 4PI3A 1BY8A 1CV8A 3BOWA 1IWDA 1BP4A 2E01A 2E02A 1CQDA 3O1GA 2AUXA 4AXMA 1MS6A 2FTDA 2DCDA 1ZCMA 3CH3X 3H7DA 2AS8A 4Q8GA 5FPWA 3P5UA 1NB3A 2PBHA
chains in the Genus database with same CATH superfamily
6PADA 2YJ2A 4OEMA 1NPZA 5PADA 3B21A 4YVAA 1YALA 1PADA 1ME3A 5CVMA 3MTNA 1NB5A 2AVWA 3V6CA 3WXFA 4W4UA 5CHVA 4QRGA 2Y5BA 4QRVA 1AYWA 3HWNA 4MI7A 1A6RA 3QT4A 1PVJA 3PT2A 3RVXA 1PE6A 3KWBX 1F29A 4QBBA 3KW9A 3N3GA 3ZUAA 2DJGB 1YZBA 4XR7A 4XZXA 4G54A 1F2AA 3P5VA 4D8EA 3W31A 2F1GA 4M0WA 3MP2A 5EZQA 2R9CA 1PCIA 3K24A 4N4ZA 1AYUA 4N8WA 2YJBA 1NLJA 2HH5A 2FUDA 1CS8A 1PPDA 1ATKA 3PNRA 2G7YA 3KFQA 3HHIA 4P6GA 3CBKA 1F2BA 1TL9A 2BU3A 1QMYA 1M6DA 2AU1A 3P5WA 1CSBB 4CDDB 4MM3B 2JQFR 3PRMA 3QSDA 1AU0A 2B1NA 3OVZA 1EWPA 1FH0A 3U8EA 3PHXA 1GLOA 1DF0A 5CHTA 2AUZA 1BGOA 4A5UA 2R9MA 4IUMA 5F02A 3IFUA 1KXRA 2FT2A 2FE8A 4I05A 3K8UA 5JH3A 3B79A 1QXPA 2AYNA 1PBHA 3BPMA 4CDCB 4Q8HA 3IEJA 2JTCA 3HD3A 2YJ8A 4X6HA 3S3QA 3QJ3A 1Y4HA 1AECA 1DKIA 1MIRA 2E00A 1PPPA 2AIMA 3PRPA 3F5VA 3M99A 2G6DA 3KKUA 3PW3A 2P0RA 3E9SA 1ZIVA 3ZNHA 1TLOA 1U9WA 3C9EA 4YYWA 3TNXA 4R3DA 2NQGA 2DC7A 4YYUA 3KSEA 3I3TA 4OW0A 4GUAA 2P7UA 4FJCA 3W30A 4BOQA 2H7JA 4YYVA 5JA7A 4MSXA 1MDWA 2J7QC 4BPVA 3RNVA 3BC3A 4K7CA 9PAPA 1EWOA 1KHPA 2B1MA 2AGAA 8PCHA 2R6NA 4YYRA 3IHPA 3OQCA 2JRIA 1U9QX 1EF7A 4W5BA 4D8BA 3TMPA 4OELA 5EF4A 2XU5A 3CBJA 3TRKA 2HWKA 2DZYA 3I06A 2CIOA 4PT5A 3USVA 3RVVA 2DCAA 3GCBA 1AU4A 3NHEA 2F7DA 3O65A 4MZOA 1EWLA 1YK8A 3BWKA 4MZSA 3IOQA 4YV8A 4HWYA 1YVBA 3AI8A 4P16A 3BY4A 1AU3A 1XKGA 4RKXA 3H89A 2Y6EA 3ERVA 2BDLA 2CB5A 1U5IA 4BS5A 4W5CA 2DCCA 1MEGA 1Q6KA 3OVXA 1MHWA 1JQPA 4DMXA 2DZZA 4QH6A 2G8EA 1U9XA 2OZ2A 2R9FA 1KHQA 3MHHA 1AU2A 1KFXL 2HXZA 3PHUA 4RY2A 3C0RA 3N4CA 4PP1A 5EZSA 3O0UA 1YK7A 2OP3A 1PPNA 3OISA 3CH2X 5EGWA 4I04A 2BTWB 1PIPA 2IBIA 1YT7A 2YJ9A 5JZEA 1Y08A 2DC6A 4BOSA 1ME4A 2C0YA 1CTEA 1GECE 3H8CA 1DEUA 4QRXA 1GCBA 3E1ZB 2FO5A 2ARYA 2VHSA 4REZA 4OVZB 3KWZA 2PNSA 1K3BB 4PP2E 3KX1A 2DC8A 1CPJA 3MJ5A 1QOLA 3IV2A 5K16A 2HHNA 1VSNA 4IP3A 1HUCB 4YYSA 4X6JA 1CJLA 4P6EA 5J94A 3HHAA 2YJCA 2G8JA 1F2CA 2R9NA 1PPOA 1SNKA 1NQCA 2FRQA 3S3RA 2FQ9A 3WXGA 4BQVA 5KO3A 4ZTBA 3OF8A 2GHUA 3BCNA 4RF1A 1X9YA 2NQAA 2JQGR 2GFOA 4YYQA 3PBHA 2DOSA 1UKFA 3H8BA 3IUTA 2J7QA 1STFE 1PXVA 4BOPA 2PADA 4D8IA 2OULA 4AXLA 2VHFA 1SP4B 2AYOA 3D6SA 2PREA 3BBAA 1BQIA 1NL6A 3H6SA 4BSQA 2DCBA 4HXDB 2FRAA 7PCKA 3PSEA 2NQDB 2XU3A 4BS6A 1AIMA 2IPPB 1GMYA 2WBFX 2E03A 4BOUA 3MHSA 4KLBA 1QDQA 3K9MA 4FK5A 3N3KA 3DF0A 2HD5A 3RVWA 3MORA 1AYVA 3F75A 4I07A 3LXSA 1CVZA 3V6EA 4RNAA 2DJFB 3BPFA 3PHWA 3OF9A 4ZUXU 3WXEA 2ACTA 3IMAA 1THEA 1POPA 4DMYA 2XU1A 4FIPA 1ITOA 1MEMA 2P86A 1KFUL 4CDFB 2NQIA 4CZWA 3LFYA 3BB7A 4PADA 4XUIA 3PDFA 1EWMA 5CVNB 3MTVA 1ICFA 5CVOB 2DC9A 1O0EA 5A24A 2R9OA 2XU4A 2ATOA 1VJVA 4CDEB 1S4VA 1U9VA 4WURA 4X6IA 2O6XA 4WA6A 5E6JA 4RF0A 4N79A 4BOZA 2FYEA 1CB5A 1TU6A 2UZJA 3P5XA 2BDZA 4PI3A 1BY8A 1CV8A 3BOWA 2Z84A 1IWDA 1BP4A 2E01A 2E02A 2BTWA 1CQDA 3O1GA 2AUXA 4AXMA 1MS6A 2FTDA 2DCDA 1ZCMA 3CH3X 3H7DA 2AS8A 4Q8GA 4OVZA 5FPWA 3P5UA 1NB3A 2PBHA
chains in the Genus database with same CATH topology
6PADA 2YJ2A 4OEMA 1NPZA 5PADA 3LTWA 4YVAA 1YALA 1W6FA 1PADA 1ME3A 5CVMA 3MTNA 1NB5A 2AVWA 3V6CA 3WXFA 4W4UA 5CHVA 4QRGA 2Y5BA 4QRVA 1AYWA 3HWNA 2VFBA 1A6RA 3QT4A 3RVXA 1PE6A 3KWBX 1F29A 4QBBA 3KW9A 3N3GA 3ZUAA 2DJGB 4XR7A 4G54A 1F2AA 3P5VA 4NV8A 2F1GA 2R9CA 1PCIA 3K24A 4N4ZA 1AYUA 4N8WA 2YJBA 1NLJA 2HH5A 2FUDA 1CS8A 1PPDA 1ATKA 3PNRA 2G7YA 3KFQA 3HHIA 4P6GA 3CBKA 1F2BA 1TL9A 1QMYA 1M6DA 2AU1A 3P5WA 1CSBB 4CDDB 2JQFR 3QSDA 1AU0A 2B1NA 3OVZA 2VFCA 1EWPA 1FH0A 3U8EA 1GLOA 1DF0A 5CHTA 4C5PA 2AUZA 1BGOA 2R9MA 5F02A 1KXRA 2FT2A 4I05A 3K8UA 5JH3A 3B79A 1QXPA 2AYNA 1PBHA 3BPMA 4CDCB 4Q8HA 3IEJA 3HD3A 2YJ8A 4X6HA 3S3QA 3QJ3A 1Y4HA 1AECA 1MIRA 2E00A 1PPPA 2AIMA 3F5VA 3M99A 2G6DA 3KKUA 3PW3A 2P0RA 1ZIVA 1TLOA 2BSZA 1U9WA 3C9EA 4YYWA 3TNXA 2NQGA 2DC7A 4YYUA 3KSEA 3I3TA 2P7UA 4FJCA 1W4TA 2H7JA 4YYVA 5JA7A 4MSXA 1MDWA 4BPVA 3BC3A 4K7CA 9PAPA 1EWOA 1KHPA 2B1MA 4GUZA 8PCHA 2R6NA 4YYRA 3IHPA 1U9QX 1EF7A 4W5BA 4OELA 5EF4A 2XU5A 3CBJA 2DZYA 3I06A 2CIOA 3USVA 3RVVA 2DCAA 3GCBA 1AU4A 3NHEA 2F7DA 4MZOA 1EWLA 1YK8A 3BWKA 4MZSA 3IOQA 4YV8A 4HWYA 1YVBA 3AI8A 1AU3A 1XKGA 3H89A 2Y6EA 3ERVA 2BDLA 2CB5A 1U5IA 4BS5A 4W5CA 2DCCA 1MEGA 1Q6KA 3OVXA 1MHWA 1JQPA 4DMXA 2DZZA 4QH6A 2G8EA 1U9XA 2OZ2A 2R9FA 1KHQA 3MHHA 1AU2A 1KFXL 2HXZA 4RY2A 3N4CA 4PP1A 3O0UA 1YK7A 2OP3A 1PPNA 3OISA 3CH2X 5EGWA 4I04A 1PIPA 2IBIA 1YT7A 2YJ9A 1Y08A 2DC6A 1ME4A 2C0YA 1CTEA 1GECE 3H8CA 1DEUA 4QRXA 1GCBA 3E1ZB 2FO5A 2ARYA 2VHSA 3KWZA 2PNSA 1K3BB 4PP2E 3KX1A 2DC8A 1CPJA 1QOLA 3IV2A 5K16A 2HHNA 1VSNA 1HUCB 4YYSA 4X6JA 1CJLA 4P6EA 5J94A 3HHAA 2YJCA 2G8JA 1F2CA 2R9NA 1PPOA 1SNKA 1NQCA 2FRQA 3S3RA 2FQ9A 3WXGA 4BQVA 3OF8A 2GHUA 4B55A 3BCNA 1X9YA 2NQAA 2JQGR 2GFOA 4YYQA 3PBHA 3H8BA 3IUTA 4NV7A 1STFE 1PXVA 2PADA 2OULA 4AXLA 2VHFA 1SP4B 2AYOA 3D6SA 2PREA 1BQIA 1NL6A 3H6SA 4BSQA 1W5RA 2DCBA 2FRAA 1E2TA 7PCKA 2NQDB 2XU3A 4BS6A 1AIMA 2IPPB 1GMYA 2WBFX 2E03A 3MHSA 4KLBA 1QDQA 3K9MA 4FK5A 3N3KA 3D9WA 3DF0A 2HD5A 3RVWA 3MORA 1AYVA 3F75A 4I07A 3LXSA 1CVZA 3V6EA 2DJFB 3BPFA 3OF9A 4BGFA 4ZUXU 3WXEA 2ACTA 3IMAA 1THEA 1POPA 4DMYA 2XU1A 4FIPA 1ITOA 1MEMA 2P86A 1KFUL 4CDFB 2NQIA 4CZWA 3LFYA 4PADA 4XUIA 3PDFA 1EWMA 5CVNB 1ICFA 5CVOB 2DC9A 1O0EA 5A24A 2R9OA 2XU4A 2ATOA 1VJVA 4CDEB 1S4VA 1U9VA 4X6IA 2O6XA 4WA6A 4N79A 2FYEA 1CB5A 1TU6A 3P5XA 2BDZA 4PI3A 1BY8A 1CV8A 3BOWA 1IWDA 1BP4A 2E01A 2E02A 1CQDA 3O1GA 2AUXA 4AXMA 1MS6A 2FTDA 2DCDA 1ZCMA 3CH3X 3H7DA 2AS8A 4Q8GA 5FPWA 1GX3A 3P5UA 1NB3A 2PBHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 6PAD A;  2YJ2 A;  4OEM A;  1NPZ A;  5PAD A;  4YVA A;  1YAL A;  1PAD A;  1ME3 A;  5CVM A;  3MTN A;  1NB5 A;  2AVW A;  3V6C A;  3WXF A;  4W4U A;  5CHV A;  4QRG A;  2Y5B A;  4QRV A;  1AYW A;  3HWN A;  1A6R A;  3QT4 A;  3RVX A;  1PE6 A;  3KWB X;  1F29 A;  4QBB A;  3KW9 A;  3N3G A;  3ZUA A;  2DJG B;  4XR7 A;  4G54 A;  1F2A A;  3P5V A;  2F1G A;  2R9C A;  1PCI A;  3K24 A;  4N4Z A;  1AYU A;  4N8W A;  2YJB A;  1NLJ A;  2HH5 A;  2FUD A;  1CS8 A;  1PPD A;  1ATK A;  3PNR A;  2G7Y A;  3KFQ A;  3HHI A;  4P6G A;  3CBK A;  1F2B A;  1TL9 A;  1QMY A;  1M6D A;  2AU1 A;  3P5W A;  1CSB B;  4CDD B;  2JQF R;  3QSD A;  1AU0 A;  2B1N A;  3OVZ A;  1EWP A;  1FH0 A;  3U8E A;  1GLO A;  1DF0 A;  5CHT A;  2AUZ A;  1BGO A;  2R9M A;  5F02 A;  1KXR A;  2FT2 A;  4I05 A;  3K8U A;  5JH3 A;  3B79 A;  1QXP A;  2AYN A;  1PBH A;  3BPM A;  4CDC B;  4Q8H A;  3IEJ A;  3HD3 A;  2YJ8 A;  4X6H A;  3S3Q A;  3QJ3 A;  1Y4H A;  1AEC A;  1MIR A;  2E00 A;  1PPP A;  2AIM A;  3F5V A;  3M99 A;  2G6D A;  3KKU A;  3PW3 A;  2P0R A;  1ZIV A;  1TLO A;  1U9W A;  3C9E A;  4YYW A;  3TNX A;  2NQG A;  2DC7 A;  4YYU A;  3KSE A;  3I3T A;  2P7U A;  4FJC A;  2H7J A;  4YYV A;  5JA7 A;  4MSX A;  1MDW A;  4BPV A;  3BC3 A;  4K7C A;  9PAP A;  1EWO A;  1KHP A;  2B1M A;  8PCH A;  2R6N A;  4YYR A;  3IHP A;  1U9Q X;  1EF7 A;  4W5B A;  4OEL A;  5EF4 A;  2XU5 A;  3CBJ A;  2DZY A;  3I06 A;  2CIO A;  3USV A;  3RVV A;  2DCA A;  3GCB A;  1AU4 A;  3NHE A;  2F7D A;  4MZO A;  1EWL A;  1YK8 A;  3BWK A;  4MZS A;  3IOQ A;  4YV8 A;  4HWY A;  1YVB A;  3AI8 A;  1AU3 A;  1XKG A;  3H89 A;  2Y6E A;  3ERV A;  2BDL A;  2CB5 A;  1U5I A;  4BS5 A;  4W5C A;  2DCC A;  1MEG A;  1Q6K A;  3OVX A;  1MHW A;  1JQP A;  4DMX A;  2DZZ A;  4QH6 A;  2G8E A;  1U9X A;  2OZ2 A;  2R9F A;  1KHQ A;  3MHH A;  1AU2 A;  1KFX L;  2HXZ A;  4RY2 A;  3N4C A;  4PP1 A;  3O0U A;  1YK7 A;  2OP3 A;  1PPN A;  3OIS A;  3CH2 X;  5EGW A;  4I04 A;  1PIP A;  2IBI A;  1YT7 A;  2YJ9 A;  1Y08 A;  2DC6 A;  1ME4 A;  2C0Y A;  1CTE A;  1GEC E;  3H8C A;  1DEU A;  4QRX A;  1GCB A;  3E1Z B;  2FO5 A;  2ARY A;  2VHS A;  3KWZ A;  2PNS A;  1K3B B;  4PP2 E;  3KX1 A;  2DC8 A;  1CPJ A;  1QOL A;  3IV2 A;  5K16 A;  2HHN A;  1VSN A;  1HUC B;  4YYS A;  4X6J A;  1CJL A;  4P6E A;  5J94 A;  3HHA A;  2YJC A;  2G8J A;  1F2C A;  2R9N A;  1PPO A;  1SNK A;  1NQC A;  2FRQ A;  3S3R A;  2FQ9 A;  3WXG A;  4BQV A;  3OF8 A;  2GHU A;  3BCN A;  1X9Y A;  2NQA A;  2JQG R;  2GFO A;  4YYQ A;  3PBH A;  3H8B A;  3IUT A;  1STF E;  1PXV A;  2PAD A;  2OUL A;  4AXL A;  2VHF A;  1SP4 B;  2AYO A;  3D6S A;  2PRE A;  1BQI A;  1NL6 A;  3H6S A;  4BSQ A;  2DCB A;  2FRA A;  7PCK A;  2NQD B;  2XU3 A;  4BS6 A;  1AIM A;  2IPP B;  1GMY A;  2WBF X;  2E03 A;  3MHS A;  4KLB A;  1QDQ A;  3K9M A;  4FK5 A;  3N3K A;  3DF0 A;  2HD5 A;  3RVW A;  3MOR A;  1AYV A;  3F75 A;  4I07 A;  3LXS A;  1CVZ A;  3V6E A;  2DJF B;  3BPF A;  3OF9 A;  4ZUX U;  3WXE A;  2ACT A;  3IMA A;  1THE A;  1POP A;  4DMY A;  2XU1 A;  4FIP A;  1ITO A;  1MEM A;  2P86 A;  1KFU L;  4CDF B;  2NQI A;  4CZW A;  3LFY A;  4PAD A;  4XUI A;  3PDF A;  1EWM A;  5CVN B;  1ICF A;  5CVO B;  2DC9 A;  1O0E A;  5A24 A;  2R9O A;  2XU4 A;  2ATO A;  1VJV A;  4CDE B;  1S4V A;  1U9V A;  4X6I A;  2O6X A;  4WA6 A;  4N79 A;  2FYE A;  1CB5 A;  1TU6 A;  3P5X A;  2BDZ A;  4PI3 A;  1BY8 A;  1CV8 A;  3BOW A;  1IWD A;  1BP4 A;  2E01 A;  2E02 A;  1CQD A;  3O1G A;  2AUX A;  4AXM A;  1MS6 A;  2FTD A;  2DCD A;  1ZCM A;  3CH3 X;  3H7D A;  2AS8 A;  4Q8G A;  5FPW A;  3P5U A;  1NB3 A;  2PBH A; 
#chains in the Genus database with same CATH topology
 6PAD A;  2YJ2 A;  4OEM A;  1NPZ A;  5PAD A;  3B21 A;  4YVA A;  1YAL A;  1PAD A;  1ME3 A;  5CVM A;  3MTN A;  1NB5 A;  2AVW A;  3V6C A;  3WXF A;  4W4U A;  5CHV A;  4QRG A;  2Y5B A;  4QRV A;  1AYW A;  3HWN A;  4MI7 A;  1A6R A;  3QT4 A;  1PVJ A;  3PT2 A;  3RVX A;  1PE6 A;  3KWB X;  1F29 A;  4QBB A;  3KW9 A;  3N3G A;  3ZUA A;  2DJG B;  1YZB A;  4XR7 A;  4XZX A;  4G54 A;  1F2A A;  3P5V A;  4D8E A;  3W31 A;  2F1G A;  4M0W A;  3MP2 A;  5EZQ A;  2R9C A;  1PCI A;  3K24 A;  4N4Z A;  1AYU A;  4N8W A;  2YJB A;  1NLJ A;  2HH5 A;  2FUD A;  1CS8 A;  1PPD A;  1ATK A;  3PNR A;  2G7Y A;  3KFQ A;  3HHI A;  4P6G A;  3CBK A;  1F2B A;  1TL9 A;  2BU3 A;  1QMY A;  1M6D A;  2AU1 A;  3P5W A;  1CSB B;  4CDD B;  4MM3 B;  2JQF R;  3PRM A;  3QSD A;  1AU0 A;  2B1N A;  3OVZ A;  1EWP A;  1FH0 A;  3U8E A;  3PHX A;  1GLO A;  1DF0 A;  5CHT A;  2AUZ A;  1BGO A;  4A5U A;  2R9M A;  4IUM A;  5F02 A;  3IFU A;  1KXR A;  2FT2 A;  2FE8 A;  4I05 A;  3K8U A;  5JH3 A;  3B79 A;  1QXP A;  2AYN A;  1PBH A;  3BPM A;  4CDC B;  4Q8H A;  3IEJ A;  2JTC A;  3HD3 A;  2YJ8 A;  4X6H A;  3S3Q A;  3QJ3 A;  1Y4H A;  1AEC A;  1DKI A;  1MIR A;  2E00 A;  1PPP A;  2AIM A;  3PRP A;  3F5V A;  3M99 A;  2G6D A;  3KKU A;  3PW3 A;  2P0R A;  3E9S A;  1ZIV A;  3ZNH A;  1TLO A;  1U9W A;  3C9E A;  4YYW A;  3TNX A;  4R3D A;  2NQG A;  2DC7 A;  4YYU A;  3KSE A;  3I3T A;  4OW0 A;  4GUA A;  2P7U A;  4FJC A;  3W30 A;  4BOQ A;  2H7J A;  4YYV A;  5JA7 A;  4MSX A;  1MDW A;  2J7Q C;  4BPV A;  3RNV A;  3BC3 A;  4K7C A;  9PAP A;  1EWO A;  1KHP A;  2B1M A;  2AGA A;  8PCH A;  2R6N A;  4YYR A;  3IHP A;  3OQC A;  2JRI A;  1U9Q X;  1EF7 A;  4W5B A;  4D8B A;  3TMP A;  4OEL A;  5EF4 A;  2XU5 A;  3CBJ A;  3TRK A;  2HWK A;  2DZY A;  3I06 A;  2CIO A;  4PT5 A;  3USV A;  3RVV A;  2DCA A;  3GCB A;  1AU4 A;  3NHE A;  2F7D A;  3O65 A;  4MZO A;  1EWL A;  1YK8 A;  3BWK A;  4MZS A;  3IOQ A;  4YV8 A;  4HWY A;  1YVB A;  3AI8 A;  4P16 A;  3BY4 A;  1AU3 A;  1XKG A;  4RKX A;  3H89 A;  2Y6E A;  3ERV A;  2BDL A;  2CB5 A;  1U5I A;  4BS5 A;  4W5C A;  2DCC A;  1MEG A;  1Q6K A;  3OVX A;  1MHW A;  1JQP A;  4DMX A;  2DZZ A;  4QH6 A;  2G8E A;  1U9X A;  2OZ2 A;  2R9F A;  1KHQ A;  3MHH A;  1AU2 A;  1KFX L;  2HXZ A;  3PHU A;  4RY2 A;  3C0R A;  3N4C A;  4PP1 A;  5EZS A;  3O0U A;  1YK7 A;  2OP3 A;  1PPN A;  3OIS A;  3CH2 X;  5EGW A;  4I04 A;  2BTW B;  1PIP A;  2IBI A;  1YT7 A;  2YJ9 A;  5JZE A;  1Y08 A;  2DC6 A;  4BOS A;  1ME4 A;  2C0Y A;  1CTE A;  1GEC E;  3H8C A;  1DEU A;  4QRX A;  1GCB A;  3E1Z B;  2FO5 A;  2ARY A;  2VHS A;  4REZ A;  4OVZ B;  3KWZ A;  2PNS A;  1K3B B;  4PP2 E;  3KX1 A;  2DC8 A;  1CPJ A;  3MJ5 A;  1QOL A;  3IV2 A;  5K16 A;  2HHN A;  1VSN A;  4IP3 A;  1HUC B;  4YYS A;  4X6J A;  1CJL A;  4P6E A;  5J94 A;  3HHA A;  2YJC A;  2G8J A;  1F2C A;  2R9N A;  1PPO A;  1SNK A;  1NQC A;  2FRQ A;  3S3R A;  2FQ9 A;  3WXG A;  4BQV A;  5KO3 A;  4ZTB A;  3OF8 A;  2GHU A;  3BCN A;  4RF1 A;  1X9Y A;  2NQA A;  2JQG R;  2GFO A;  4YYQ A;  3PBH A;  2DOS A;  1UKF A;  3H8B A;  3IUT A;  2J7Q A;  1STF E;  1PXV A;  4BOP A;  2PAD A;  4D8I A;  2OUL A;  4AXL A;  2VHF A;  1SP4 B;  2AYO A;  3D6S A;  2PRE A;  3BBA A;  1BQI A;  1NL6 A;  3H6S A;  4BSQ A;  2DCB A;  4HXD B;  2FRA A;  7PCK A;  3PSE A;  2NQD B;  2XU3 A;  4BS6 A;  1AIM A;  2IPP B;  1GMY A;  2WBF X;  2E03 A;  4BOU A;  3MHS A;  4KLB A;  1QDQ A;  3K9M A;  4FK5 A;  3N3K A;  3DF0 A;  2HD5 A;  3RVW A;  3MOR A;  1AYV A;  3F75 A;  4I07 A;  3LXS A;  1CVZ A;  3V6E A;  4RNA A;  2DJF B;  3BPF A;  3PHW A;  3OF9 A;  4ZUX U;  3WXE A;  2ACT A;  3IMA A;  1THE A;  1POP A;  4DMY A;  2XU1 A;  4FIP A;  1ITO A;  1MEM A;  2P86 A;  1KFU L;  4CDF B;  2NQI A;  4CZW A;  3LFY A;  3BB7 A;  4PAD A;  4XUI A;  3PDF A;  1EWM A;  5CVN B;  3MTV A;  1ICF A;  5CVO B;  2DC9 A;  1O0E A;  5A24 A;  2R9O A;  2XU4 A;  2ATO A;  1VJV A;  4CDE B;  1S4V A;  1U9V A;  4WUR A;  4X6I A;  2O6X A;  4WA6 A;  5E6J A;  4RF0 A;  4N79 A;  4BOZ A;  2FYE A;  1CB5 A;  1TU6 A;  2UZJ A;  3P5X A;  2BDZ A;  4PI3 A;  1BY8 A;  1CV8 A;  3BOW A;  2Z84 A;  1IWD A;  1BP4 A;  2E01 A;  2E02 A;  2BTW A;  1CQD A;  3O1G A;  2AUX A;  4AXM A;  1MS6 A;  2FTD A;  2DCD A;  1ZCM A;  3CH3 X;  3H7D A;  2AS8 A;  4Q8G A;  4OVZ A;  5FPW A;  3P5U A;  1NB3 A;  2PBH A; 
#chains in the Genus database with same CATH homology
 6PAD A;  2YJ2 A;  4OEM A;  1NPZ A;  5PAD A;  3LTW A;  4YVA A;  1YAL A;  1W6F A;  1PAD A;  1ME3 A;  5CVM A;  3MTN A;  1NB5 A;  2AVW A;  3V6C A;  3WXF A;  4W4U A;  5CHV A;  4QRG A;  2Y5B A;  4QRV A;  1AYW A;  3HWN A;  2VFB A;  1A6R A;  3QT4 A;  3RVX A;  1PE6 A;  3KWB X;  1F29 A;  4QBB A;  3KW9 A;  3N3G A;  3ZUA A;  2DJG B;  4XR7 A;  4G54 A;  1F2A A;  3P5V A;  4NV8 A;  2F1G A;  2R9C A;  1PCI A;  3K24 A;  4N4Z A;  1AYU A;  4N8W A;  2YJB A;  1NLJ A;  2HH5 A;  2FUD A;  1CS8 A;  1PPD A;  1ATK A;  3PNR A;  2G7Y A;  3KFQ A;  3HHI A;  4P6G A;  3CBK A;  1F2B A;  1TL9 A;  1QMY A;  1M6D A;  2AU1 A;  3P5W A;  1CSB B;  4CDD B;  2JQF R;  3QSD A;  1AU0 A;  2B1N A;  3OVZ A;  2VFC A;  1EWP A;  1FH0 A;  3U8E A;  1GLO A;  1DF0 A;  5CHT A;  4C5P A;  2AUZ A;  1BGO A;  2R9M A;  5F02 A;  1KXR A;  2FT2 A;  4I05 A;  3K8U A;  5JH3 A;  3B79 A;  1QXP A;  2AYN A;  1PBH A;  3BPM A;  4CDC B;  4Q8H A;  3IEJ A;  3HD3 A;  2YJ8 A;  4X6H A;  3S3Q A;  3QJ3 A;  1Y4H A;  1AEC A;  1MIR A;  2E00 A;  1PPP A;  2AIM A;  3F5V A;  3M99 A;  2G6D A;  3KKU A;  3PW3 A;  2P0R A;  1ZIV A;  1TLO A;  2BSZ A;  1U9W A;  3C9E A;  4YYW A;  3TNX A;  2NQG A;  2DC7 A;  4YYU A;  3KSE A;  3I3T A;  2P7U A;  4FJC A;  1W4T A;  2H7J A;  4YYV A;  5JA7 A;  4MSX A;  1MDW A;  4BPV A;  3BC3 A;  4K7C A;  9PAP A;  1EWO A;  1KHP A;  2B1M A;  4GUZ A;  8PCH A;  2R6N A;  4YYR A;  3IHP A;  1U9Q X;  1EF7 A;  4W5B A;  4OEL A;  5EF4 A;  2XU5 A;  3CBJ A;  2DZY A;  3I06 A;  2CIO A;  3USV A;  3RVV A;  2DCA A;  3GCB A;  1AU4 A;  3NHE A;  2F7D A;  4MZO A;  1EWL A;  1YK8 A;  3BWK A;  4MZS A;  3IOQ A;  4YV8 A;  4HWY A;  1YVB A;  3AI8 A;  1AU3 A;  1XKG A;  3H89 A;  2Y6E A;  3ERV A;  2BDL A;  2CB5 A;  1U5I A;  4BS5 A;  4W5C A;  2DCC A;  1MEG A;  1Q6K A;  3OVX A;  1MHW A;  1JQP A;  4DMX A;  2DZZ A;  4QH6 A;  2G8E A;  1U9X A;  2OZ2 A;  2R9F A;  1KHQ A;  3MHH A;  1AU2 A;  1KFX L;  2HXZ A;  4RY2 A;  3N4C A;  4PP1 A;  3O0U A;  1YK7 A;  2OP3 A;  1PPN A;  3OIS A;  3CH2 X;  5EGW A;  4I04 A;  1PIP A;  2IBI A;  1YT7 A;  2YJ9 A;  1Y08 A;  2DC6 A;  1ME4 A;  2C0Y A;  1CTE A;  1GEC E;  3H8C A;  1DEU A;  4QRX A;  1GCB A;  3E1Z B;  2FO5 A;  2ARY A;  2VHS A;  3KWZ A;  2PNS A;  1K3B B;  4PP2 E;  3KX1 A;  2DC8 A;  1CPJ A;  1QOL A;  3IV2 A;  5K16 A;  2HHN A;  1VSN A;  1HUC B;  4YYS A;  4X6J A;  1CJL A;  4P6E A;  5J94 A;  3HHA A;  2YJC A;  2G8J A;  1F2C A;  2R9N A;  1PPO A;  1SNK A;  1NQC A;  2FRQ A;  3S3R A;  2FQ9 A;  3WXG A;  4BQV A;  3OF8 A;  2GHU A;  4B55 A;  3BCN A;  1X9Y A;  2NQA A;  2JQG R;  2GFO A;  4YYQ A;  3PBH A;  3H8B A;  3IUT A;  4NV7 A;  1STF E;  1PXV A;  2PAD A;  2OUL A;  4AXL A;  2VHF A;  1SP4 B;  2AYO A;  3D6S A;  2PRE A;  1BQI A;  1NL6 A;  3H6S A;  4BSQ A;  1W5R A;  2DCB A;  2FRA A;  1E2T A;  7PCK A;  2NQD B;  2XU3 A;  4BS6 A;  1AIM A;  2IPP B;  1GMY A;  2WBF X;  2E03 A;  3MHS A;  4KLB A;  1QDQ A;  3K9M A;  4FK5 A;  3N3K A;  3D9W A;  3DF0 A;  2HD5 A;  3RVW A;  3MOR A;  1AYV A;  3F75 A;  4I07 A;  3LXS A;  1CVZ A;  3V6E A;  2DJF B;  3BPF A;  3OF9 A;  4BGF A;  4ZUX U;  3WXE A;  2ACT A;  3IMA A;  1THE A;  1POP A;  4DMY A;  2XU1 A;  4FIP A;  1ITO A;  1MEM A;  2P86 A;  1KFU L;  4CDF B;  2NQI A;  4CZW A;  3LFY A;  4PAD A;  4XUI A;  3PDF A;  1EWM A;  5CVN B;  1ICF A;  5CVO B;  2DC9 A;  1O0E A;  5A24 A;  2R9O A;  2XU4 A;  2ATO A;  1VJV A;  4CDE B;  1S4V A;  1U9V A;  4X6I A;  2O6X A;  4WA6 A;  4N79 A;  2FYE A;  1CB5 A;  1TU6 A;  3P5X A;  2BDZ A;  4PI3 A;  1BY8 A;  1CV8 A;  3BOW A;  1IWD A;  1BP4 A;  2E01 A;  2E02 A;  1CQD A;  3O1G A;  2AUX A;  4AXM A;  1MS6 A;  2FTD A;  2DCD A;  1ZCM A;  3CH3 X;  3H7D A;  2AS8 A;  4Q8G A;  5FPW A;  1GX3 A;  3P5U A;  1NB3 A;  2PBH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...