1F29A

Crystal structure analysis of cruzain bound to a vinyl sulfone derived inhibitor (i)
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
215
structure length
215
Chain Sequence
APAAVDWRARGAVTAVKDQGQCGSCWAFSAIGNVECQWFLAGHPLTNLSEQMLVSCDKTDSGCSGGLMNNAFEWIVQENNGAVYTEDSYPYASGEGISPPCTTSGHTVGATITGHVELPQDEAQIAAWLAVNGPVAVAVDASSWMTYTGGVMTSCVSEQLDHGVLLVGYNDSAAVPYWIIKNSWTTQWGEEGYIRIAKGSNQCLVKEEASSAVVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords CRUZAIN
publication title A target within the target: probing cruzain's P1' site to define structural determinants for the Chagas' disease protease.
pubmed doi rcsb
source organism Trypanosoma cruzi
total genus 64
structure length 215
sequence length 215
chains with identical sequence B, C
ec nomenclature ec 3.4.22.51: Cruzipain.
pdb deposition date 2000-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1f29A00
2E00A 2R9OA 1AIMA 3IEJA 1PPOA 4N79A 2DC9A 1QDQA 2XU5A 2DCAA 1GMYA 3I06A 1U5IA 3IMAA 1NB3A 2XU1A 3P5UA 3S3RA 3GCBA 4CDEB 1DEUA 1PPDA 1CPJA 4I04A 4YV8A 3KSEA 1AYVA 2E03A 3P5XA 4P6EA 1KXRA 4Q8HA 2XU3A 1K3BB 1CTEA 4YVAA 1EF7A 2AUXA 1MEGA 1M6DA 3OF8A 1VJVA 3IHPA 3KFQA 4QH6A 1QXPA 4ZUXU 3CBKA 1YALA 4PADA 4OELA 3N3GA 4FK5A 2HD5A 2DZZA 3IOQA 2Y5BA 1KHQA 2VHSA 3WXGA 2AIMA 3BPMA 2B1MA 1TL9A 2AYNA 2DC8A 1NPZA 2P0RA 3IV2A 1AYUA 5CHTA 4CDDB 1Y08A 4BS5A 4YYRA 2YJ8A 1GECE 3M99A 1THEA 4YYUA 1CVZA 1SP4B 1U9VA 2CIOA 1BY8A 4QRVA 2F7DA 2FQ9A 3ERVA 2DCCA 3CH2X 4BPVA 2FRAA 1XKGA 5CHVA 1ITOA 2DC6A 2VHFA 4MZSA 1NB5A 3WXFA 4I05A 2HH5A 1MIRA 3CBJA 4YYWA 2JQGR 4W4UA 3AI8A 4CDFB 5FPWA 2P7UA 2AU1A 3HWNA 1Q6KA 3BC3A 3RVWA 2R9CA 2CB5A 2AVWA 1EWPA 1BGOA 1KHPA 1X9YA 1AU2A 2YJ2A 2DCDA 2DC7A 4QRXA 1F2AA 3H89A 1ZIVA 3PDFA 1F29A 3N3KA 3S3QA 3K24A 3LFYA 3TNXA 4G54A 5PADA 3KWZA 3OVXA 1PCIA 3KKUA 1QMYA 1SNKA 3D6SA 3BCNA 2ATOA 4AXLA 3U8EA 2JQFR 2HXZA 3O1GA 3O0UA 2FYEA 2OULA 1U9QX 3BWKA 1YK8A 4PP2E 3IUTA 1ME3A 2GFOA 2AS8A 2FO5A 3K8UA 2NQGA 4YYSA 3F5VA 4BSQA 2DZYA 1NQCA 1ZCMA 2OZ2A 4PP1A 2ACTA 2G8JA 3PBHA 4MSXA 4BQVA 2C0YA 3PNRA 1F2BA 3P5WA 4XUIA 2G7YA 3MORA 2OP3A 4Q8GA 1ICFA 3WXEA 2PADA 3H6SA 5CVMA 1ATKA 1POPA 4P6GA 4X6JA 2WBFX 2FRQA 3QJ3A 2E02A 2R9NA 2HHNA 1BP4A 1YT7A 1QOLA 4MZOA 3K9MA 1DF0A 4PI3A 2R6NA 2FTDA 1TU6A 1MHWA 2NQAA 5J94A 3B79A 4BS6A 4XR7A 2PNSA 4AXMA 4X6IA 2NQDB 4K7CA 4QBBA 5F02A 2DCBA 4HWYA 1AU3A 3P5VA 1CS8A 1VSNA 3BPFA 2DJGB 2XU4A 1NLJA 3KX1A 3ZUAA 1S4VA 2G6DA 3N4CA 4W5CA 3HHIA 1IWDA 2H7JA 2YJBA 1PPNA 2ARYA 4N4ZA 5JH3A 2YJ9A 3H8BA 3I3TA 6PADA 4N8WA 1A6RA 1MDWA 1AU4A 3F75A 2AUZA 2B1NA 2NQIA 5EF4A 5EGWA 4FJCA 3RVVA 2O6XA 1BQIA 1NL6A 1EWMA 3E1ZB 3KW9A 1AU0A 1PIPA 2YJCA 2AYOA 2R9MA 5A24A 4CDCB 2Y6EA 2IBIA 2P86A 4FIPA 3RVXA 3HHAA 3MTNA 1TLOA 3V6CA 1CV8A 1JQPA 2G8EA 3NHEA 3QT4A 7PCKA 3MHHA 3OF9A 5CVOB 3OVZA 1EWOA 1PPPA 1U9WA 4WA6A 4OEMA 2R9FA 3C9EA 4I07A 2IPPB 3MHSA 1PADA 3KWBX 4KLBA 2PBHA 1U9XA 1FH0A 1Y4HA 3BOWA 4DMYA 3PW3A 1CB5A 1F2CA 3USVA 1ME4A 3CH3X 4YYVA 1KFUL 1GLOA 2F1GA 3LXSA 2E01A 4RY2A 5K16A 4DMXA 1AYWA 1YK7A 1GCBA 3OISA 2BDZA 1KFXL 4CZWA 3V6EA 3H8CA 1AECA 1O0EA 3H7DA 4X6HA 3HD3A 1CSBB 2PREA 2BDLA 5CVNB 1CQDA 1YVBA 9PAPA 1MS6A 1PXVA 4YYQA 4W5BA 2FUDA 1HUCB 3DF0A 1EWLA 1CJLA 2FT2A 2GHUA 1PBHA 8PCHA 4QRGA 3QSDA 1MEMA 1PE6A 1STFE 5JA7A 2DJFB
chains in the Genus database with same CATH superfamily
2E00A 2R9OA 1AIMA 3IEJA 1PPOA 2HWKA 4N79A 2DC9A 4MM3B 1QDQA 2XU5A 2DCAA 1GMYA 3I06A 4D8IA 1U5IA 3IMAA 1NB3A 2XU1A 3P5UA 3S3RA 3GCBA 4CDEB 2J7QA 4A5UA 1DEUA 1PPDA 1CPJA 4I04A 4D8BA 4YV8A 3KSEA 1AYVA 2E03A 3P5XA 4P6EA 1KXRA 4BOQA 4Q8HA 2XU3A 1K3BB 3PRMA 4BOUA 1CTEA 3TRKA 4YVAA 1EF7A 4XZXA 2AUXA 1MEGA 1M6DA 3OF8A 1VJVA 3IHPA 3KFQA 4QH6A 1QXPA 4ZUXU 3CBKA 1YALA 4PADA 4OELA 3N3GA 4FK5A 2HD5A 2DZZA 3IOQA 2Y5BA 2AGAA 1KHQA 2VHSA 3WXGA 2AIMA 4MI7A 3BPMA 4HXDB 2B1MA 3BB7A 1TL9A 2AYNA 2DC8A 3IFUA 1NPZA 2P0RA 3IV2A 1AYUA 5CHTA 4CDDB 1Y08A 4BS5A 4YYRA 4RF0A 2YJ8A 1GECE 3M99A 3MJ5A 1THEA 4YYUA 1PVJA 1CVZA 1SP4B 1U9VA 2CIOA 1BY8A 4QRVA 3E9SA 2F7DA 5KO3A 2FQ9A 3ERVA 2DCCA 5EZQA 3B21A 3CH2X 2DOSA 4RF1A 4BPVA 2FRAA 1XKGA 5CHVA 1ITOA 2DC6A 4P16A 2VHFA 4MZSA 1NB5A 3WXFA 4I05A 2HH5A 1MIRA 4OVZA 3CBJA 4YYWA 2JQGR 4W4UA 3AI8A 4CDFB 5FPWA 2P7UA 2AU1A 3HWNA 1Q6KA 3BC3A 3RVWA 2Z84A 2R9CA 2CB5A 4D8EA 4BOZA 2AVWA 1EWPA 1BGOA 1KHPA 1X9YA 1AU2A 2YJ2A 2BTWA 2DCDA 2DC7A 4QRXA 1F2AA 3H89A 4RKXA 1ZIVA 3PDFA 1F29A 3N3KA 3S3QA 2BU3A 4GUAA 3K24A 3LFYA 4IP3A 3TNXA 4G54A 5PADA 3KWZA 3OVXA 1PCIA 3KKUA 1QMYA 4OW0A 1SNKA 3D6SA 3BCNA 2ATOA 4AXLA 3U8EA 2JQFR 4PT5A 2HXZA 3O1GA 3BBAA 3O0UA 2FYEA 2OULA 1U9QX 3BWKA 1YK8A 4PP2E 3IUTA 1ME3A 2GFOA 2AS8A 2FO5A 3K8UA 5E6JA 2NQGA 4YYSA 3F5VA 4BSQA 2DZYA 1NQCA 1ZCMA 2OZ2A 4WURA 4PP1A 2ACTA 2G8JA 3PBHA 4MSXA 4BQVA 2C0YA 3PNRA 1F2BA 3P5WA 4XUIA 2FE8A 2G7YA 3MORA 2OP3A 4Q8GA 2UZJA 1ICFA 3WXEA 2PADA 3H6SA 5CVMA 3OQCA 1ATKA 1POPA 4P6GA 4X6JA 2WBFX 2FRQA 5EZSA 4RNAA 3QJ3A 2E02A 2R9NA 2HHNA 1BP4A 1YT7A 3PRPA 1QOLA 4MZOA 4BOPA 3K9MA 1DF0A 2BTWB 4PI3A 2R6NA 2FTDA 1TU6A 2J7QC 1MHWA 2NQAA 5J94A 3B79A 4BS6A 4XR7A 2PNSA 4AXMA 4X6IA 3RNVA 2NQDB 4K7CA 3PHWA 4QBBA 5F02A 2DCBA 4HWYA 1AU3A 3P5VA 1CS8A 1VSNA 3BPFA 2DJGB 2XU4A 1NLJA 3BY4A 3KX1A 4BOSA 3ZUAA 3PHXA 3ZNHA 1S4VA 2G6DA 3N4CA 4W5CA 3HHIA 1IWDA 2H7JA 2YJBA 1PPNA 2ARYA 4N4ZA 5JH3A 1UKFA 2YJ9A 3H8BA 3I3TA 6PADA 4N8WA 1A6RA 1MDWA 1AU4A 2JRIA 3F75A 4IUMA 2AUZA 2B1NA 2NQIA 5EF4A 5EGWA 3MP2A 4FJCA 3RVVA 2O6XA 1BQIA 3W31A 1NL6A 2JTCA 1EWMA 3E1ZB 3KW9A 4M0WA 1AU0A 1PIPA 2YJCA 2AYOA 2R9MA 3O65A 5A24A 4CDCB 2Y6EA 1DKIA 2IBIA 2P86A 4FIPA 1YZBA 3MTVA 3RVXA 3HHAA 3MTNA 1TLOA 3V6CA 1CV8A 1JQPA 2G8EA 3NHEA 3QT4A 7PCKA 3PSEA 3MHHA 3OF9A 5CVOB 3OVZA 1EWOA 1PPPA 1U9WA 4WA6A 4OEMA 2R9FA 4R3DA 3C9EA 4I07A 2IPPB 4OVZB 3MHSA 1PADA 3KWBX 4KLBA 2PBHA 1U9XA 1FH0A 1Y4HA 3BOWA 4DMYA 3PW3A 1CB5A 1F2CA 3PT2A 3USVA 3W30A 1ME4A 3CH3X 4YYVA 1KFUL 1GLOA 2F1GA 3LXSA 2E01A 3TMPA 4RY2A 5K16A 4DMXA 1AYWA 1YK7A 1GCBA 3OISA 2BDZA 1KFXL 4CZWA 3V6EA 3H8CA 4REZA 1AECA 5JZEA 1O0EA 3H7DA 4X6HA 3HD3A 1CSBB 2PREA 2BDLA 5CVNB 1CQDA 1YVBA 9PAPA 1MS6A 1PXVA 4YYQA 4W5BA 2FUDA 1HUCB 3DF0A 1EWLA 1CJLA 2FT2A 2GHUA 1PBHA 8PCHA 4ZTBA 4QRGA 3QSDA 1MEMA 3PHUA 1PE6A 1STFE 5JA7A 3C0RA 2DJFB
chains in the Genus database with same CATH topology
2E00A 2R9OA 1AIMA 3IEJA 1PPOA 4N79A 2DC9A 1QDQA 2XU5A 2DCAA 1GMYA 3I06A 1U5IA 3IMAA 1NB3A 2XU1A 3P5UA 3S3RA 3GCBA 4CDEB 1DEUA 1PPDA 1CPJA 4I04A 4YV8A 3KSEA 1AYVA 2E03A 3P5XA 4P6EA 1KXRA 4Q8HA 2XU3A 1K3BB 1CTEA 4YVAA 1EF7A 3D9WA 2AUXA 1MEGA 1M6DA 3OF8A 1VJVA 3IHPA 3KFQA 4QH6A 1QXPA 4ZUXU 3CBKA 1YALA 4PADA 4OELA 3N3GA 4FK5A 2HD5A 2DZZA 3IOQA 2Y5BA 1KHQA 2VHSA 3WXGA 2AIMA 3BPMA 2B1MA 1TL9A 2AYNA 2DC8A 1NPZA 2P0RA 3IV2A 1AYUA 5CHTA 4CDDB 1Y08A 4BS5A 4YYRA 4C5PA 2YJ8A 1GECE 1E2TA 3M99A 1THEA 4YYUA 1CVZA 1SP4B 1U9VA 2CIOA 1BY8A 4QRVA 2F7DA 2FQ9A 3ERVA 2DCCA 3CH2X 4BPVA 2FRAA 1XKGA 5CHVA 1ITOA 2DC6A 2VHFA 4MZSA 1NB5A 3WXFA 4I05A 2HH5A 1MIRA 3CBJA 4YYWA 2JQGR 4W4UA 3AI8A 4CDFB 5FPWA 2P7UA 2AU1A 3HWNA 1Q6KA 3BC3A 3RVWA 2R9CA 2CB5A 2AVWA 1EWPA 1BGOA 1KHPA 1X9YA 1AU2A 2YJ2A 2DCDA 2DC7A 4QRXA 1F2AA 3H89A 1ZIVA 3PDFA 1F29A 3N3KA 3S3QA 3K24A 3LFYA 3TNXA 4G54A 5PADA 3KWZA 3OVXA 1PCIA 3KKUA 1QMYA 1SNKA 3D6SA 3BCNA 2ATOA 4AXLA 3U8EA 2JQFR 1W4TA 2HXZA 3O1GA 3O0UA 2FYEA 2OULA 1U9QX 3BWKA 1YK8A 4PP2E 3IUTA 1ME3A 2GFOA 2AS8A 2FO5A 3K8UA 2NQGA 4YYSA 3F5VA 4BSQA 2DZYA 1NQCA 1ZCMA 2OZ2A 4PP1A 2ACTA 2G8JA 3PBHA 4MSXA 4BQVA 2C0YA 2VFBA 3PNRA 1F2BA 3P5WA 4XUIA 2G7YA 3MORA 2OP3A 4Q8GA 1ICFA 3WXEA 1GX3A 2PADA 3H6SA 2VFCA 5CVMA 1ATKA 1POPA 4P6GA 4X6JA 2WBFX 2FRQA 3QJ3A 2E02A 1W6FA 2R9NA 2HHNA 1BP4A 1YT7A 1QOLA 4MZOA 3K9MA 1DF0A 4PI3A 2R6NA 2FTDA 1TU6A 1MHWA 2NQAA 5J94A 3B79A 4BS6A 4XR7A 2PNSA 4AXMA 4X6IA 2NQDB 4K7CA 4QBBA 5F02A 2DCBA 4GUZA 4HWYA 1AU3A 3P5VA 1CS8A 1VSNA 3BPFA 2DJGB 2XU4A 1NLJA 3KX1A 3ZUAA 1S4VA 2G6DA 3N4CA 4W5CA 3HHIA 1IWDA 2H7JA 2YJBA 1PPNA 2ARYA 4N4ZA 5JH3A 2YJ9A 3H8BA 3I3TA 6PADA 4N8WA 1A6RA 1MDWA 1AU4A 2BSZA 3F75A 2AUZA 2B1NA 2NQIA 5EF4A 5EGWA 4NV7A 4FJCA 3RVVA 2O6XA 1BQIA 1NL6A 1EWMA 3E1ZB 3KW9A 1AU0A 1PIPA 2YJCA 2AYOA 2R9MA 5A24A 4CDCB 2Y6EA 2IBIA 2P86A 4FIPA 3RVXA 3HHAA 3MTNA 1TLOA 3V6CA 1CV8A 1JQPA 2G8EA 3NHEA 3QT4A 7PCKA 3MHHA 3OF9A 5CVOB 3OVZA 1EWOA 1PPPA 1U9WA 4WA6A 4OEMA 2R9FA 3C9EA 4I07A 2IPPB 3MHSA 1PADA 3KWBX 4KLBA 2PBHA 1U9XA 1FH0A 1Y4HA 3BOWA 4DMYA 3LTWA 3PW3A 4NV8A 1CB5A 1W5RA 1F2CA 3USVA 1ME4A 3CH3X 4B55A 4YYVA 1KFUL 1GLOA 2F1GA 3LXSA 2E01A 4RY2A 5K16A 4DMXA 1AYWA 1YK7A 4BGFA 1GCBA 3OISA 2BDZA 1KFXL 4CZWA 3V6EA 3H8CA 1AECA 1O0EA 3H7DA 4X6HA 3HD3A 1CSBB 2PREA 2BDLA 5CVNB 1CQDA 1YVBA 9PAPA 1MS6A 1PXVA 4YYQA 4W5BA 2FUDA 1HUCB 3DF0A 1EWLA 1CJLA 2FT2A 2GHUA 1PBHA 8PCHA 4QRGA 3QSDA 1MEMA 1PE6A 1STFE 5JA7A 2DJFB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E00 A;  2R9O A;  1AIM A;  3IEJ A;  1PPO A;  4N79 A;  2DC9 A;  1QDQ A;  2XU5 A;  2DCA A;  1GMY A;  3I06 A;  1U5I A;  3IMA A;  1NB3 A;  2XU1 A;  3P5U A;  3S3R A;  3GCB A;  4CDE B;  1DEU A;  1PPD A;  1CPJ A;  4I04 A;  4YV8 A;  3KSE A;  1AYV A;  2E03 A;  3P5X A;  4P6E A;  1KXR A;  4Q8H A;  2XU3 A;  1K3B B;  1CTE A;  4YVA A;  1EF7 A;  2AUX A;  1MEG A;  1M6D A;  3OF8 A;  1VJV A;  3IHP A;  3KFQ A;  4QH6 A;  1QXP A;  4ZUX U;  3CBK A;  1YAL A;  4PAD A;  4OEL A;  3N3G A;  4FK5 A;  2HD5 A;  2DZZ A;  3IOQ A;  2Y5B A;  1KHQ A;  2VHS A;  3WXG A;  2AIM A;  3BPM A;  2B1M A;  1TL9 A;  2AYN A;  2DC8 A;  1NPZ A;  2P0R A;  3IV2 A;  1AYU A;  5CHT A;  4CDD B;  1Y08 A;  4BS5 A;  4YYR A;  2YJ8 A;  1GEC E;  3M99 A;  1THE A;  4YYU A;  1CVZ A;  1SP4 B;  1U9V A;  2CIO A;  1BY8 A;  4QRV A;  2F7D A;  2FQ9 A;  3ERV A;  2DCC A;  3CH2 X;  4BPV A;  2FRA A;  1XKG A;  5CHV A;  1ITO A;  2DC6 A;  2VHF A;  4MZS A;  1NB5 A;  3WXF A;  4I05 A;  2HH5 A;  1MIR A;  3CBJ A;  4YYW A;  2JQG R;  4W4U A;  3AI8 A;  4CDF B;  5FPW A;  2P7U A;  2AU1 A;  3HWN A;  1Q6K A;  3BC3 A;  3RVW A;  2R9C A;  2CB5 A;  2AVW A;  1EWP A;  1BGO A;  1KHP A;  1X9Y A;  1AU2 A;  2YJ2 A;  2DCD A;  2DC7 A;  4QRX A;  1F2A A;  3H89 A;  1ZIV A;  3PDF A;  1F29 A;  3N3K A;  3S3Q A;  3K24 A;  3LFY A;  3TNX A;  4G54 A;  5PAD A;  3KWZ A;  3OVX A;  1PCI A;  3KKU A;  1QMY A;  1SNK A;  3D6S A;  3BCN A;  2ATO A;  4AXL A;  3U8E A;  2JQF R;  2HXZ A;  3O1G A;  3O0U A;  2FYE A;  2OUL A;  1U9Q X;  3BWK A;  1YK8 A;  4PP2 E;  3IUT A;  1ME3 A;  2GFO A;  2AS8 A;  2FO5 A;  3K8U A;  2NQG A;  4YYS A;  3F5V A;  4BSQ A;  2DZY A;  1NQC A;  1ZCM A;  2OZ2 A;  4PP1 A;  2ACT A;  2G8J A;  3PBH A;  4MSX A;  4BQV A;  2C0Y A;  3PNR A;  1F2B A;  3P5W A;  4XUI A;  2G7Y A;  3MOR A;  2OP3 A;  4Q8G A;  1ICF A;  3WXE A;  2PAD A;  3H6S A;  5CVM A;  1ATK A;  1POP A;  4P6G A;  4X6J A;  2WBF X;  2FRQ A;  3QJ3 A;  2E02 A;  2R9N A;  2HHN A;  1BP4 A;  1YT7 A;  1QOL A;  4MZO A;  3K9M A;  1DF0 A;  4PI3 A;  2R6N A;  2FTD A;  1TU6 A;  1MHW A;  2NQA A;  5J94 A;  3B79 A;  4BS6 A;  4XR7 A;  2PNS A;  4AXM A;  4X6I A;  2NQD B;  4K7C A;  4QBB A;  5F02 A;  2DCB A;  4HWY A;  1AU3 A;  3P5V A;  1CS8 A;  1VSN A;  3BPF A;  2DJG B;  2XU4 A;  1NLJ A;  3KX1 A;  3ZUA A;  1S4V A;  2G6D A;  3N4C A;  4W5C A;  3HHI A;  1IWD A;  2H7J A;  2YJB A;  1PPN A;  2ARY A;  4N4Z A;  5JH3 A;  2YJ9 A;  3H8B A;  3I3T A;  6PAD A;  4N8W A;  1A6R A;  1MDW A;  1AU4 A;  3F75 A;  2AUZ A;  2B1N A;  2NQI A;  5EF4 A;  5EGW A;  4FJC A;  3RVV A;  2O6X A;  1BQI A;  1NL6 A;  1EWM A;  3E1Z B;  3KW9 A;  1AU0 A;  1PIP A;  2YJC A;  2AYO A;  2R9M A;  5A24 A;  4CDC B;  2Y6E A;  2IBI A;  2P86 A;  4FIP A;  3RVX A;  3HHA A;  3MTN A;  1TLO A;  3V6C A;  1CV8 A;  1JQP A;  2G8E A;  3NHE A;  3QT4 A;  7PCK A;  3MHH A;  3OF9 A;  5CVO B;  3OVZ A;  1EWO A;  1PPP A;  1U9W A;  4WA6 A;  4OEM A;  2R9F A;  3C9E A;  4I07 A;  2IPP B;  3MHS A;  1PAD A;  3KWB X;  4KLB A;  2PBH A;  1U9X A;  1FH0 A;  1Y4H A;  3BOW A;  4DMY A;  3PW3 A;  1CB5 A;  1F2C A;  3USV A;  1ME4 A;  3CH3 X;  4YYV A;  1KFU L;  1GLO A;  2F1G A;  3LXS A;  2E01 A;  4RY2 A;  5K16 A;  4DMX A;  1AYW A;  1YK7 A;  1GCB A;  3OIS A;  2BDZ A;  1KFX L;  4CZW A;  3V6E A;  3H8C A;  1AEC A;  1O0E A;  3H7D A;  4X6H A;  3HD3 A;  1CSB B;  2PRE A;  2BDL A;  5CVN B;  1CQD A;  1YVB A;  9PAP A;  1MS6 A;  1PXV A;  4YYQ A;  4W5B A;  2FUD A;  1HUC B;  3DF0 A;  1EWL A;  1CJL A;  2FT2 A;  2GHU A;  1PBH A;  8PCH A;  4QRG A;  3QSD A;  1MEM A;  1PE6 A;  1STF E;  5JA7 A;  2DJF B; 
#chains in the Genus database with same CATH topology
 2E00 A;  2R9O A;  1AIM A;  3IEJ A;  1PPO A;  2HWK A;  4N79 A;  2DC9 A;  4MM3 B;  1QDQ A;  2XU5 A;  2DCA A;  1GMY A;  3I06 A;  4D8I A;  1U5I A;  3IMA A;  1NB3 A;  2XU1 A;  3P5U A;  3S3R A;  3GCB A;  4CDE B;  2J7Q A;  4A5U A;  1DEU A;  1PPD A;  1CPJ A;  4I04 A;  4D8B A;  4YV8 A;  3KSE A;  1AYV A;  2E03 A;  3P5X A;  4P6E A;  1KXR A;  4BOQ A;  4Q8H A;  2XU3 A;  1K3B B;  3PRM A;  4BOU A;  1CTE A;  3TRK A;  4YVA A;  1EF7 A;  4XZX A;  2AUX A;  1MEG A;  1M6D A;  3OF8 A;  1VJV A;  3IHP A;  3KFQ A;  4QH6 A;  1QXP A;  4ZUX U;  3CBK A;  1YAL A;  4PAD A;  4OEL A;  3N3G A;  4FK5 A;  2HD5 A;  2DZZ A;  3IOQ A;  2Y5B A;  2AGA A;  1KHQ A;  2VHS A;  3WXG A;  2AIM A;  4MI7 A;  3BPM A;  4HXD B;  2B1M A;  3BB7 A;  1TL9 A;  2AYN A;  2DC8 A;  3IFU A;  1NPZ A;  2P0R A;  3IV2 A;  1AYU A;  5CHT A;  4CDD B;  1Y08 A;  4BS5 A;  4YYR A;  4RF0 A;  2YJ8 A;  1GEC E;  3M99 A;  3MJ5 A;  1THE A;  4YYU A;  1PVJ A;  1CVZ A;  1SP4 B;  1U9V A;  2CIO A;  1BY8 A;  4QRV A;  3E9S A;  2F7D A;  5KO3 A;  2FQ9 A;  3ERV A;  2DCC A;  5EZQ A;  3B21 A;  3CH2 X;  2DOS A;  4RF1 A;  4BPV A;  2FRA A;  1XKG A;  5CHV A;  1ITO A;  2DC6 A;  4P16 A;  2VHF A;  4MZS A;  1NB5 A;  3WXF A;  4I05 A;  2HH5 A;  1MIR A;  4OVZ A;  3CBJ A;  4YYW A;  2JQG R;  4W4U A;  3AI8 A;  4CDF B;  5FPW A;  2P7U A;  2AU1 A;  3HWN A;  1Q6K A;  3BC3 A;  3RVW A;  2Z84 A;  2R9C A;  2CB5 A;  4D8E A;  4BOZ A;  2AVW A;  1EWP A;  1BGO A;  1KHP A;  1X9Y A;  1AU2 A;  2YJ2 A;  2BTW A;  2DCD A;  2DC7 A;  4QRX A;  1F2A A;  3H89 A;  4RKX A;  1ZIV A;  3PDF A;  1F29 A;  3N3K A;  3S3Q A;  2BU3 A;  4GUA A;  3K24 A;  3LFY A;  4IP3 A;  3TNX A;  4G54 A;  5PAD A;  3KWZ A;  3OVX A;  1PCI A;  3KKU A;  1QMY A;  4OW0 A;  1SNK A;  3D6S A;  3BCN A;  2ATO A;  4AXL A;  3U8E A;  2JQF R;  4PT5 A;  2HXZ A;  3O1G A;  3BBA A;  3O0U A;  2FYE A;  2OUL A;  1U9Q X;  3BWK A;  1YK8 A;  4PP2 E;  3IUT A;  1ME3 A;  2GFO A;  2AS8 A;  2FO5 A;  3K8U A;  5E6J A;  2NQG A;  4YYS A;  3F5V A;  4BSQ A;  2DZY A;  1NQC A;  1ZCM A;  2OZ2 A;  4WUR A;  4PP1 A;  2ACT A;  2G8J A;  3PBH A;  4MSX A;  4BQV A;  2C0Y A;  3PNR A;  1F2B A;  3P5W A;  4XUI A;  2FE8 A;  2G7Y A;  3MOR A;  2OP3 A;  4Q8G A;  2UZJ A;  1ICF A;  3WXE A;  2PAD A;  3H6S A;  5CVM A;  3OQC A;  1ATK A;  1POP A;  4P6G A;  4X6J A;  2WBF X;  2FRQ A;  5EZS A;  4RNA A;  3QJ3 A;  2E02 A;  2R9N A;  2HHN A;  1BP4 A;  1YT7 A;  3PRP A;  1QOL A;  4MZO A;  4BOP A;  3K9M A;  1DF0 A;  2BTW B;  4PI3 A;  2R6N A;  2FTD A;  1TU6 A;  2J7Q C;  1MHW A;  2NQA A;  5J94 A;  3B79 A;  4BS6 A;  4XR7 A;  2PNS A;  4AXM A;  4X6I A;  3RNV A;  2NQD B;  4K7C A;  3PHW A;  4QBB A;  5F02 A;  2DCB A;  4HWY A;  1AU3 A;  3P5V A;  1CS8 A;  1VSN A;  3BPF A;  2DJG B;  2XU4 A;  1NLJ A;  3BY4 A;  3KX1 A;  4BOS A;  3ZUA A;  3PHX A;  3ZNH A;  1S4V A;  2G6D A;  3N4C A;  4W5C A;  3HHI A;  1IWD A;  2H7J A;  2YJB A;  1PPN A;  2ARY A;  4N4Z A;  5JH3 A;  1UKF A;  2YJ9 A;  3H8B A;  3I3T A;  6PAD A;  4N8W A;  1A6R A;  1MDW A;  1AU4 A;  2JRI A;  3F75 A;  4IUM A;  2AUZ A;  2B1N A;  2NQI A;  5EF4 A;  5EGW A;  3MP2 A;  4FJC A;  3RVV A;  2O6X A;  1BQI A;  3W31 A;  1NL6 A;  2JTC A;  1EWM A;  3E1Z B;  3KW9 A;  4M0W A;  1AU0 A;  1PIP A;  2YJC A;  2AYO A;  2R9M A;  3O65 A;  5A24 A;  4CDC B;  2Y6E A;  1DKI A;  2IBI A;  2P86 A;  4FIP A;  1YZB A;  3MTV A;  3RVX A;  3HHA A;  3MTN A;  1TLO A;  3V6C A;  1CV8 A;  1JQP A;  2G8E A;  3NHE A;  3QT4 A;  7PCK A;  3PSE A;  3MHH A;  3OF9 A;  5CVO B;  3OVZ A;  1EWO A;  1PPP A;  1U9W A;  4WA6 A;  4OEM A;  2R9F A;  4R3D A;  3C9E A;  4I07 A;  2IPP B;  4OVZ B;  3MHS A;  1PAD A;  3KWB X;  4KLB A;  2PBH A;  1U9X A;  1FH0 A;  1Y4H A;  3BOW A;  4DMY A;  3PW3 A;  1CB5 A;  1F2C A;  3PT2 A;  3USV A;  3W30 A;  1ME4 A;  3CH3 X;  4YYV A;  1KFU L;  1GLO A;  2F1G A;  3LXS A;  2E01 A;  3TMP A;  4RY2 A;  5K16 A;  4DMX A;  1AYW A;  1YK7 A;  1GCB A;  3OIS A;  2BDZ A;  1KFX L;  4CZW A;  3V6E A;  3H8C A;  4REZ A;  1AEC A;  5JZE A;  1O0E A;  3H7D A;  4X6H A;  3HD3 A;  1CSB B;  2PRE A;  2BDL A;  5CVN B;  1CQD A;  1YVB A;  9PAP A;  1MS6 A;  1PXV A;  4YYQ A;  4W5B A;  2FUD A;  1HUC B;  3DF0 A;  1EWL A;  1CJL A;  2FT2 A;  2GHU A;  1PBH A;  8PCH A;  4ZTB A;  4QRG A;  3QSD A;  1MEM A;  3PHU A;  1PE6 A;  1STF E;  5JA7 A;  3C0R A;  2DJF B; 
#chains in the Genus database with same CATH homology
 2E00 A;  2R9O A;  1AIM A;  3IEJ A;  1PPO A;  4N79 A;  2DC9 A;  1QDQ A;  2XU5 A;  2DCA A;  1GMY A;  3I06 A;  1U5I A;  3IMA A;  1NB3 A;  2XU1 A;  3P5U A;  3S3R A;  3GCB A;  4CDE B;  1DEU A;  1PPD A;  1CPJ A;  4I04 A;  4YV8 A;  3KSE A;  1AYV A;  2E03 A;  3P5X A;  4P6E A;  1KXR A;  4Q8H A;  2XU3 A;  1K3B B;  1CTE A;  4YVA A;  1EF7 A;  3D9W A;  2AUX A;  1MEG A;  1M6D A;  3OF8 A;  1VJV A;  3IHP A;  3KFQ A;  4QH6 A;  1QXP A;  4ZUX U;  3CBK A;  1YAL A;  4PAD A;  4OEL A;  3N3G A;  4FK5 A;  2HD5 A;  2DZZ A;  3IOQ A;  2Y5B A;  1KHQ A;  2VHS A;  3WXG A;  2AIM A;  3BPM A;  2B1M A;  1TL9 A;  2AYN A;  2DC8 A;  1NPZ A;  2P0R A;  3IV2 A;  1AYU A;  5CHT A;  4CDD B;  1Y08 A;  4BS5 A;  4YYR A;  4C5P A;  2YJ8 A;  1GEC E;  1E2T A;  3M99 A;  1THE A;  4YYU A;  1CVZ A;  1SP4 B;  1U9V A;  2CIO A;  1BY8 A;  4QRV A;  2F7D A;  2FQ9 A;  3ERV A;  2DCC A;  3CH2 X;  4BPV A;  2FRA A;  1XKG A;  5CHV A;  1ITO A;  2DC6 A;  2VHF A;  4MZS A;  1NB5 A;  3WXF A;  4I05 A;  2HH5 A;  1MIR A;  3CBJ A;  4YYW A;  2JQG R;  4W4U A;  3AI8 A;  4CDF B;  5FPW A;  2P7U A;  2AU1 A;  3HWN A;  1Q6K A;  3BC3 A;  3RVW A;  2R9C A;  2CB5 A;  2AVW A;  1EWP A;  1BGO A;  1KHP A;  1X9Y A;  1AU2 A;  2YJ2 A;  2DCD A;  2DC7 A;  4QRX A;  1F2A A;  3H89 A;  1ZIV A;  3PDF A;  1F29 A;  3N3K A;  3S3Q A;  3K24 A;  3LFY A;  3TNX A;  4G54 A;  5PAD A;  3KWZ A;  3OVX A;  1PCI A;  3KKU A;  1QMY A;  1SNK A;  3D6S A;  3BCN A;  2ATO A;  4AXL A;  3U8E A;  2JQF R;  1W4T A;  2HXZ A;  3O1G A;  3O0U A;  2FYE A;  2OUL A;  1U9Q X;  3BWK A;  1YK8 A;  4PP2 E;  3IUT A;  1ME3 A;  2GFO A;  2AS8 A;  2FO5 A;  3K8U A;  2NQG A;  4YYS A;  3F5V A;  4BSQ A;  2DZY A;  1NQC A;  1ZCM A;  2OZ2 A;  4PP1 A;  2ACT A;  2G8J A;  3PBH A;  4MSX A;  4BQV A;  2C0Y A;  2VFB A;  3PNR A;  1F2B A;  3P5W A;  4XUI A;  2G7Y A;  3MOR A;  2OP3 A;  4Q8G A;  1ICF A;  3WXE A;  1GX3 A;  2PAD A;  3H6S A;  2VFC A;  5CVM A;  1ATK A;  1POP A;  4P6G A;  4X6J A;  2WBF X;  2FRQ A;  3QJ3 A;  2E02 A;  1W6F A;  2R9N A;  2HHN A;  1BP4 A;  1YT7 A;  1QOL A;  4MZO A;  3K9M A;  1DF0 A;  4PI3 A;  2R6N A;  2FTD A;  1TU6 A;  1MHW A;  2NQA A;  5J94 A;  3B79 A;  4BS6 A;  4XR7 A;  2PNS A;  4AXM A;  4X6I A;  2NQD B;  4K7C A;  4QBB A;  5F02 A;  2DCB A;  4GUZ A;  4HWY A;  1AU3 A;  3P5V A;  1CS8 A;  1VSN A;  3BPF A;  2DJG B;  2XU4 A;  1NLJ A;  3KX1 A;  3ZUA A;  1S4V A;  2G6D A;  3N4C A;  4W5C A;  3HHI A;  1IWD A;  2H7J A;  2YJB A;  1PPN A;  2ARY A;  4N4Z A;  5JH3 A;  2YJ9 A;  3H8B A;  3I3T A;  6PAD A;  4N8W A;  1A6R A;  1MDW A;  1AU4 A;  2BSZ A;  3F75 A;  2AUZ A;  2B1N A;  2NQI A;  5EF4 A;  5EGW A;  4NV7 A;  4FJC A;  3RVV A;  2O6X A;  1BQI A;  1NL6 A;  1EWM A;  3E1Z B;  3KW9 A;  1AU0 A;  1PIP A;  2YJC A;  2AYO A;  2R9M A;  5A24 A;  4CDC B;  2Y6E A;  2IBI A;  2P86 A;  4FIP A;  3RVX A;  3HHA A;  3MTN A;  1TLO A;  3V6C A;  1CV8 A;  1JQP A;  2G8E A;  3NHE A;  3QT4 A;  7PCK A;  3MHH A;  3OF9 A;  5CVO B;  3OVZ A;  1EWO A;  1PPP A;  1U9W A;  4WA6 A;  4OEM A;  2R9F A;  3C9E A;  4I07 A;  2IPP B;  3MHS A;  1PAD A;  3KWB X;  4KLB A;  2PBH A;  1U9X A;  1FH0 A;  1Y4H A;  3BOW A;  4DMY A;  3LTW A;  3PW3 A;  4NV8 A;  1CB5 A;  1W5R A;  1F2C A;  3USV A;  1ME4 A;  3CH3 X;  4B55 A;  4YYV A;  1KFU L;  1GLO A;  2F1G A;  3LXS A;  2E01 A;  4RY2 A;  5K16 A;  4DMX A;  1AYW A;  1YK7 A;  4BGF A;  1GCB A;  3OIS A;  2BDZ A;  1KFX L;  4CZW A;  3V6E A;  3H8C A;  1AEC A;  1O0E A;  3H7D A;  4X6H A;  3HD3 A;  1CSB B;  2PRE A;  2BDL A;  5CVN B;  1CQD A;  1YVB A;  9PAP A;  1MS6 A;  1PXV A;  4YYQ A;  4W5B A;  2FUD A;  1HUC B;  3DF0 A;  1EWL A;  1CJL A;  2FT2 A;  2GHU A;  1PBH A;  8PCH A;  4QRG A;  3QSD A;  1MEM A;  1PE6 A;  1STF E;  5JA7 A;  2DJF B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...