3P5XA

Actinidin from actinidia arguta planch (sarusashi)
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
220
structure length
219
Chain Sequence
LPDYVDWRSSGAVVDIKDQGQCGSWAFSTIAAVEGINKIATGDLISLSEQELVDCGRTQNTRGCDGGFMTDGFQFIINNGGINTEANYPYTAEEGQCNLDLQQEKYVSIDTYENVPYNNEWALQTAVAYQPVSVALEAAGYNFQHYSSGIFTGPCGTAVDHAVTIVGYGTEGGIDYWIVKNSWGTTWGEEGYMRIQRNVGGVGQCGIAKKASYPVKYYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Actinidin
publication title Structural analysis of actinidin and a comparison of cadmium and sulfur anomalous signals from actinidin crystals measured using in-house copper- and chromium-anode X-ray sources
pubmed doi rcsb
molecule tags Hydrolase
total genus 64
structure length 219
sequence length 220
ec nomenclature ec 3.4.22.14: Actinidain.
pdb deposition date 2010-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3p5xA00
3K24A 3V6CA 2AYOA 1NLJA 4I05A 2PBHA 1M6DA 1QDQA 3HD3A 2DJFB 3PDFA 1ATKA 4W5CA 3K8UA 2HH5A 2Y5BA 2G8JA 1ZIVA 3P5WA 3DF0A 3B79A 1BQIA 1EWPA 5F02A 3WXGA 1AU0A 2HD5A 2G7YA 3WXEA 2FRQA 3H6SA 2AUZA 1GCBA 3CH2X 5CVOB 2JQFR 3P5UA 3PBHA 6PADA 2DCBA 4HWYA 4YYQA 4XR7A 2FO5A 2C0YA 2E00A 2O6XA 2XU3A 4PI3A 4MZSA 1U9WA 2FRAA 1DEUA 2HXZA 2FUDA 2PREA 9PAPA 1U5IA 3ZUAA 3RVXA 1NPZA 1POPA 3IHPA 5CVNB 1ME3A 1CVZA 4PP1A 4YYWA 1ICFA 4XUIA 2DCCA 3IEJA 3PNRA 1XKGA 1BY8A 3OF9A 2CIOA 1PIPA 3BCNA 1PCIA 3LXSA 4MZOA 4YYRA 2G8EA 2NQAA 3MTNA 1F29A 4X6JA 2YJ9A 5CVMA 1NB5A 2CB5A 3AI8A 3LFYA 1AU3A 3U8EA 4YV8A 5EF4A 2AYNA 4I04A 1EF7A 3OF8A 1PPNA 1YK7A 1BP4A 4BPVA 1YALA 3QSDA 3KFQA 2R9MA 4I07A 4BS5A 3IUTA 1VSNA 1CB5A 4N4ZA 2ATOA 1S4VA 2FQ9A 1HUCB 2PADA 1Y08A 3P5XA 4G54A 4QBBA 1PPPA 3IV2A 4N79A 1AU2A 3BWKA 4PADA 1AYUA 2DC9A 2AUXA 1AECA 3CBJA 1K3BB 1PXVA 2AIMA 1GLOA 3USVA 2DZYA 3KWZA 2B1MA 4BS6A 5CHTA 5FPWA 2NQIA 2PNSA 3MHHA 3OVXA 2DC7A 3I3TA 3H8BA 3S3RA 4CDFB 3S3QA 2GFOA 1EWOA 1MEMA 3MORA 4Q8HA 3N3KA 3IOQA 2DCAA 4AXLA 2FTDA 3KKUA 3KWBX 2P0RA 3P5VA 4X6HA 5EGWA 3CBKA 1CSBB 1MDWA 5A24A 3I06A 2ARYA 1MIRA 2YJBA 1TLOA 2E01A 2G6DA 2AU1A 3F5VA 4PP2E 3CH3X 1Q6KA 2F7DA 2OULA 3GCBA 3ERVA 2XU4A 4YYVA 2FT2A 2R9CA 1TL9A 4RY2A 2AS8A 2DC6A 1MS6A 4CDEB 4WA6A 4QRXA 1U9VA 1KHPA 3H89A 3BPFA 1TU6A 3RVVA 4OELA 1AU4A 4QRGA 2AVWA 1STFE 3KSEA 3MHSA 2P7UA 3N4CA 2IPPB 3O0UA 1F2CA 2NQGA 4KLBA 1CTEA 4FIPA 1CJLA 3QT4A 1NQCA 1SP4B 4BSQA 2HHNA 3HWNA 1FH0A 2Y6EA 3NHEA 4X6IA 3IMAA 1AYWA 2DZZA 4YVAA 1NL6A 1EWMA 2WBFX 3H7DA 3KW9A 4QRVA 2OZ2A 1YT7A 4QH6A 4CDDB 2B1NA 2R9OA 1U9QX 2YJCA 2YJ8A 1GMYA 1KHQA 1PPOA 1QMYA 2GHUA 4N8WA 4DMYA 1ZCMA 1O0EA 2JQGR 2P86A 3PW3A 4OEMA 3OISA 3N3GA 3O1GA 5JA7A 5JH3A 2E02A 1CQDA 1AYVA 1ITOA 4CDCB 4MSXA 2R6NA 1Y4HA 3D6SA 1GECE 1CV8A 4ZUXU 3BC3A 3C9EA 4P6EA 2ACTA 1KFUL 3K9MA 1AIMA 1CPJA 1PBHA 3QJ3A 1F2BA 4FJCA 2DJGB 1MEGA 4FK5A 2XU5A 1MHWA 1QOLA 2VHSA 2OP3A 7PCKA 1KXRA 4K7CA 2R9FA 1NB3A 5J94A 2YJ2A 1PE6A 4BQVA 2DCDA 4YYSA 8PCHA 2NQDB 5K16A 4YYUA 2R9NA 4AXMA 5CHVA 2VHFA 1DF0A 5PADA 1YK8A 1SNKA 1JQPA 2E03A 1ME4A 3E1ZB 1EWLA 4Q8GA 3F75A 4CZWA 1BGOA 1THEA 3BPMA 3KX1A 3BOWA 3OVZA 3HHIA 1PADA 1KFXL 4W4UA 1A6RA 1PPDA 1VJVA 1YVBA 3HHAA 3RVWA 1IWDA 4DMXA 1QXPA 3TNXA 3H8CA 2F1GA 2BDZA 3M99A 3V6EA 1CS8A 1F2AA 2H7JA 2IBIA 1U9XA 2FYEA 2BDLA 3WXFA 4W5BA 1X9YA 2XU1A 4P6GA 2DC8A
chains in the Genus database with same CATH superfamily
2BTWB 3K24A 3V6CA 2AYOA 1NLJA 4I05A 2PBHA 1M6DA 1QDQA 2J7QC 2J7QA 3HD3A 4D8EA 2DJFB 3PDFA 4BOQA 1ATKA 4W5CA 3K8UA 2BU3A 4IP3A 2HH5A 2Y5BA 2G8JA 1ZIVA 4D8IA 3P5WA 3B21A 3DF0A 3B79A 1BQIA 1EWPA 5F02A 3WXGA 1AU0A 2HD5A 2G7YA 3WXEA 2FRQA 4IUMA 3H6SA 3PSEA 2AUZA 1GCBA 3CH2X 5CVOB 4BOSA 2JQFR 3P5UA 3PBHA 6PADA 2DCBA 4HWYA 4YYQA 4XR7A 2FO5A 2C0YA 2E00A 2O6XA 2XU3A 4PI3A 4MZSA 1U9WA 2FRAA 1DEUA 2HXZA 4HXDB 2FUDA 2PREA 9PAPA 1U5IA 3ZUAA 3RVXA 1NPZA 1POPA 3IHPA 5CVNB 3PHWA 1ME3A 2FE8A 1CVZA 4PP1A 4YYWA 1ICFA 4XUIA 2DCCA 3IEJA 3PNRA 2DOSA 1XKGA 4BOZA 3OF9A 1BY8A 2CIOA 1PIPA 3BCNA 1PCIA 3LXSA 4MZOA 4REZA 4YYRA 2G8EA 2NQAA 3MTNA 1F29A 4X6JA 4MI7A 2YJ9A 5CVMA 4OVZB 1NB5A 2CB5A 3AI8A 3LFYA 1AU3A 3U8EA 4YV8A 5EF4A 2AYNA 4I04A 3PRMA 1EF7A 3OF8A 1PPNA 1YK7A 3PT2A 1BP4A 4BPVA 1YALA 3QSDA 3KFQA 2R9MA 4I07A 4BS5A 3IUTA 1VSNA 1CB5A 4N4ZA 2ATOA 1S4VA 2FQ9A 1HUCB 2PADA 3MP2A 1Y08A 3P5XA 4RF1A 4G54A 4QBBA 1PPPA 3IV2A 4N79A 1AU2A 1YZBA 3BWKA 4PADA 1AYUA 2DC9A 2AUXA 1AECA 3CBJA 1K3BB 1PXVA 2AIMA 4OW0A 4XZXA 1GLOA 3USVA 2DZYA 3BB7A 3KWZA 4GUAA 2B1MA 4BS6A 5CHTA 5FPWA 2NQIA 2PNSA 3RNVA 3MHHA 3OVXA 2DC7A 3I3TA 3H8BA 4RNAA 3S3RA 4CDFB 3S3QA 2GFOA 1EWOA 1MEMA 3MORA 4Q8HA 3N3KA 3IOQA 2DCAA 4AXLA 2FTDA 5EZQA 3KKUA 3KWBX 3IFUA 2P0RA 3P5VA 4X6HA 4BOPA 5EGWA 3CBKA 1CSBB 1MDWA 5A24A 3I06A 2ARYA 1MIRA 2YJBA 3MTVA 1TLOA 2E01A 3C0RA 2G6DA 5JZEA 2AU1A 3F5VA 4PP2E 3CH3X 1Q6KA 2F7DA 2HWKA 2OULA 3GCBA 3ERVA 2XU4A 4YYVA 3E9SA 2FT2A 4WURA 2R9CA 1TL9A 4RY2A 2AS8A 2DC6A 1MS6A 4CDEB 4WA6A 4QRXA 1U9VA 1KHPA 3H89A 3BPFA 1TU6A 4P16A 3RVVA 4OELA 1AU4A 4QRGA 2AVWA 1STFE 3KSEA 3MHSA 2P7UA 3N4CA 4MM3B 2IPPB 3O0UA 2AGAA 1F2CA 2NQGA 4KLBA 1CTEA 4FIPA 1CJLA 3QT4A 1NQCA 1SP4B 4BSQA 2HHNA 2BTWA 3HWNA 1FH0A 3ZNHA 2Y6EA 3NHEA 4X6IA 3IMAA 1AYWA 2DZZA 4D8BA 4YVAA 1NL6A 4RF0A 1EWMA 2WBFX 3H7DA 3KW9A 4QRVA 2OZ2A 1YT7A 4QH6A 4CDDB 2B1NA 3W31A 2R9OA 3BBAA 1U9QX 2YJCA 4M0WA 2YJ8A 1GMYA 1KHQA 1PPOA 3PRPA 1DKIA 1QMYA 2GHUA 4N8WA 4DMYA 1ZCMA 1O0EA 2JQGR 2P86A 1PVJA 3PW3A 4OEMA 3OISA 3N3GA 3BY4A 3O1GA 5JA7A 5JH3A 2E02A 1CQDA 1AYVA 1ITOA 5KO3A 4CDCB 4MSXA 2R6NA 2UZJA 1Y4HA 3D6SA 1GECE 1CV8A 4ZUXU 3BC3A 3C9EA 5EZSA 4P6EA 2ACTA 1KFUL 3K9MA 1AIMA 1CPJA 1PBHA 3QJ3A 1F2BA 4FJCA 2DJGB 1MEGA 3TMPA 4FK5A 2XU5A 1MHWA 1QOLA 4R3DA 2VHSA 2OP3A 7PCKA 1KXRA 4K7CA 2R9FA 1NB3A 5J94A 2YJ2A 1PE6A 4BQVA 4OVZA 4BOUA 2DCDA 3OQCA 4YYSA 8PCHA 2NQDB 5K16A 4YYUA 2R9NA 4PT5A 5E6JA 4AXMA 5CHVA 2VHFA 1DF0A 4RKXA 5PADA 1YK8A 1SNKA 1JQPA 2E03A 1ME4A 4A5UA 3TRKA 3E1ZB 1EWLA 4Q8GA 3F75A 4CZWA 1BGOA 1THEA 3BPMA 3KX1A 2JTCA 1UKFA 2JRIA 3BOWA 3PHUA 3OVZA 3HHIA 4ZTBA 1PADA 1KFXL 4W4UA 1A6RA 1PPDA 1VJVA 3O65A 1YVBA 3W30A 3HHAA 3RVWA 1IWDA 4DMXA 1QXPA 3MJ5A 3TNXA 3H8CA 2F1GA 2BDZA 3M99A 3V6EA 1CS8A 1F2AA 2H7JA 2IBIA 1U9XA 2FYEA 3PHXA 2BDLA 2Z84A 3WXFA 4W5BA 1X9YA 2XU1A 4P6GA 2DC8A
chains in the Genus database with same CATH topology
3K24A 3V6CA 2AYOA 1NLJA 4I05A 2PBHA 1M6DA 1QDQA 3HD3A 2DJFB 3PDFA 1ATKA 4W5CA 3K8UA 2HH5A 2Y5BA 2G8JA 1ZIVA 3P5WA 3DF0A 3B79A 1BQIA 1EWPA 5F02A 3WXGA 1AU0A 2HD5A 2G7YA 3WXEA 2FRQA 3H6SA 2AUZA 1GCBA 3CH2X 5CVOB 2JQFR 3P5UA 3PBHA 2VFBA 6PADA 2DCBA 4HWYA 4YYQA 4XR7A 2FO5A 2C0YA 4BGFA 2E00A 2O6XA 2XU3A 4PI3A 4MZSA 1U9WA 2FRAA 1DEUA 2HXZA 2FUDA 2PREA 9PAPA 1U5IA 3ZUAA 3RVXA 1NPZA 1POPA 3IHPA 4GUZA 5CVNB 1ME3A 1CVZA 4PP1A 4YYWA 1ICFA 4XUIA 2DCCA 3IEJA 3PNRA 1XKGA 1BY8A 3OF9A 2CIOA 1PIPA 3BCNA 1PCIA 3LXSA 4MZOA 4YYRA 2G8EA 2NQAA 3MTNA 1F29A 4X6JA 2YJ9A 5CVMA 1NB5A 2CB5A 3AI8A 3LFYA 1AU3A 3U8EA 4YV8A 5EF4A 2AYNA 4I04A 1EF7A 3OF8A 1PPNA 1YK7A 1BP4A 4BPVA 1YALA 3QSDA 3KFQA 2R9MA 4I07A 4BS5A 3IUTA 4B55A 1VSNA 1CB5A 4N4ZA 2ATOA 1S4VA 2FQ9A 1HUCB 2PADA 1Y08A 3P5XA 4G54A 4QBBA 1PPPA 3IV2A 4N79A 1AU2A 3BWKA 4PADA 1AYUA 2DC9A 2AUXA 1AECA 3CBJA 1K3BB 1PXVA 2AIMA 1GLOA 3USVA 2DZYA 3KWZA 2B1MA 4BS6A 5CHTA 5FPWA 2NQIA 2PNSA 3MHHA 3OVXA 2DC7A 3I3TA 3H8BA 3S3RA 4CDFB 2VFCA 3S3QA 2GFOA 1EWOA 3D9WA 1MEMA 3MORA 4Q8HA 3N3KA 3IOQA 2DCAA 4AXLA 2FTDA 3KKUA 3KWBX 2P0RA 3P5VA 4X6HA 5EGWA 3CBKA 1CSBB 1MDWA 5A24A 3I06A 2ARYA 1MIRA 2YJBA 1TLOA 2E01A 2G6DA 2AU1A 3F5VA 4PP2E 3CH3X 1Q6KA 2F7DA 2OULA 3GCBA 3ERVA 2XU4A 4YYVA 2FT2A 2R9CA 1TL9A 4RY2A 2AS8A 2DC6A 1MS6A 4CDEB 4WA6A 4QRXA 1U9VA 1KHPA 3H89A 3BPFA 1TU6A 3RVVA 4OELA 1AU4A 4QRGA 2AVWA 1STFE 3KSEA 3MHSA 2P7UA 4NV8A 3N4CA 2IPPB 3O0UA 1F2CA 2NQGA 4KLBA 1CTEA 4FIPA 1CJLA 3QT4A 1NQCA 1SP4B 4BSQA 2HHNA 3HWNA 1FH0A 1GX3A 2Y6EA 3NHEA 4X6IA 3IMAA 1AYWA 2DZZA 4YVAA 1NL6A 1EWMA 2WBFX 3H7DA 3KW9A 4QRVA 2OZ2A 1YT7A 4QH6A 4CDDB 2B1NA 2R9OA 1U9QX 2YJCA 2YJ8A 1GMYA 1KHQA 1PPOA 1QMYA 2GHUA 4N8WA 4DMYA 1ZCMA 1O0EA 2JQGR 2P86A 3PW3A 4OEMA 3OISA 3N3GA 3O1GA 5JA7A 5JH3A 2E02A 1CQDA 1AYVA 1ITOA 4CDCB 4MSXA 2R6NA 1Y4HA 3D6SA 1GECE 4C5PA 1CV8A 2BSZA 4ZUXU 3BC3A 3C9EA 4P6EA 2ACTA 1KFUL 3K9MA 1AIMA 1CPJA 1PBHA 3QJ3A 1F2BA 4FJCA 2DJGB 1MEGA 4FK5A 2XU5A 1MHWA 1QOLA 1W5RA 2VHSA 2OP3A 7PCKA 1KXRA 4K7CA 2R9FA 1NB3A 5J94A 2YJ2A 1PE6A 4BQVA 2DCDA 4YYSA 8PCHA 3LTWA 2NQDB 5K16A 4YYUA 2R9NA 4AXMA 5CHVA 2VHFA 1DF0A 5PADA 1YK8A 1SNKA 1JQPA 1W4TA 2E03A 1ME4A 3E1ZB 1EWLA 4Q8GA 3F75A 4CZWA 1BGOA 1THEA 3BPMA 3KX1A 4NV7A 3BOWA 3OVZA 3HHIA 1PADA 1KFXL 4W4UA 1A6RA 1PPDA 1VJVA 1YVBA 3HHAA 3RVWA 1IWDA 4DMXA 1QXPA 3TNXA 3H8CA 1E2TA 2F1GA 2BDZA 3M99A 3V6EA 1CS8A 1F2AA 2H7JA 2IBIA 1U9XA 2FYEA 2BDLA 3WXFA 4W5BA 1W6FA 1X9YA 2XU1A 4P6GA 2DC8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K24 A;  3V6C A;  2AYO A;  1NLJ A;  4I05 A;  2PBH A;  1M6D A;  1QDQ A;  3HD3 A;  2DJF B;  3PDF A;  1ATK A;  4W5C A;  3K8U A;  2HH5 A;  2Y5B A;  2G8J A;  1ZIV A;  3P5W A;  3DF0 A;  3B79 A;  1BQI A;  1EWP A;  5F02 A;  3WXG A;  1AU0 A;  2HD5 A;  2G7Y A;  3WXE A;  2FRQ A;  3H6S A;  2AUZ A;  1GCB A;  3CH2 X;  5CVO B;  2JQF R;  3P5U A;  3PBH A;  6PAD A;  2DCB A;  4HWY A;  4YYQ A;  4XR7 A;  2FO5 A;  2C0Y A;  2E00 A;  2O6X A;  2XU3 A;  4PI3 A;  4MZS A;  1U9W A;  2FRA A;  1DEU A;  2HXZ A;  2FUD A;  2PRE A;  9PAP A;  1U5I A;  3ZUA A;  3RVX A;  1NPZ A;  1POP A;  3IHP A;  5CVN B;  1ME3 A;  1CVZ A;  4PP1 A;  4YYW A;  1ICF A;  4XUI A;  2DCC A;  3IEJ A;  3PNR A;  1XKG A;  1BY8 A;  3OF9 A;  2CIO A;  1PIP A;  3BCN A;  1PCI A;  3LXS A;  4MZO A;  4YYR A;  2G8E A;  2NQA A;  3MTN A;  1F29 A;  4X6J A;  2YJ9 A;  5CVM A;  1NB5 A;  2CB5 A;  3AI8 A;  3LFY A;  1AU3 A;  3U8E A;  4YV8 A;  5EF4 A;  2AYN A;  4I04 A;  1EF7 A;  3OF8 A;  1PPN A;  1YK7 A;  1BP4 A;  4BPV A;  1YAL A;  3QSD A;  3KFQ A;  2R9M A;  4I07 A;  4BS5 A;  3IUT A;  1VSN A;  1CB5 A;  4N4Z A;  2ATO A;  1S4V A;  2FQ9 A;  1HUC B;  2PAD A;  1Y08 A;  3P5X A;  4G54 A;  4QBB A;  1PPP A;  3IV2 A;  4N79 A;  1AU2 A;  3BWK A;  4PAD A;  1AYU A;  2DC9 A;  2AUX A;  1AEC A;  3CBJ A;  1K3B B;  1PXV A;  2AIM A;  1GLO A;  3USV A;  2DZY A;  3KWZ A;  2B1M A;  4BS6 A;  5CHT A;  5FPW A;  2NQI A;  2PNS A;  3MHH A;  3OVX A;  2DC7 A;  3I3T A;  3H8B A;  3S3R A;  4CDF B;  3S3Q A;  2GFO A;  1EWO A;  1MEM A;  3MOR A;  4Q8H A;  3N3K A;  3IOQ A;  2DCA A;  4AXL A;  2FTD A;  3KKU A;  3KWB X;  2P0R A;  3P5V A;  4X6H A;  5EGW A;  3CBK A;  1CSB B;  1MDW A;  5A24 A;  3I06 A;  2ARY A;  1MIR A;  2YJB A;  1TLO A;  2E01 A;  2G6D A;  2AU1 A;  3F5V A;  4PP2 E;  3CH3 X;  1Q6K A;  2F7D A;  2OUL A;  3GCB A;  3ERV A;  2XU4 A;  4YYV A;  2FT2 A;  2R9C A;  1TL9 A;  4RY2 A;  2AS8 A;  2DC6 A;  1MS6 A;  4CDE B;  4WA6 A;  4QRX A;  1U9V A;  1KHP A;  3H89 A;  3BPF A;  1TU6 A;  3RVV A;  4OEL A;  1AU4 A;  4QRG A;  2AVW A;  1STF E;  3KSE A;  3MHS A;  2P7U A;  3N4C A;  2IPP B;  3O0U A;  1F2C A;  2NQG A;  4KLB A;  1CTE A;  4FIP A;  1CJL A;  3QT4 A;  1NQC A;  1SP4 B;  4BSQ A;  2HHN A;  3HWN A;  1FH0 A;  2Y6E A;  3NHE A;  4X6I A;  3IMA A;  1AYW A;  2DZZ A;  4YVA A;  1NL6 A;  1EWM A;  2WBF X;  3H7D A;  3KW9 A;  4QRV A;  2OZ2 A;  1YT7 A;  4QH6 A;  4CDD B;  2B1N A;  2R9O A;  1U9Q X;  2YJC A;  2YJ8 A;  1GMY A;  1KHQ A;  1PPO A;  1QMY A;  2GHU A;  4N8W A;  4DMY A;  1ZCM A;  1O0E A;  2JQG R;  2P86 A;  3PW3 A;  4OEM A;  3OIS A;  3N3G A;  3O1G A;  5JA7 A;  5JH3 A;  2E02 A;  1CQD A;  1AYV A;  1ITO A;  4CDC B;  4MSX A;  2R6N A;  1Y4H A;  3D6S A;  1GEC E;  1CV8 A;  4ZUX U;  3BC3 A;  3C9E A;  4P6E A;  2ACT A;  1KFU L;  3K9M A;  1AIM A;  1CPJ A;  1PBH A;  3QJ3 A;  1F2B A;  4FJC A;  2DJG B;  1MEG A;  4FK5 A;  2XU5 A;  1MHW A;  1QOL A;  2VHS A;  2OP3 A;  7PCK A;  1KXR A;  4K7C A;  2R9F A;  1NB3 A;  5J94 A;  2YJ2 A;  1PE6 A;  4BQV A;  2DCD A;  4YYS A;  8PCH A;  2NQD B;  5K16 A;  4YYU A;  2R9N A;  4AXM A;  5CHV A;  2VHF A;  1DF0 A;  5PAD A;  1YK8 A;  1SNK A;  1JQP A;  2E03 A;  1ME4 A;  3E1Z B;  1EWL A;  4Q8G A;  3F75 A;  4CZW A;  1BGO A;  1THE A;  3BPM A;  3KX1 A;  3BOW A;  3OVZ A;  3HHI A;  1PAD A;  1KFX L;  4W4U A;  1A6R A;  1PPD A;  1VJV A;  1YVB A;  3HHA A;  3RVW A;  1IWD A;  4DMX A;  1QXP A;  3TNX A;  3H8C A;  2F1G A;  2BDZ A;  3M99 A;  3V6E A;  1CS8 A;  1F2A A;  2H7J A;  2IBI A;  1U9X A;  2FYE A;  2BDL A;  3WXF A;  4W5B A;  1X9Y A;  2XU1 A;  4P6G A;  2DC8 A; 
#chains in the Genus database with same CATH topology
 2BTW B;  3K24 A;  3V6C A;  2AYO A;  1NLJ A;  4I05 A;  2PBH A;  1M6D A;  1QDQ A;  2J7Q C;  2J7Q A;  3HD3 A;  4D8E A;  2DJF B;  3PDF A;  4BOQ A;  1ATK A;  4W5C A;  3K8U A;  2BU3 A;  4IP3 A;  2HH5 A;  2Y5B A;  2G8J A;  1ZIV A;  4D8I A;  3P5W A;  3B21 A;  3DF0 A;  3B79 A;  1BQI A;  1EWP A;  5F02 A;  3WXG A;  1AU0 A;  2HD5 A;  2G7Y A;  3WXE A;  2FRQ A;  4IUM A;  3H6S A;  3PSE A;  2AUZ A;  1GCB A;  3CH2 X;  5CVO B;  4BOS A;  2JQF R;  3P5U A;  3PBH A;  6PAD A;  2DCB A;  4HWY A;  4YYQ A;  4XR7 A;  2FO5 A;  2C0Y A;  2E00 A;  2O6X A;  2XU3 A;  4PI3 A;  4MZS A;  1U9W A;  2FRA A;  1DEU A;  2HXZ A;  4HXD B;  2FUD A;  2PRE A;  9PAP A;  1U5I A;  3ZUA A;  3RVX A;  1NPZ A;  1POP A;  3IHP A;  5CVN B;  3PHW A;  1ME3 A;  2FE8 A;  1CVZ A;  4PP1 A;  4YYW A;  1ICF A;  4XUI A;  2DCC A;  3IEJ A;  3PNR A;  2DOS A;  1XKG A;  4BOZ A;  3OF9 A;  1BY8 A;  2CIO A;  1PIP A;  3BCN A;  1PCI A;  3LXS A;  4MZO A;  4REZ A;  4YYR A;  2G8E A;  2NQA A;  3MTN A;  1F29 A;  4X6J A;  4MI7 A;  2YJ9 A;  5CVM A;  4OVZ B;  1NB5 A;  2CB5 A;  3AI8 A;  3LFY A;  1AU3 A;  3U8E A;  4YV8 A;  5EF4 A;  2AYN A;  4I04 A;  3PRM A;  1EF7 A;  3OF8 A;  1PPN A;  1YK7 A;  3PT2 A;  1BP4 A;  4BPV A;  1YAL A;  3QSD A;  3KFQ A;  2R9M A;  4I07 A;  4BS5 A;  3IUT A;  1VSN A;  1CB5 A;  4N4Z A;  2ATO A;  1S4V A;  2FQ9 A;  1HUC B;  2PAD A;  3MP2 A;  1Y08 A;  3P5X A;  4RF1 A;  4G54 A;  4QBB A;  1PPP A;  3IV2 A;  4N79 A;  1AU2 A;  1YZB A;  3BWK A;  4PAD A;  1AYU A;  2DC9 A;  2AUX A;  1AEC A;  3CBJ A;  1K3B B;  1PXV A;  2AIM A;  4OW0 A;  4XZX A;  1GLO A;  3USV A;  2DZY A;  3BB7 A;  3KWZ A;  4GUA A;  2B1M A;  4BS6 A;  5CHT A;  5FPW A;  2NQI A;  2PNS A;  3RNV A;  3MHH A;  3OVX A;  2DC7 A;  3I3T A;  3H8B A;  4RNA A;  3S3R A;  4CDF B;  3S3Q A;  2GFO A;  1EWO A;  1MEM A;  3MOR A;  4Q8H A;  3N3K A;  3IOQ A;  2DCA A;  4AXL A;  2FTD A;  5EZQ A;  3KKU A;  3KWB X;  3IFU A;  2P0R A;  3P5V A;  4X6H A;  4BOP A;  5EGW A;  3CBK A;  1CSB B;  1MDW A;  5A24 A;  3I06 A;  2ARY A;  1MIR A;  2YJB A;  3MTV A;  1TLO A;  2E01 A;  3C0R A;  2G6D A;  5JZE A;  2AU1 A;  3F5V A;  4PP2 E;  3CH3 X;  1Q6K A;  2F7D A;  2HWK A;  2OUL A;  3GCB A;  3ERV A;  2XU4 A;  4YYV A;  3E9S A;  2FT2 A;  4WUR A;  2R9C A;  1TL9 A;  4RY2 A;  2AS8 A;  2DC6 A;  1MS6 A;  4CDE B;  4WA6 A;  4QRX A;  1U9V A;  1KHP A;  3H89 A;  3BPF A;  1TU6 A;  4P16 A;  3RVV A;  4OEL A;  1AU4 A;  4QRG A;  2AVW A;  1STF E;  3KSE A;  3MHS A;  2P7U A;  3N4C A;  4MM3 B;  2IPP B;  3O0U A;  2AGA A;  1F2C A;  2NQG A;  4KLB A;  1CTE A;  4FIP A;  1CJL A;  3QT4 A;  1NQC A;  1SP4 B;  4BSQ A;  2HHN A;  2BTW A;  3HWN A;  1FH0 A;  3ZNH A;  2Y6E A;  3NHE A;  4X6I A;  3IMA A;  1AYW A;  2DZZ A;  4D8B A;  4YVA A;  1NL6 A;  4RF0 A;  1EWM A;  2WBF X;  3H7D A;  3KW9 A;  4QRV A;  2OZ2 A;  1YT7 A;  4QH6 A;  4CDD B;  2B1N A;  3W31 A;  2R9O A;  3BBA A;  1U9Q X;  2YJC A;  4M0W A;  2YJ8 A;  1GMY A;  1KHQ A;  1PPO A;  3PRP A;  1DKI A;  1QMY A;  2GHU A;  4N8W A;  4DMY A;  1ZCM A;  1O0E A;  2JQG R;  2P86 A;  1PVJ A;  3PW3 A;  4OEM A;  3OIS A;  3N3G A;  3BY4 A;  3O1G A;  5JA7 A;  5JH3 A;  2E02 A;  1CQD A;  1AYV A;  1ITO A;  5KO3 A;  4CDC B;  4MSX A;  2R6N A;  2UZJ A;  1Y4H A;  3D6S A;  1GEC E;  1CV8 A;  4ZUX U;  3BC3 A;  3C9E A;  5EZS A;  4P6E A;  2ACT A;  1KFU L;  3K9M A;  1AIM A;  1CPJ A;  1PBH A;  3QJ3 A;  1F2B A;  4FJC A;  2DJG B;  1MEG A;  3TMP A;  4FK5 A;  2XU5 A;  1MHW A;  1QOL A;  4R3D A;  2VHS A;  2OP3 A;  7PCK A;  1KXR A;  4K7C A;  2R9F A;  1NB3 A;  5J94 A;  2YJ2 A;  1PE6 A;  4BQV A;  4OVZ A;  4BOU A;  2DCD A;  3OQC A;  4YYS A;  8PCH A;  2NQD B;  5K16 A;  4YYU A;  2R9N A;  4PT5 A;  5E6J A;  4AXM A;  5CHV A;  2VHF A;  1DF0 A;  4RKX A;  5PAD A;  1YK8 A;  1SNK A;  1JQP A;  2E03 A;  1ME4 A;  4A5U A;  3TRK A;  3E1Z B;  1EWL A;  4Q8G A;  3F75 A;  4CZW A;  1BGO A;  1THE A;  3BPM A;  3KX1 A;  2JTC A;  1UKF A;  2JRI A;  3BOW A;  3PHU A;  3OVZ A;  3HHI A;  4ZTB A;  1PAD A;  1KFX L;  4W4U A;  1A6R A;  1PPD A;  1VJV A;  3O65 A;  1YVB A;  3W30 A;  3HHA A;  3RVW A;  1IWD A;  4DMX A;  1QXP A;  3MJ5 A;  3TNX A;  3H8C A;  2F1G A;  2BDZ A;  3M99 A;  3V6E A;  1CS8 A;  1F2A A;  2H7J A;  2IBI A;  1U9X A;  2FYE A;  3PHX A;  2BDL A;  2Z84 A;  3WXF A;  4W5B A;  1X9Y A;  2XU1 A;  4P6G A;  2DC8 A; 
#chains in the Genus database with same CATH homology
 3K24 A;  3V6C A;  2AYO A;  1NLJ A;  4I05 A;  2PBH A;  1M6D A;  1QDQ A;  3HD3 A;  2DJF B;  3PDF A;  1ATK A;  4W5C A;  3K8U A;  2HH5 A;  2Y5B A;  2G8J A;  1ZIV A;  3P5W A;  3DF0 A;  3B79 A;  1BQI A;  1EWP A;  5F02 A;  3WXG A;  1AU0 A;  2HD5 A;  2G7Y A;  3WXE A;  2FRQ A;  3H6S A;  2AUZ A;  1GCB A;  3CH2 X;  5CVO B;  2JQF R;  3P5U A;  3PBH A;  2VFB A;  6PAD A;  2DCB A;  4HWY A;  4YYQ A;  4XR7 A;  2FO5 A;  2C0Y A;  4BGF A;  2E00 A;  2O6X A;  2XU3 A;  4PI3 A;  4MZS A;  1U9W A;  2FRA A;  1DEU A;  2HXZ A;  2FUD A;  2PRE A;  9PAP A;  1U5I A;  3ZUA A;  3RVX A;  1NPZ A;  1POP A;  3IHP A;  4GUZ A;  5CVN B;  1ME3 A;  1CVZ A;  4PP1 A;  4YYW A;  1ICF A;  4XUI A;  2DCC A;  3IEJ A;  3PNR A;  1XKG A;  1BY8 A;  3OF9 A;  2CIO A;  1PIP A;  3BCN A;  1PCI A;  3LXS A;  4MZO A;  4YYR A;  2G8E A;  2NQA A;  3MTN A;  1F29 A;  4X6J A;  2YJ9 A;  5CVM A;  1NB5 A;  2CB5 A;  3AI8 A;  3LFY A;  1AU3 A;  3U8E A;  4YV8 A;  5EF4 A;  2AYN A;  4I04 A;  1EF7 A;  3OF8 A;  1PPN A;  1YK7 A;  1BP4 A;  4BPV A;  1YAL A;  3QSD A;  3KFQ A;  2R9M A;  4I07 A;  4BS5 A;  3IUT A;  4B55 A;  1VSN A;  1CB5 A;  4N4Z A;  2ATO A;  1S4V A;  2FQ9 A;  1HUC B;  2PAD A;  1Y08 A;  3P5X A;  4G54 A;  4QBB A;  1PPP A;  3IV2 A;  4N79 A;  1AU2 A;  3BWK A;  4PAD A;  1AYU A;  2DC9 A;  2AUX A;  1AEC A;  3CBJ A;  1K3B B;  1PXV A;  2AIM A;  1GLO A;  3USV A;  2DZY A;  3KWZ A;  2B1M A;  4BS6 A;  5CHT A;  5FPW A;  2NQI A;  2PNS A;  3MHH A;  3OVX A;  2DC7 A;  3I3T A;  3H8B A;  3S3R A;  4CDF B;  2VFC A;  3S3Q A;  2GFO A;  1EWO A;  3D9W A;  1MEM A;  3MOR A;  4Q8H A;  3N3K A;  3IOQ A;  2DCA A;  4AXL A;  2FTD A;  3KKU A;  3KWB X;  2P0R A;  3P5V A;  4X6H A;  5EGW A;  3CBK A;  1CSB B;  1MDW A;  5A24 A;  3I06 A;  2ARY A;  1MIR A;  2YJB A;  1TLO A;  2E01 A;  2G6D A;  2AU1 A;  3F5V A;  4PP2 E;  3CH3 X;  1Q6K A;  2F7D A;  2OUL A;  3GCB A;  3ERV A;  2XU4 A;  4YYV A;  2FT2 A;  2R9C A;  1TL9 A;  4RY2 A;  2AS8 A;  2DC6 A;  1MS6 A;  4CDE B;  4WA6 A;  4QRX A;  1U9V A;  1KHP A;  3H89 A;  3BPF A;  1TU6 A;  3RVV A;  4OEL A;  1AU4 A;  4QRG A;  2AVW A;  1STF E;  3KSE A;  3MHS A;  2P7U A;  4NV8 A;  3N4C A;  2IPP B;  3O0U A;  1F2C A;  2NQG A;  4KLB A;  1CTE A;  4FIP A;  1CJL A;  3QT4 A;  1NQC A;  1SP4 B;  4BSQ A;  2HHN A;  3HWN A;  1FH0 A;  1GX3 A;  2Y6E A;  3NHE A;  4X6I A;  3IMA A;  1AYW A;  2DZZ A;  4YVA A;  1NL6 A;  1EWM A;  2WBF X;  3H7D A;  3KW9 A;  4QRV A;  2OZ2 A;  1YT7 A;  4QH6 A;  4CDD B;  2B1N A;  2R9O A;  1U9Q X;  2YJC A;  2YJ8 A;  1GMY A;  1KHQ A;  1PPO A;  1QMY A;  2GHU A;  4N8W A;  4DMY A;  1ZCM A;  1O0E A;  2JQG R;  2P86 A;  3PW3 A;  4OEM A;  3OIS A;  3N3G A;  3O1G A;  5JA7 A;  5JH3 A;  2E02 A;  1CQD A;  1AYV A;  1ITO A;  4CDC B;  4MSX A;  2R6N A;  1Y4H A;  3D6S A;  1GEC E;  4C5P A;  1CV8 A;  2BSZ A;  4ZUX U;  3BC3 A;  3C9E A;  4P6E A;  2ACT A;  1KFU L;  3K9M A;  1AIM A;  1CPJ A;  1PBH A;  3QJ3 A;  1F2B A;  4FJC A;  2DJG B;  1MEG A;  4FK5 A;  2XU5 A;  1MHW A;  1QOL A;  1W5R A;  2VHS A;  2OP3 A;  7PCK A;  1KXR A;  4K7C A;  2R9F A;  1NB3 A;  5J94 A;  2YJ2 A;  1PE6 A;  4BQV A;  2DCD A;  4YYS A;  8PCH A;  3LTW A;  2NQD B;  5K16 A;  4YYU A;  2R9N A;  4AXM A;  5CHV A;  2VHF A;  1DF0 A;  5PAD A;  1YK8 A;  1SNK A;  1JQP A;  1W4T A;  2E03 A;  1ME4 A;  3E1Z B;  1EWL A;  4Q8G A;  3F75 A;  4CZW A;  1BGO A;  1THE A;  3BPM A;  3KX1 A;  4NV7 A;  3BOW A;  3OVZ A;  3HHI A;  1PAD A;  1KFX L;  4W4U A;  1A6R A;  1PPD A;  1VJV A;  1YVB A;  3HHA A;  3RVW A;  1IWD A;  4DMX A;  1QXP A;  3TNX A;  3H8C A;  1E2T A;  2F1G A;  2BDZ A;  3M99 A;  3V6E A;  1CS8 A;  1F2A A;  2H7J A;  2IBI A;  1U9X A;  2FYE A;  2BDL A;  3WXF A;  4W5B A;  1W6F A;  1X9Y A;  2XU1 A;  4P6G A;  2DC8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...