3P5XA

Actinidin from actinidia arguta planch (sarusashi)
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
220
structure length
219
Chain Sequence
LPDYVDWRSSGAVVDIKDQGQCGSWAFSTIAAVEGINKIATGDLISLSEQELVDCGRTQNTRGCDGGFMTDGFQFIINNGGINTEANYPYTAEEGQCNLDLQQEKYVSIDTYENVPYNNEWALQTAVAYQPVSVALEAAGYNFQHYSSGIFTGPCGTAVDHAVTIVGYGTEGGIDYWIVKNSWGTTWGEEGYMRIQRNVGGVGQCGIAKKASYPVKYYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Actinidin
publication title Structural analysis of actinidin and a comparison of cadmium and sulfur anomalous signals from actinidin crystals measured using in-house copper- and chromium-anode X-ray sources
pubmed doi rcsb
total genus 64
structure length 219
sequence length 220
ec nomenclature ec 3.4.22.14: Actinidain.
pdb deposition date 2010-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3p5xA00
3AI8A 3N3GA 3K24A 4YVAA 1IWDA 1CTEA 5A24A 3F75A 1PXVA 4AXLA 3IEJA 3QSDA 3KWZA 2YJ8A 2WBFX 1CPJA 3F5VA 4X6HA 3HHIA 1PCIA 1EWLA 3N3KA 4BS5A 2AYNA 1Y08A 1ZCMA 2PBHA 4Q8GA 1PPNA 1AECA 2FT2A 1GMYA 3KKUA 4PI3A 9PAPA 1ITOA 4RY2A 4YYWA 3PW3A 1QMYA 2OP3A 1EWOA 1YK7A 4G54A 2HHNA 4P6EA 1SP4B 3PNRA 3LXSA 1AU0A 1U9QX 4KLBA 4I04A 4PP1A 3H7DA 2BDZA 4BQVA 1VSNA 2PREA 4CZWA 2AUXA 3OVZA 6PADA 1U5IA 1VJVA 3ZUAA 2Y5BA 5JH3A 4BSQA 3S3QA 3HD3A 3IV2A 2AVWA 1QDQA 4OELA 3IHPA 4FJCA 2E02A 4W5CA 2AS8A 1TU6A 3BPMA 2C0YA 2R9MA 4DMYA 4XUIA 1F29A 1GCBA 4PP2E 3OISA 2R9OA 4YV8A 1TLOA 3IMAA 3P5VA 3OF8A 3B79A 3BWKA 3MHSA 3P5XA 1PPOA 3N4CA 3H89A 4OEMA 4YYVA 2YJ2A 2BDLA 2NQAA 5CVOB 3H8BA 5J94A 3CH2X 3H8CA 1POPA 3OVXA 2Y6EA 3MHHA 2OULA 2HXZA 2F1GA 1CQDA 3M99A 2FRAA 1EWPA 3U8EA 4I05A 2HH5A 3RVXA 1CS8A 1CSBB 1ME4A 2ARYA 4XR7A 1ZIVA 1MDWA 2R6NA 4BPVA 1CB5A 1M6DA 2P86A 1NB3A 2IPPB 4I07A 1U9VA 3KFQA 2NQIA 4W5BA 1KFUL 3KWBX 3NHEA 5F02A 4N8WA 2DC7A 1S4VA 2FUDA 4QBBA 5FPWA 3P5WA 3WXEA 1YT7A 3BCNA 1PBHA 2FQ9A 4K7CA 5EF4A 2AYOA 4QRGA 2AU1A 3GCBA 2DJFB 1K3BB 3BPFA 1XKGA 3K8UA 1NLJA 1AYWA 2HD5A 1NQCA 1AIMA 5EGWA 3ERVA 1F2AA 1STFE 1GECE 2GHUA 2DJGB 2JQGR 1BP4A 3USVA 2XU4A 2OZ2A 3OF9A 2YJCA 4FIPA 2G8JA 1NB5A 1KHPA 3LFYA 3KSEA 3KW9A 3RVWA 2DCAA 2XU3A 1YALA 3DF0A 1MS6A 1PADA 1SNKA 8PCHA 2CB5A 3I3TA 2B1NA 2VHSA 3BOWA 3PBHA 3HHAA 2AIMA 2O6XA 1Y4HA 2IBIA 2ACTA 2FO5A 1YVBA 1HUCB 3V6CA 3RVVA 1NPZA 4P6GA 2NQDB 2XU5A 4BS6A 2FTDA 1MIRA 3TNXA 1KFXL 2E00A 1AU4A 1F2BA 4QRVA 3P5UA 2B1MA 2ATOA 4X6IA 2DCDA 2G8EA 7PCKA 5CHVA 2NQGA 2P0RA 3H6SA 2E03A 4YYUA 2DC6A 1MEMA 1O0EA 4Q8HA 5K16A 1A6RA 2H7JA 1GLOA 1MEGA 3O0UA 2G7YA 1Q6KA 2DCCA 2YJBA 3MTNA 3PDFA 1THEA 1YK8A 1QOLA 4YYQA 4CDCB 4MZOA 3IOQA 4PADA 1ATKA 2DC9A 1PE6A 1PPDA 3IUTA 4CDDB 3QJ3A 1AU2A 1QXPA 5CVMA 3V6EA 1ME3A 2XU1A 2P7UA 2DZYA 3E1ZB 4W4UA 3QT4A 4ZUXU 4N4ZA 1BQIA 3BC3A 1JQPA 3C9EA 1MHWA 2GFOA 4MZSA 4N79A 4QRXA 1PIPA 4QH6A 3S3RA 3I06A 5CVNB 2AUZA 3HWNA 2PNSA 4AXMA 1DEUA 1PPPA 2F7DA 2G6DA 2R9FA 2R9NA 4YYRA 3O1GA 5CHTA 1NL6A 2FRQA 3KX1A 1AU3A 4WA6A 1EWMA 1ICFA 3CBKA 4FK5A 1F2CA 1TL9A 2PADA 2VHFA 2DZZA 2CIOA 1KHQA 2YJ9A 2R9CA 1AYVA 4DMXA 1BY8A 3WXFA 3CH3X 3WXGA 4HWYA 2FYEA 3CBJA 1BGOA 2JQFR 1CV8A 1CVZA 1FH0A 2E01A 5JA7A 4X6JA 1AYUA 4YYSA 1CJLA 1EF7A 1U9XA 4MSXA 4CDEB 1KXRA 3D6SA 4CDFB 2DCBA 1X9YA 2DC8A 3MORA 3K9MA 5PADA 1DF0A 1U9WA
chains in the Genus database with same CATH superfamily
3AI8A 3N3GA 3K24A 4YVAA 1IWDA 1CTEA 5A24A 3F75A 1PXVA 4AXLA 3IEJA 3QSDA 3KWZA 4RKXA 2YJ8A 2WBFX 1CPJA 3F5VA 4X6HA 3HHIA 1PCIA 1EWLA 3N3KA 4R3DA 4BS5A 2AYNA 1Y08A 1ZCMA 2PBHA 4Q8GA 1PPNA 3W31A 1AECA 2FT2A 1GMYA 3KKUA 4PI3A 9PAPA 1ITOA 4RY2A 4YYWA 3PW3A 1QMYA 2JRIA 2OP3A 1EWOA 4D8EA 1YK7A 4G54A 5E6JA 2HHNA 4P6EA 4WURA 5KO3A 3TRKA 4BOZA 1SP4B 3PNRA 3MJ5A 3LXSA 1DKIA 1AU0A 1U9QX 4KLBA 4I04A 4PP1A 3H7DA 2BDZA 4BQVA 1VSNA 2PREA 4CZWA 2AUXA 3OVZA 6PADA 1U5IA 1VJVA 3ZUAA 2Y5BA 3PRMA 4REZA 5JH3A 4BSQA 3S3QA 3HD3A 3IV2A 2AVWA 1QDQA 4OELA 3IHPA 4FJCA 2E02A 4W5CA 2AS8A 1TU6A 3BPMA 2C0YA 2R9MA 4DMYA 4XUIA 1F29A 1GCBA 2BTWA 3OISA 2R9OA 2UZJA 1TLOA 4PP2E 4YV8A 4OVZA 3IMAA 3P5VA 3OF8A 3B79A 5EZQA 3BB7A 3BWKA 3MHSA 3P5XA 1PPOA 3N4CA 3H89A 4OEMA 4YYVA 4D8IA 5JZEA 2YJ2A 2BDLA 2NQAA 5CVOB 3H8BA 5J94A 3CH2X 3H8CA 1POPA 3OVXA 2Y6EA 3MHHA 2OULA 3MP2A 2HXZA 2F1GA 1CQDA 1PVJA 2Z84A 3M99A 2FRAA 3PT2A 1EWPA 3U8EA 4I05A 2HH5A 3B21A 2FE8A 3RVXA 4A5UA 1CS8A 1CSBB 1ME4A 2ARYA 4XR7A 3O65A 1ZIVA 3TMPA 1MDWA 2R6NA 3BBAA 4BPVA 1CB5A 1M6DA 2P86A 1NB3A 2IPPB 4I07A 1U9VA 3KFQA 2NQIA 4W5BA 1KFUL 3KWBX 3NHEA 5F02A 4IUMA 2AGAA 4N8WA 4D8BA 2DC7A 1S4VA 2FUDA 4QBBA 5FPWA 3P5WA 3WXEA 4RF1A 3RNVA 4BOSA 4BOPA 1YT7A 3BCNA 3PHUA 1PBHA 2FQ9A 4BOUA 4K7CA 5EF4A 2AYOA 4QRGA 2AU1A 3GCBA 2DJFB 1K3BB 2J7QA 3BPFA 1XKGA 3K8UA 1NLJA 1AYWA 2HD5A 1NQCA 1AIMA 3MTVA 5EGWA 3ERVA 1F2AA 1STFE 1GECE 2GHUA 2DJGB 2JTCA 2JQGR 3IFUA 1BP4A 3USVA 2XU4A 2OZ2A 3OF9A 2YJCA 4FIPA 2G8JA 1NB5A 1KHPA 3LFYA 3KSEA 3OQCA 3KW9A 3RVWA 4IP3A 2DCAA 2XU3A 2HWKA 1YALA 3DF0A 4XZXA 1MS6A 4MI7A 1PADA 1SNKA 8PCHA 2CB5A 3I3TA 4RNAA 2B1NA 2VHSA 3BOWA 3PBHA 3HHAA 2AIMA 4HXDB 2J7QC 2O6XA 1Y4HA 2IBIA 2ACTA 2FO5A 1YVBA 2DOSA 1HUCB 3V6CA 3RVVA 1NPZA 4P6GA 2NQDB 2XU5A 4BS6A 3C0RA 2FTDA 1MIRA 3TNXA 1KFXL 2E00A 1AU4A 1F2BA 4QRVA 3P5UA 2B1MA 2ATOA 4X6IA 2DCDA 2G8EA 7PCKA 5CHVA 2NQGA 2P0RA 3H6SA 2E03A 4GUAA 4YYUA 2DC6A 1MEMA 1O0EA 4Q8HA 5K16A 1A6RA 2H7JA 1GLOA 1MEGA 3O0UA 2G7YA 1Q6KA 1UKFA 4ZTBA 2DCCA 2YJBA 3MTNA 3PDFA 1YZBA 1THEA 1YK8A 1QOLA 4YYQA 4CDCB 4MZOA 3IOQA 3W30A 4PADA 1ATKA 2DC9A 1PE6A 1PPDA 3IUTA 3PHXA 4CDDB 3QJ3A 1AU2A 1QXPA 5CVMA 3V6EA 1ME3A 2XU1A 2P7UA 2DZYA 3E1ZB 4W4UA 3QT4A 4ZUXU 4N4ZA 1BQIA 3BC3A 2BU3A 1JQPA 3C9EA 1MHWA 2GFOA 4MZSA 4N79A 3PSEA 4QRXA 1PIPA 4QH6A 3S3RA 3I06A 3PRPA 2AUZA 5CVNB 3ZNHA 3HWNA 2PNSA 4AXMA 4MM3B 1DEUA 1PPPA 3PHWA 2F7DA 2G6DA 4BOQA 2R9FA 2R9NA 4YYRA 3O1GA 5CHTA 3BY4A 2BTWB 1NL6A 4OVZB 2FRQA 3KX1A 4PT5A 1AU3A 4P16A 4WA6A 1EWMA 1ICFA 3CBKA 4FK5A 5EZSA 1F2CA 1TL9A 2PADA 2VHFA 4OW0A 2DZZA 2CIOA 1KHQA 2YJ9A 2R9CA 1AYVA 4DMXA 1BY8A 3WXFA 4RF0A 4M0WA 3CH3X 3WXGA 4HWYA 2FYEA 3CBJA 1BGOA 2JQFR 1CV8A 1CVZA 1FH0A 2E01A 5JA7A 4X6JA 1AYUA 4YYSA 3E9SA 1CJLA 1EF7A 1U9XA 4MSXA 4CDEB 1KXRA 3D6SA 4CDFB 2DCBA 1X9YA 2DC8A 3MORA 3K9MA 5PADA 1DF0A 1U9WA
chains in the Genus database with same CATH topology
3AI8A 3N3GA 3K24A 4YVAA 1IWDA 3D9WA 1CTEA 5A24A 3F75A 1PXVA 4AXLA 3IEJA 3QSDA 3KWZA 2YJ8A 2WBFX 1CPJA 3F5VA 4X6HA 3HHIA 1PCIA 1EWLA 3N3KA 4BS5A 2AYNA 1Y08A 1ZCMA 2PBHA 4NV8A 4Q8GA 1PPNA 1AECA 2FT2A 1GMYA 3KKUA 4PI3A 9PAPA 1ITOA 4RY2A 4YYWA 3PW3A 1QMYA 2OP3A 1EWOA 1YK7A 4G54A 2HHNA 4P6EA 1SP4B 3PNRA 3LXSA 1AU0A 1U9QX 4KLBA 4I04A 4PP1A 3H7DA 2BDZA 4BQVA 1VSNA 2PREA 4CZWA 2AUXA 3OVZA 6PADA 1U5IA 1VJVA 3ZUAA 2Y5BA 5JH3A 4BSQA 3S3QA 3HD3A 3IV2A 2AVWA 1QDQA 4OELA 3IHPA 4FJCA 2E02A 4W5CA 2AS8A 1TU6A 3BPMA 2C0YA 2R9MA 4DMYA 4XUIA 1F29A 1GCBA 4PP2E 3OISA 2R9OA 4YV8A 1TLOA 3IMAA 3P5VA 3OF8A 3B79A 3BWKA 3MHSA 3P5XA 1PPOA 3N4CA 3H89A 4OEMA 4YYVA 2YJ2A 2BDLA 2NQAA 5CVOB 3H8BA 5J94A 3CH2X 3H8CA 1POPA 3OVXA 2Y6EA 3MHHA 2OULA 2HXZA 2F1GA 1CQDA 3M99A 2FRAA 1EWPA 3U8EA 4I05A 2HH5A 3RVXA 1CS8A 1CSBB 1ME4A 2ARYA 4XR7A 1ZIVA 1MDWA 2R6NA 4BPVA 2VFCA 1CB5A 1M6DA 2P86A 1NB3A 2IPPB 4I07A 1U9VA 3KFQA 2NQIA 4W5BA 1KFUL 3KWBX 3NHEA 5F02A 4N8WA 2DC7A 1S4VA 2FUDA 4QBBA 5FPWA 3P5WA 3WXEA 1YT7A 3BCNA 1PBHA 2FQ9A 4GUZA 4K7CA 5EF4A 2AYOA 4QRGA 2AU1A 3GCBA 2DJFB 1K3BB 3BPFA 1XKGA 3LTWA 3K8UA 1NLJA 1AYWA 2HD5A 1NQCA 1AIMA 5EGWA 3ERVA 1W5RA 1F2AA 1STFE 1GECE 2GHUA 2DJGB 2JQGR 1BP4A 3USVA 2XU4A 2OZ2A 3OF9A 2YJCA 4FIPA 2G8JA 4NV7A 1NB5A 1KHPA 3LFYA 3KSEA 3KW9A 3RVWA 2DCAA 2VFBA 2XU3A 1YALA 3DF0A 1MS6A 1PADA 1SNKA 8PCHA 4B55A 2CB5A 3I3TA 2B1NA 2VHSA 3BOWA 3PBHA 3HHAA 2AIMA 2O6XA 1Y4HA 2IBIA 2ACTA 2FO5A 1YVBA 1HUCB 3V6CA 1GX3A 3RVVA 1NPZA 4P6GA 2NQDB 2XU5A 4BS6A 1E2TA 2FTDA 1MIRA 3TNXA 1KFXL 2E00A 1AU4A 1F2BA 4QRVA 3P5UA 2B1MA 2ATOA 4X6IA 2DCDA 2G8EA 7PCKA 5CHVA 2NQGA 2P0RA 3H6SA 2E03A 4YYUA 2DC6A 1MEMA 1O0EA 4Q8HA 5K16A 1A6RA 2H7JA 1GLOA 1MEGA 3O0UA 2G7YA 1Q6KA 2DCCA 2YJBA 3MTNA 3PDFA 1THEA 1YK8A 1QOLA 4YYQA 4CDCB 4MZOA 3IOQA 4PADA 1ATKA 2DC9A 1PE6A 1PPDA 3IUTA 4CDDB 3QJ3A 1AU2A 1QXPA 5CVMA 1W6FA 3V6EA 1ME3A 2XU1A 2P7UA 2DZYA 3E1ZB 4W4UA 3QT4A 4ZUXU 4N4ZA 4BGFA 1BQIA 3BC3A 1JQPA 3C9EA 1MHWA 2GFOA 4MZSA 4N79A 4QRXA 1PIPA 4C5PA 4QH6A 3S3RA 3I06A 5CVNB 2AUZA 3HWNA 2PNSA 4AXMA 1DEUA 1PPPA 2F7DA 2G6DA 2R9FA 2R9NA 4YYRA 1W4TA 3O1GA 5CHTA 2BSZA 1NL6A 2FRQA 3KX1A 1AU3A 4WA6A 1EWMA 1ICFA 3CBKA 4FK5A 1F2CA 1TL9A 2PADA 2VHFA 2DZZA 2CIOA 1KHQA 2YJ9A 2R9CA 1AYVA 4DMXA 1BY8A 3WXFA 3CH3X 3WXGA 4HWYA 2FYEA 3CBJA 1BGOA 2JQFR 1CV8A 1CVZA 1FH0A 2E01A 5JA7A 4X6JA 1AYUA 4YYSA 1CJLA 1EF7A 1U9XA 4MSXA 4CDEB 1KXRA 3D6SA 4CDFB 2DCBA 1X9YA 2DC8A 3MORA 3K9MA 5PADA 1DF0A 1U9WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AI8 A;  3N3G A;  3K24 A;  4YVA A;  1IWD A;  1CTE A;  5A24 A;  3F75 A;  1PXV A;  4AXL A;  3IEJ A;  3QSD A;  3KWZ A;  2YJ8 A;  2WBF X;  1CPJ A;  3F5V A;  4X6H A;  3HHI A;  1PCI A;  1EWL A;  3N3K A;  4BS5 A;  2AYN A;  1Y08 A;  1ZCM A;  2PBH A;  4Q8G A;  1PPN A;  1AEC A;  2FT2 A;  1GMY A;  3KKU A;  4PI3 A;  9PAP A;  1ITO A;  4RY2 A;  4YYW A;  3PW3 A;  1QMY A;  2OP3 A;  1EWO A;  1YK7 A;  4G54 A;  2HHN A;  4P6E A;  1SP4 B;  3PNR A;  3LXS A;  1AU0 A;  1U9Q X;  4KLB A;  4I04 A;  4PP1 A;  3H7D A;  2BDZ A;  4BQV A;  1VSN A;  2PRE A;  4CZW A;  2AUX A;  3OVZ A;  6PAD A;  1U5I A;  1VJV A;  3ZUA A;  2Y5B A;  5JH3 A;  4BSQ A;  3S3Q A;  3HD3 A;  3IV2 A;  2AVW A;  1QDQ A;  4OEL A;  3IHP A;  4FJC A;  2E02 A;  4W5C A;  2AS8 A;  1TU6 A;  3BPM A;  2C0Y A;  2R9M A;  4DMY A;  4XUI A;  1F29 A;  1GCB A;  4PP2 E;  3OIS A;  2R9O A;  4YV8 A;  1TLO A;  3IMA A;  3P5V A;  3OF8 A;  3B79 A;  3BWK A;  3MHS A;  3P5X A;  1PPO A;  3N4C A;  3H89 A;  4OEM A;  4YYV A;  2YJ2 A;  2BDL A;  2NQA A;  5CVO B;  3H8B A;  5J94 A;  3CH2 X;  3H8C A;  1POP A;  3OVX A;  2Y6E A;  3MHH A;  2OUL A;  2HXZ A;  2F1G A;  1CQD A;  3M99 A;  2FRA A;  1EWP A;  3U8E A;  4I05 A;  2HH5 A;  3RVX A;  1CS8 A;  1CSB B;  1ME4 A;  2ARY A;  4XR7 A;  1ZIV A;  1MDW A;  2R6N A;  4BPV A;  1CB5 A;  1M6D A;  2P86 A;  1NB3 A;  2IPP B;  4I07 A;  1U9V A;  3KFQ A;  2NQI A;  4W5B A;  1KFU L;  3KWB X;  3NHE A;  5F02 A;  4N8W A;  2DC7 A;  1S4V A;  2FUD A;  4QBB A;  5FPW A;  3P5W A;  3WXE A;  1YT7 A;  3BCN A;  1PBH A;  2FQ9 A;  4K7C A;  5EF4 A;  2AYO A;  4QRG A;  2AU1 A;  3GCB A;  2DJF B;  1K3B B;  3BPF A;  1XKG A;  3K8U A;  1NLJ A;  1AYW A;  2HD5 A;  1NQC A;  1AIM A;  5EGW A;  3ERV A;  1F2A A;  1STF E;  1GEC E;  2GHU A;  2DJG B;  2JQG R;  1BP4 A;  3USV A;  2XU4 A;  2OZ2 A;  3OF9 A;  2YJC A;  4FIP A;  2G8J A;  1NB5 A;  1KHP A;  3LFY A;  3KSE A;  3KW9 A;  3RVW A;  2DCA A;  2XU3 A;  1YAL A;  3DF0 A;  1MS6 A;  1PAD A;  1SNK A;  8PCH A;  2CB5 A;  3I3T A;  2B1N A;  2VHS A;  3BOW A;  3PBH A;  3HHA A;  2AIM A;  2O6X A;  1Y4H A;  2IBI A;  2ACT A;  2FO5 A;  1YVB A;  1HUC B;  3V6C A;  3RVV A;  1NPZ A;  4P6G A;  2NQD B;  2XU5 A;  4BS6 A;  2FTD A;  1MIR A;  3TNX A;  1KFX L;  2E00 A;  1AU4 A;  1F2B A;  4QRV A;  3P5U A;  2B1M A;  2ATO A;  4X6I A;  2DCD A;  2G8E A;  7PCK A;  5CHV A;  2NQG A;  2P0R A;  3H6S A;  2E03 A;  4YYU A;  2DC6 A;  1MEM A;  1O0E A;  4Q8H A;  5K16 A;  1A6R A;  2H7J A;  1GLO A;  1MEG A;  3O0U A;  2G7Y A;  1Q6K A;  2DCC A;  2YJB A;  3MTN A;  3PDF A;  1THE A;  1YK8 A;  1QOL A;  4YYQ A;  4CDC B;  4MZO A;  3IOQ A;  4PAD A;  1ATK A;  2DC9 A;  1PE6 A;  1PPD A;  3IUT A;  4CDD B;  3QJ3 A;  1AU2 A;  1QXP A;  5CVM A;  3V6E A;  1ME3 A;  2XU1 A;  2P7U A;  2DZY A;  3E1Z B;  4W4U A;  3QT4 A;  4ZUX U;  4N4Z A;  1BQI A;  3BC3 A;  1JQP A;  3C9E A;  1MHW A;  2GFO A;  4MZS A;  4N79 A;  4QRX A;  1PIP A;  4QH6 A;  3S3R A;  3I06 A;  5CVN B;  2AUZ A;  3HWN A;  2PNS A;  4AXM A;  1DEU A;  1PPP A;  2F7D A;  2G6D A;  2R9F A;  2R9N A;  4YYR A;  3O1G A;  5CHT A;  1NL6 A;  2FRQ A;  3KX1 A;  1AU3 A;  4WA6 A;  1EWM A;  1ICF A;  3CBK A;  4FK5 A;  1F2C A;  1TL9 A;  2PAD A;  2VHF A;  2DZZ A;  2CIO A;  1KHQ A;  2YJ9 A;  2R9C A;  1AYV A;  4DMX A;  1BY8 A;  3WXF A;  3CH3 X;  3WXG A;  4HWY A;  2FYE A;  3CBJ A;  1BGO A;  2JQF R;  1CV8 A;  1CVZ A;  1FH0 A;  2E01 A;  5JA7 A;  4X6J A;  1AYU A;  4YYS A;  1CJL A;  1EF7 A;  1U9X A;  4MSX A;  4CDE B;  1KXR A;  3D6S A;  4CDF B;  2DCB A;  1X9Y A;  2DC8 A;  3MOR A;  3K9M A;  5PAD A;  1DF0 A;  1U9W A; 
#chains in the Genus database with same CATH topology
 3AI8 A;  3N3G A;  3K24 A;  4YVA A;  1IWD A;  1CTE A;  5A24 A;  3F75 A;  1PXV A;  4AXL A;  3IEJ A;  3QSD A;  3KWZ A;  4RKX A;  2YJ8 A;  2WBF X;  1CPJ A;  3F5V A;  4X6H A;  3HHI A;  1PCI A;  1EWL A;  3N3K A;  4R3D A;  4BS5 A;  2AYN A;  1Y08 A;  1ZCM A;  2PBH A;  4Q8G A;  1PPN A;  3W31 A;  1AEC A;  2FT2 A;  1GMY A;  3KKU A;  4PI3 A;  9PAP A;  1ITO A;  4RY2 A;  4YYW A;  3PW3 A;  1QMY A;  2JRI A;  2OP3 A;  1EWO A;  4D8E A;  1YK7 A;  4G54 A;  5E6J A;  2HHN A;  4P6E A;  4WUR A;  5KO3 A;  3TRK A;  4BOZ A;  1SP4 B;  3PNR A;  3MJ5 A;  3LXS A;  1DKI A;  1AU0 A;  1U9Q X;  4KLB A;  4I04 A;  4PP1 A;  3H7D A;  2BDZ A;  4BQV A;  1VSN A;  2PRE A;  4CZW A;  2AUX A;  3OVZ A;  6PAD A;  1U5I A;  1VJV A;  3ZUA A;  2Y5B A;  3PRM A;  4REZ A;  5JH3 A;  4BSQ A;  3S3Q A;  3HD3 A;  3IV2 A;  2AVW A;  1QDQ A;  4OEL A;  3IHP A;  4FJC A;  2E02 A;  4W5C A;  2AS8 A;  1TU6 A;  3BPM A;  2C0Y A;  2R9M A;  4DMY A;  4XUI A;  1F29 A;  1GCB A;  2BTW A;  3OIS A;  2R9O A;  2UZJ A;  1TLO A;  4PP2 E;  4YV8 A;  4OVZ A;  3IMA A;  3P5V A;  3OF8 A;  3B79 A;  5EZQ A;  3BB7 A;  3BWK A;  3MHS A;  3P5X A;  1PPO A;  3N4C A;  3H89 A;  4OEM A;  4YYV A;  4D8I A;  5JZE A;  2YJ2 A;  2BDL A;  2NQA A;  5CVO B;  3H8B A;  5J94 A;  3CH2 X;  3H8C A;  1POP A;  3OVX A;  2Y6E A;  3MHH A;  2OUL A;  3MP2 A;  2HXZ A;  2F1G A;  1CQD A;  1PVJ A;  2Z84 A;  3M99 A;  2FRA A;  3PT2 A;  1EWP A;  3U8E A;  4I05 A;  2HH5 A;  3B21 A;  2FE8 A;  3RVX A;  4A5U A;  1CS8 A;  1CSB B;  1ME4 A;  2ARY A;  4XR7 A;  3O65 A;  1ZIV A;  3TMP A;  1MDW A;  2R6N A;  3BBA A;  4BPV A;  1CB5 A;  1M6D A;  2P86 A;  1NB3 A;  2IPP B;  4I07 A;  1U9V A;  3KFQ A;  2NQI A;  4W5B A;  1KFU L;  3KWB X;  3NHE A;  5F02 A;  4IUM A;  2AGA A;  4N8W A;  4D8B A;  2DC7 A;  1S4V A;  2FUD A;  4QBB A;  5FPW A;  3P5W A;  3WXE A;  4RF1 A;  3RNV A;  4BOS A;  4BOP A;  1YT7 A;  3BCN A;  3PHU A;  1PBH A;  2FQ9 A;  4BOU A;  4K7C A;  5EF4 A;  2AYO A;  4QRG A;  2AU1 A;  3GCB A;  2DJF B;  1K3B B;  2J7Q A;  3BPF A;  1XKG A;  3K8U A;  1NLJ A;  1AYW A;  2HD5 A;  1NQC A;  1AIM A;  3MTV A;  5EGW A;  3ERV A;  1F2A A;  1STF E;  1GEC E;  2GHU A;  2DJG B;  2JTC A;  2JQG R;  3IFU A;  1BP4 A;  3USV A;  2XU4 A;  2OZ2 A;  3OF9 A;  2YJC A;  4FIP A;  2G8J A;  1NB5 A;  1KHP A;  3LFY A;  3KSE A;  3OQC A;  3KW9 A;  3RVW A;  4IP3 A;  2DCA A;  2XU3 A;  2HWK A;  1YAL A;  3DF0 A;  4XZX A;  1MS6 A;  4MI7 A;  1PAD A;  1SNK A;  8PCH A;  2CB5 A;  3I3T A;  4RNA A;  2B1N A;  2VHS A;  3BOW A;  3PBH A;  3HHA A;  2AIM A;  4HXD B;  2J7Q C;  2O6X A;  1Y4H A;  2IBI A;  2ACT A;  2FO5 A;  1YVB A;  2DOS A;  1HUC B;  3V6C A;  3RVV A;  1NPZ A;  4P6G A;  2NQD B;  2XU5 A;  4BS6 A;  3C0R A;  2FTD A;  1MIR A;  3TNX A;  1KFX L;  2E00 A;  1AU4 A;  1F2B A;  4QRV A;  3P5U A;  2B1M A;  2ATO A;  4X6I A;  2DCD A;  2G8E A;  7PCK A;  5CHV A;  2NQG A;  2P0R A;  3H6S A;  2E03 A;  4GUA A;  4YYU A;  2DC6 A;  1MEM A;  1O0E A;  4Q8H A;  5K16 A;  1A6R A;  2H7J A;  1GLO A;  1MEG A;  3O0U A;  2G7Y A;  1Q6K A;  1UKF A;  4ZTB A;  2DCC A;  2YJB A;  3MTN A;  3PDF A;  1YZB A;  1THE A;  1YK8 A;  1QOL A;  4YYQ A;  4CDC B;  4MZO A;  3IOQ A;  3W30 A;  4PAD A;  1ATK A;  2DC9 A;  1PE6 A;  1PPD A;  3IUT A;  3PHX A;  4CDD B;  3QJ3 A;  1AU2 A;  1QXP A;  5CVM A;  3V6E A;  1ME3 A;  2XU1 A;  2P7U A;  2DZY A;  3E1Z B;  4W4U A;  3QT4 A;  4ZUX U;  4N4Z A;  1BQI A;  3BC3 A;  2BU3 A;  1JQP A;  3C9E A;  1MHW A;  2GFO A;  4MZS A;  4N79 A;  3PSE A;  4QRX A;  1PIP A;  4QH6 A;  3S3R A;  3I06 A;  3PRP A;  2AUZ A;  5CVN B;  3ZNH A;  3HWN A;  2PNS A;  4AXM A;  4MM3 B;  1DEU A;  1PPP A;  3PHW A;  2F7D A;  2G6D A;  4BOQ A;  2R9F A;  2R9N A;  4YYR A;  3O1G A;  5CHT A;  3BY4 A;  2BTW B;  1NL6 A;  4OVZ B;  2FRQ A;  3KX1 A;  4PT5 A;  1AU3 A;  4P16 A;  4WA6 A;  1EWM A;  1ICF A;  3CBK A;  4FK5 A;  5EZS A;  1F2C A;  1TL9 A;  2PAD A;  2VHF A;  4OW0 A;  2DZZ A;  2CIO A;  1KHQ A;  2YJ9 A;  2R9C A;  1AYV A;  4DMX A;  1BY8 A;  3WXF A;  4RF0 A;  4M0W A;  3CH3 X;  3WXG A;  4HWY A;  2FYE A;  3CBJ A;  1BGO A;  2JQF R;  1CV8 A;  1CVZ A;  1FH0 A;  2E01 A;  5JA7 A;  4X6J A;  1AYU A;  4YYS A;  3E9S A;  1CJL A;  1EF7 A;  1U9X A;  4MSX A;  4CDE B;  1KXR A;  3D6S A;  4CDF B;  2DCB A;  1X9Y A;  2DC8 A;  3MOR A;  3K9M A;  5PAD A;  1DF0 A;  1U9W A; 
#chains in the Genus database with same CATH homology
 3AI8 A;  3N3G A;  3K24 A;  4YVA A;  1IWD A;  3D9W A;  1CTE A;  5A24 A;  3F75 A;  1PXV A;  4AXL A;  3IEJ A;  3QSD A;  3KWZ A;  2YJ8 A;  2WBF X;  1CPJ A;  3F5V A;  4X6H A;  3HHI A;  1PCI A;  1EWL A;  3N3K A;  4BS5 A;  2AYN A;  1Y08 A;  1ZCM A;  2PBH A;  4NV8 A;  4Q8G A;  1PPN A;  1AEC A;  2FT2 A;  1GMY A;  3KKU A;  4PI3 A;  9PAP A;  1ITO A;  4RY2 A;  4YYW A;  3PW3 A;  1QMY A;  2OP3 A;  1EWO A;  1YK7 A;  4G54 A;  2HHN A;  4P6E A;  1SP4 B;  3PNR A;  3LXS A;  1AU0 A;  1U9Q X;  4KLB A;  4I04 A;  4PP1 A;  3H7D A;  2BDZ A;  4BQV A;  1VSN A;  2PRE A;  4CZW A;  2AUX A;  3OVZ A;  6PAD A;  1U5I A;  1VJV A;  3ZUA A;  2Y5B A;  5JH3 A;  4BSQ A;  3S3Q A;  3HD3 A;  3IV2 A;  2AVW A;  1QDQ A;  4OEL A;  3IHP A;  4FJC A;  2E02 A;  4W5C A;  2AS8 A;  1TU6 A;  3BPM A;  2C0Y A;  2R9M A;  4DMY A;  4XUI A;  1F29 A;  1GCB A;  4PP2 E;  3OIS A;  2R9O A;  4YV8 A;  1TLO A;  3IMA A;  3P5V A;  3OF8 A;  3B79 A;  3BWK A;  3MHS A;  3P5X A;  1PPO A;  3N4C A;  3H89 A;  4OEM A;  4YYV A;  2YJ2 A;  2BDL A;  2NQA A;  5CVO B;  3H8B A;  5J94 A;  3CH2 X;  3H8C A;  1POP A;  3OVX A;  2Y6E A;  3MHH A;  2OUL A;  2HXZ A;  2F1G A;  1CQD A;  3M99 A;  2FRA A;  1EWP A;  3U8E A;  4I05 A;  2HH5 A;  3RVX A;  1CS8 A;  1CSB B;  1ME4 A;  2ARY A;  4XR7 A;  1ZIV A;  1MDW A;  2R6N A;  4BPV A;  2VFC A;  1CB5 A;  1M6D A;  2P86 A;  1NB3 A;  2IPP B;  4I07 A;  1U9V A;  3KFQ A;  2NQI A;  4W5B A;  1KFU L;  3KWB X;  3NHE A;  5F02 A;  4N8W A;  2DC7 A;  1S4V A;  2FUD A;  4QBB A;  5FPW A;  3P5W A;  3WXE A;  1YT7 A;  3BCN A;  1PBH A;  2FQ9 A;  4GUZ A;  4K7C A;  5EF4 A;  2AYO A;  4QRG A;  2AU1 A;  3GCB A;  2DJF B;  1K3B B;  3BPF A;  1XKG A;  3LTW A;  3K8U A;  1NLJ A;  1AYW A;  2HD5 A;  1NQC A;  1AIM A;  5EGW A;  3ERV A;  1W5R A;  1F2A A;  1STF E;  1GEC E;  2GHU A;  2DJG B;  2JQG R;  1BP4 A;  3USV A;  2XU4 A;  2OZ2 A;  3OF9 A;  2YJC A;  4FIP A;  2G8J A;  4NV7 A;  1NB5 A;  1KHP A;  3LFY A;  3KSE A;  3KW9 A;  3RVW A;  2DCA A;  2VFB A;  2XU3 A;  1YAL A;  3DF0 A;  1MS6 A;  1PAD A;  1SNK A;  8PCH A;  4B55 A;  2CB5 A;  3I3T A;  2B1N A;  2VHS A;  3BOW A;  3PBH A;  3HHA A;  2AIM A;  2O6X A;  1Y4H A;  2IBI A;  2ACT A;  2FO5 A;  1YVB A;  1HUC B;  3V6C A;  1GX3 A;  3RVV A;  1NPZ A;  4P6G A;  2NQD B;  2XU5 A;  4BS6 A;  1E2T A;  2FTD A;  1MIR A;  3TNX A;  1KFX L;  2E00 A;  1AU4 A;  1F2B A;  4QRV A;  3P5U A;  2B1M A;  2ATO A;  4X6I A;  2DCD A;  2G8E A;  7PCK A;  5CHV A;  2NQG A;  2P0R A;  3H6S A;  2E03 A;  4YYU A;  2DC6 A;  1MEM A;  1O0E A;  4Q8H A;  5K16 A;  1A6R A;  2H7J A;  1GLO A;  1MEG A;  3O0U A;  2G7Y A;  1Q6K A;  2DCC A;  2YJB A;  3MTN A;  3PDF A;  1THE A;  1YK8 A;  1QOL A;  4YYQ A;  4CDC B;  4MZO A;  3IOQ A;  4PAD A;  1ATK A;  2DC9 A;  1PE6 A;  1PPD A;  3IUT A;  4CDD B;  3QJ3 A;  1AU2 A;  1QXP A;  5CVM A;  1W6F A;  3V6E A;  1ME3 A;  2XU1 A;  2P7U A;  2DZY A;  3E1Z B;  4W4U A;  3QT4 A;  4ZUX U;  4N4Z A;  4BGF A;  1BQI A;  3BC3 A;  1JQP A;  3C9E A;  1MHW A;  2GFO A;  4MZS A;  4N79 A;  4QRX A;  1PIP A;  4C5P A;  4QH6 A;  3S3R A;  3I06 A;  5CVN B;  2AUZ A;  3HWN A;  2PNS A;  4AXM A;  1DEU A;  1PPP A;  2F7D A;  2G6D A;  2R9F A;  2R9N A;  4YYR A;  1W4T A;  3O1G A;  5CHT A;  2BSZ A;  1NL6 A;  2FRQ A;  3KX1 A;  1AU3 A;  4WA6 A;  1EWM A;  1ICF A;  3CBK A;  4FK5 A;  1F2C A;  1TL9 A;  2PAD A;  2VHF A;  2DZZ A;  2CIO A;  1KHQ A;  2YJ9 A;  2R9C A;  1AYV A;  4DMX A;  1BY8 A;  3WXF A;  3CH3 X;  3WXG A;  4HWY A;  2FYE A;  3CBJ A;  1BGO A;  2JQF R;  1CV8 A;  1CVZ A;  1FH0 A;  2E01 A;  5JA7 A;  4X6J A;  1AYU A;  4YYS A;  1CJL A;  1EF7 A;  1U9X A;  4MSX A;  4CDE B;  1KXR A;  3D6S A;  4CDF B;  2DCB A;  1X9Y A;  2DC8 A;  3MOR A;  3K9M A;  5PAD A;  1DF0 A;  1U9W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...