3P5XA

Actinidin from actinidia arguta planch (sarusashi)
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
220
structure length
219
Chain Sequence
LPDYVDWRSSGAVVDIKDQGQCGSWAFSTIAAVEGINKIATGDLISLSEQELVDCGRTQNTRGCDGGFMTDGFQFIINNGGINTEANYPYTAEEGQCNLDLQQEKYVSIDTYENVPYNNEWALQTAVAYQPVSVALEAAGYNFQHYSSGIFTGPCGTAVDHAVTIVGYGTEGGIDYWIVKNSWGTTWGEEGYMRIQRNVGGVGQCGIAKKASYPVKYYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of actinidin and a comparison of cadmium and sulfur anomalous signals from actinidin crystals measured using in-house copper- and chromium-anode X-ray sources
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords Actinidin
total genus 64
structure length 219
sequence length 220
ec nomenclature ec 3.4.22.14: Actinidain.
pdb deposition date 2010-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3p5xA00
4YYSA 4QH6A 2G6DA 5CVOB 1FH0A 2ATOA 4FK5A 1PPDA 2YJ8A 1EWMA 1STFE 4QRXA 1NL6A 4OELA 3WXGA 1QXPA 6PADA 3IMAA 4QBBA 2G8EA 2DC8A 3MHSA 1SNKA 2AYNA 2GHUA 4P6EA 1YK7A 2BDLA 1CPJA 3OF9A 1AU4A 1Y4HA 2E00A 2DC9A 1YVBA 4N8WA 4AXMA 1HUCB 1EWPA 1TLOA 3KFQA 1KFUL 2DCBA 3H8CA 2IPPB 2DC7A 2DC6A 3WXEA 4BQVA 2F7DA 2AUZA 2NQAA 4PADA 1U9XA 2R9CA 3P5XA 3B79A 1GLOA 5CHVA 2HXZA 3IOQA 1X9YA 2VHFA 1BP4A 1K3BB 3M99A 1CS8A 4DMYA 1ITOA 3V6CA 1EF7A 2FRAA 2R9OA 1KXRA 4X6IA 5JH3A 1XKGA 1SP4B 3KSEA 3RVWA 3MORA 4ZUXU 1M6DA 3BPFA 4MZSA 1U9VA 1F29A 5F02A 2R6NA 1ZIVA 2R9MA 2HHNA 2FUDA 1GECE 3WXFA 1EWOA 2PNSA 2AU1A 3N3KA 2E02A 1F2BA 1CQDA 3TNXA 4PI3A 3V6EA 2YJ2A 2P86A 1CV8A 1ZCMA 1NQCA 1F2CA 3S3RA 2AUXA 3C9EA 3PNRA 2XU5A 1GCBA 2E01A 1MS6A 8PCHA 1PPNA 2DZYA 1JQPA 2NQDB 1YT7A 2BDZA 2FRQA 3IHPA 1PPOA 5EF4A 4YVAA 2B1NA 1PCIA 2DJGB 2AS8A 1KFXL 4W5BA 3DF0A 3RVVA 4QRVA 1QMYA 2NQGA 2HD5A 2P7UA 1CVZA 1IWDA 7PCKA 3S3QA 4MSXA 1KHQA 2DCDA 4X6JA 4Q8GA 4N4ZA 1AU2A 3QT4A 2B1MA 1YALA 1U5IA 3H8BA 3OVXA 1YK8A 3K8UA 3OISA 3P5WA 4KLBA 3H7DA 1MIRA 3HD3A 3CBJA 2AVWA 3I3TA 2OULA 3IV2A 4AXLA 4K7CA 5EGWA 1S4VA 5PADA 1CJLA 1MEMA 4YV8A 1AU3A 2CIOA 1CSBB 3U8EA 4BS5A 4I05A 1EWLA 1DF0A 4P6GA 1ICFA 1U9QX 1QDQA 2JQGR 1BGOA 2FQ9A 3K24A 2OP3A 2Y6EA 3NHEA 4W5CA 2WBFX 3PDFA 1PIPA 3OVZA 2XU4A 1NLJA 2HH5A 3RVXA 2CB5A 5J94A 1A6RA 2C0YA 3HHAA 2PADA 1ATKA 2GFOA 4N79A 3CH3X 3KWBX 3KW9A 3GCBA 5A24A 2AIMA 4I04A 1BQIA 1KHPA 3IUTA 1O0EA 1TL9A 4CDEB 2DJFB 2OZ2A 4WA6A 4W4UA 3ERVA 1AYUA 4CDCB 1POPA 2IBIA 2DCCA 5CVMA 4I07A 1PE6A 3CH2X 3LXSA 3ZUAA 3IEJA 3BWKA 1QOLA 4CDDB 2VHSA 5CVNB 1ME3A 4HWYA 1ME4A 2NQIA 9PAPA 1Y08A 4BPVA 3F75A 4XR7A 1MEGA 1VSNA 3BOWA 2YJBA 3H89A 2ARYA 2R9FA 2DCAA 3I06A 1NPZA 4DMXA 2P0RA 2G7YA 1AU0A 2PREA 2E03A 4X6HA 2H7JA 3BCNA 3QJ3A 2F1GA 4G54A 3HHIA 2XU3A 2JQFR 1PXVA 3LFYA 1AYWA 1U9WA 2AYOA 2ACTA 2FT2A 3AI8A 1THEA 5FPWA 1BY8A 4FIPA 1VJVA 3O1GA 3P5UA 1Q6KA 4XUIA 2YJCA 3N4CA 3PBHA 2FYEA 3D6SA 1NB3A 1AIMA 3N3GA 4YYWA 3CBKA 2DZZA 3KX1A 3MHHA 3OF8A 3USVA 2O6XA 1NB5A 2FO5A 1AYVA 1MDWA 4YYUA 4CDFB 3PW3A 4RY2A 4MZOA 4BSQA 1PADA 1F2AA 5K16A 1PPPA 4YYQA 3O0UA 2FTDA 3P5VA 3HWNA 1MHWA 2Y5BA 4FJCA 1DEUA 4PP2E 1TU6A 2YJ9A 3KWZA 2G8JA 5JA7A 2PBHA 4OEMA 3KKUA 3K9MA 4CZWA 3H6SA 4PP1A 4QRGA 3QSDA 2XU1A 3E1ZB 5CHTA 4YYVA 1AECA 4Q8HA 1CTEA 1GMYA 3BC3A 3BPMA 1CB5A 3MTNA 2R9NA 4YYRA 1PBHA 3F5VA 4BS6A
chains in the Genus database with same CATH superfamily
4YYSA 4QH6A 2G6DA 4OVZA 5CVOB 1FH0A 2ATOA 4FK5A 1DKIA 1PPDA 2YJ8A 1EWMA 1STFE 1UKFA 4QRXA 5EZSA 1NL6A 4OELA 3WXGA 1QXPA 4D8BA 3IMAA 6PADA 4QBBA 2G8EA 2DC8A 3MHSA 1SNKA 2AYNA 4RF1A 2GHUA 2AGAA 4P6EA 1YK7A 2BDLA 1CPJA 3OF9A 1AU4A 1Y4HA 2E00A 2DC9A 1YVBA 4N8WA 4AXMA 1HUCB 1EWPA 1TLOA 3KFQA 1KFUL 2DCBA 3H8CA 2IPPB 2J7QA 4REZA 2DC7A 2Z84A 2DC6A 3W30A 3WXEA 4BQVA 2F7DA 2AUZA 2NQAA 4PADA 5KO3A 4IUMA 1U9XA 2R9CA 3PT2A 3P5XA 3B79A 1GLOA 5CHVA 2HXZA 4WURA 3IOQA 1X9YA 2VHFA 1BP4A 1K3BB 3M99A 1CS8A 4DMYA 3E9SA 3W31A 3BBAA 4ZTBA 1ITOA 3V6CA 1EF7A 2FRAA 2R9OA 1KXRA 4BOPA 4X6IA 5JH3A 3PRMA 1XKGA 1SP4B 3KSEA 3RVWA 3MORA 4ZUXU 1M6DA 3BPFA 4MZSA 1U9VA 1F29A 5F02A 4M0WA 2R6NA 1ZIVA 2R9MA 2HHNA 2FUDA 1GECE 3WXFA 1EWOA 2PNSA 2AU1A 3N3KA 2E02A 1F2BA 1CQDA 3TNXA 4PI3A 3V6EA 2YJ2A 2P86A 1CV8A 1ZCMA 2BTWA 5JZEA 1NQCA 1F2CA 3S3RA 2AUXA 3C9EA 3PNRA 2XU5A 1GCBA 2E01A 1MS6A 3PSEA 1YZBA 8PCHA 1PPNA 2DZYA 1JQPA 2NQDB 1YT7A 2BDZA 2FRQA 3IHPA 1PPOA 5EF4A 4YVAA 2B1NA 1PCIA 2DJGB 2AS8A 4HXDB 1KFXL 4W5BA 3TMPA 3DF0A 3RVVA 4BOQA 2HWKA 4QRVA 1QMYA 2NQGA 2HD5A 2P7UA 1CVZA 1IWDA 7PCKA 3S3QA 4MSXA 1KHQA 2DCDA 4X6JA 4Q8GA 4N4ZA 4OW0A 5E6JA 1AU2A 3QT4A 2B1MA 1YALA 1U5IA 3H8BA 3OVXA 1YK8A 3K8UA 4RF0A 3B21A 3OISA 3P5WA 4KLBA 3H7DA 1MIRA 3HD3A 3CBJA 2AVWA 3I3TA 2OULA 5EZQA 3IV2A 3MJ5A 4AXLA 4K7CA 5EGWA 1S4VA 5PADA 1CJLA 1MEMA 4YV8A 4A5UA 1AU3A 2J7QC 2CIOA 1CSBB 3U8EA 2BTWB 4BS5A 4I05A 1EWLA 1DF0A 4P6GA 4BOZA 1ICFA 1U9QX 1QDQA 2JQGR 1BGOA 2FQ9A 4GUAA 3K24A 2OP3A 2Y6EA 3NHEA 4W5CA 2WBFX 3PDFA 1PIPA 3OVZA 2XU4A 1NLJA 2HH5A 4R3DA 3RVXA 2BU3A 2CB5A 5J94A 1A6RA 2C0YA 3HHAA 3PRPA 2PADA 1ATKA 2GFOA 4N79A 3CH3X 3KWBX 3KW9A 3GCBA 5A24A 2AIMA 4I04A 1BQIA 1KHPA 3ZNHA 3IUTA 1O0EA 1TL9A 4CDEB 2DJFB 2OZ2A 3MP2A 4WA6A 4W4UA 3ERVA 2FE8A 1AYUA 4CDCB 1POPA 2IBIA 2DCCA 5CVMA 4I07A 1PE6A 3CH2X 3LXSA 3ZUAA 3IEJA 3BWKA 1QOLA 3BB7A 4CDDB 2VHSA 5CVNB 3BY4A 1ME3A 3TRKA 4OVZB 4HWYA 1ME4A 2NQIA 9PAPA 1Y08A 4BPVA 3F75A 3C0RA 4XR7A 1MEGA 1VSNA 3BOWA 2YJBA 3H89A 2ARYA 2R9FA 1PVJA 2DCAA 4P16A 3I06A 1NPZA 4D8EA 3O65A 4DMXA 3PHWA 2P0RA 2G7YA 1AU0A 3MTVA 2PREA 2E03A 4X6HA 2H7JA 3BCNA 3QJ3A 2F1GA 3PHUA 3PHXA 4G54A 3HHIA 2XU3A 2JQFR 1PXVA 3LFYA 1AYWA 1U9WA 2AYOA 2ACTA 3OQCA 2FT2A 3AI8A 1THEA 5FPWA 1BY8A 4FIPA 1VJVA 3O1GA 3IFUA 2JTCA 3P5UA 1Q6KA 4XUIA 2YJCA 3N4CA 3PBHA 2FYEA 3D6SA 1NB3A 1AIMA 3N3GA 4MI7A 2DOSA 4YYWA 3CBKA 2UZJA 2DZZA 3KX1A 3MHHA 4BOUA 3OF8A 3USVA 2O6XA 1NB5A 2FO5A 1AYVA 1MDWA 4YYUA 2JRIA 4CDFB 3PW3A 4RY2A 4IP3A 4MZOA 4BSQA 1PADA 4BOSA 1F2AA 5K16A 4PT5A 1PPPA 4YYQA 3O0UA 2FTDA 3P5VA 4XZXA 3HWNA 1MHWA 2Y5BA 4FJCA 1DEUA 4PP2E 1TU6A 2YJ9A 3KWZA 3RNVA 2G8JA 5JA7A 2PBHA 4OEMA 3KKUA 3K9MA 4CZWA 3H6SA 4PP1A 4QRGA 3QSDA 4MM3B 2XU1A 4D8IA 3E1ZB 4RNAA 5CHTA 4YYVA 1AECA 4Q8HA 1CTEA 1GMYA 3BC3A 3BPMA 1CB5A 3MTNA 2R9NA 4RKXA 4YYRA 1PBHA 3F5VA 4BS6A
chains in the Genus database with same CATH topology
4YYSA 4QH6A 2G6DA 5CVOB 1FH0A 2ATOA 1PPDA 4FK5A 2YJ8A 4GUZA 1EWMA 1STFE 4QRXA 1NL6A 4OELA 3WXGA 1QXPA 6PADA 3IMAA 4QBBA 2G8EA 2DC8A 3MHSA 1SNKA 4B55A 2AYNA 2GHUA 4P6EA 1YK7A 2BDLA 1CPJA 3OF9A 1AU4A 1Y4HA 2E00A 2DC9A 1YVBA 4N8WA 4AXMA 1HUCB 1EWPA 1TLOA 3KFQA 1KFUL 2DCBA 3H8CA 2IPPB 2DC7A 2DC6A 3WXEA 4C5PA 4BQVA 2F7DA 2AUZA 2NQAA 4PADA 1U9XA 2R9CA 3P5XA 3B79A 1GLOA 5CHVA 2HXZA 3IOQA 1X9YA 2VHFA 1BP4A 1K3BB 3M99A 1CS8A 4DMYA 1ITOA 3V6CA 1EF7A 2FRAA 2R9OA 1KXRA 4X6IA 5JH3A 1XKGA 1SP4B 3KSEA 3RVWA 3MORA 4ZUXU 1M6DA 3BPFA 4MZSA 1W6FA 1U9VA 1F29A 5F02A 1W4TA 2R6NA 1ZIVA 2R9MA 2VFCA 2HHNA 2FUDA 1GECE 3WXFA 1EWOA 2PNSA 4BGFA 2AU1A 3N3KA 2E02A 1F2BA 1CQDA 3TNXA 4PI3A 3V6EA 2YJ2A 2P86A 1CV8A 1ZCMA 1NQCA 1F2CA 3S3RA 2AUXA 3C9EA 3PNRA 2XU5A 1GCBA 2E01A 1MS6A 8PCHA 1PPNA 2DZYA 1JQPA 2NQDB 1E2TA 1YT7A 2BDZA 2FRQA 3IHPA 1PPOA 5EF4A 4YVAA 2B1NA 1PCIA 2DJGB 2AS8A 1KFXL 4W5BA 3DF0A 3RVVA 4QRVA 1QMYA 2NQGA 2HD5A 2P7UA 1CVZA 1IWDA 7PCKA 3S3QA 4MSXA 1KHQA 2DCDA 4X6JA 4Q8GA 4N4ZA 1AU2A 3QT4A 2B1MA 1YALA 1U5IA 3H8BA 3OVXA 1YK8A 3K8UA 3OISA 3P5WA 4KLBA 3H7DA 1MIRA 3HD3A 3CBJA 2AVWA 3I3TA 3LTWA 2OULA 3IV2A 4AXLA 4K7CA 5EGWA 2BSZA 1S4VA 5PADA 1CJLA 1MEMA 4YV8A 1AU3A 2CIOA 1CSBB 3U8EA 3D9WA 4BS5A 4I05A 1EWLA 1DF0A 4P6GA 1ICFA 1U9QX 1QDQA 2JQGR 1BGOA 2FQ9A 3K24A 2OP3A 2Y6EA 3NHEA 4W5CA 2WBFX 3PDFA 1PIPA 3OVZA 2XU4A 1NLJA 2HH5A 3RVXA 2CB5A 5J94A 1A6RA 2C0YA 3HHAA 2PADA 1ATKA 2GFOA 4N79A 3CH3X 3KWBX 3KW9A 3GCBA 5A24A 2AIMA 4I04A 1BQIA 1KHPA 3IUTA 1O0EA 1TL9A 4CDEB 2DJFB 2OZ2A 4WA6A 4W4UA 3ERVA 1AYUA 4CDCB 1POPA 2IBIA 2DCCA 5CVMA 4I07A 1PE6A 3CH2X 3LXSA 4NV8A 3ZUAA 3IEJA 3BWKA 1QOLA 4CDDB 2VHSA 5CVNB 1ME3A 4HWYA 1ME4A 2NQIA 9PAPA 1Y08A 4BPVA 3F75A 4XR7A 1MEGA 1VSNA 3BOWA 2YJBA 3H89A 2ARYA 2R9FA 2VFBA 2DCAA 3I06A 1NPZA 4DMXA 2P0RA 2G7YA 1AU0A 2PREA 2E03A 4X6HA 2H7JA 3BCNA 3QJ3A 2F1GA 4G54A 3HHIA 2XU3A 2JQFR 1PXVA 3LFYA 1W5RA 1AYWA 1U9WA 2AYOA 2ACTA 2FT2A 3AI8A 1GX3A 1THEA 5FPWA 1BY8A 4FIPA 1VJVA 3O1GA 3P5UA 1Q6KA 4XUIA 2YJCA 3N4CA 3PBHA 2FYEA 3D6SA 1NB3A 1AIMA 3N3GA 4YYWA 3CBKA 2DZZA 3KX1A 3MHHA 3OF8A 3USVA 2O6XA 1NB5A 2FO5A 1AYVA 1MDWA 4YYUA 4CDFB 3PW3A 4RY2A 4MZOA 4BSQA 1PADA 1F2AA 5K16A 1PPPA 4YYQA 3O0UA 2FTDA 3P5VA 3HWNA 1MHWA 2Y5BA 4FJCA 4NV7A 1DEUA 4PP2E 1TU6A 2YJ9A 3KWZA 2G8JA 5JA7A 2PBHA 4OEMA 3KKUA 3K9MA 4CZWA 3H6SA 4PP1A 4QRGA 3QSDA 2XU1A 3E1ZB 5CHTA 4YYVA 1AECA 4Q8HA 1CTEA 1GMYA 3BC3A 3BPMA 1CB5A 3MTNA 2R9NA 4YYRA 1PBHA 3F5VA 4BS6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YYS A;  4QH6 A;  2G6D A;  5CVO B;  1FH0 A;  2ATO A;  4FK5 A;  1PPD A;  2YJ8 A;  1EWM A;  1STF E;  4QRX A;  1NL6 A;  4OEL A;  3WXG A;  1QXP A;  6PAD A;  3IMA A;  4QBB A;  2G8E A;  2DC8 A;  3MHS A;  1SNK A;  2AYN A;  2GHU A;  4P6E A;  1YK7 A;  2BDL A;  1CPJ A;  3OF9 A;  1AU4 A;  1Y4H A;  2E00 A;  2DC9 A;  1YVB A;  4N8W A;  4AXM A;  1HUC B;  1EWP A;  1TLO A;  3KFQ A;  1KFU L;  2DCB A;  3H8C A;  2IPP B;  2DC7 A;  2DC6 A;  3WXE A;  4BQV A;  2F7D A;  2AUZ A;  2NQA A;  4PAD A;  1U9X A;  2R9C A;  3P5X A;  3B79 A;  1GLO A;  5CHV A;  2HXZ A;  3IOQ A;  1X9Y A;  2VHF A;  1BP4 A;  1K3B B;  3M99 A;  1CS8 A;  4DMY A;  1ITO A;  3V6C A;  1EF7 A;  2FRA A;  2R9O A;  1KXR A;  4X6I A;  5JH3 A;  1XKG A;  1SP4 B;  3KSE A;  3RVW A;  3MOR A;  4ZUX U;  1M6D A;  3BPF A;  4MZS A;  1U9V A;  1F29 A;  5F02 A;  2R6N A;  1ZIV A;  2R9M A;  2HHN A;  2FUD A;  1GEC E;  3WXF A;  1EWO A;  2PNS A;  2AU1 A;  3N3K A;  2E02 A;  1F2B A;  1CQD A;  3TNX A;  4PI3 A;  3V6E A;  2YJ2 A;  2P86 A;  1CV8 A;  1ZCM A;  1NQC A;  1F2C A;  3S3R A;  2AUX A;  3C9E A;  3PNR A;  2XU5 A;  1GCB A;  2E01 A;  1MS6 A;  8PCH A;  1PPN A;  2DZY A;  1JQP A;  2NQD B;  1YT7 A;  2BDZ A;  2FRQ A;  3IHP A;  1PPO A;  5EF4 A;  4YVA A;  2B1N A;  1PCI A;  2DJG B;  2AS8 A;  1KFX L;  4W5B A;  3DF0 A;  3RVV A;  4QRV A;  1QMY A;  2NQG A;  2HD5 A;  2P7U A;  1CVZ A;  1IWD A;  7PCK A;  3S3Q A;  4MSX A;  1KHQ A;  2DCD A;  4X6J A;  4Q8G A;  4N4Z A;  1AU2 A;  3QT4 A;  2B1M A;  1YAL A;  1U5I A;  3H8B A;  3OVX A;  1YK8 A;  3K8U A;  3OIS A;  3P5W A;  4KLB A;  3H7D A;  1MIR A;  3HD3 A;  3CBJ A;  2AVW A;  3I3T A;  2OUL A;  3IV2 A;  4AXL A;  4K7C A;  5EGW A;  1S4V A;  5PAD A;  1CJL A;  1MEM A;  4YV8 A;  1AU3 A;  2CIO A;  1CSB B;  3U8E A;  4BS5 A;  4I05 A;  1EWL A;  1DF0 A;  4P6G A;  1ICF A;  1U9Q X;  1QDQ A;  2JQG R;  1BGO A;  2FQ9 A;  3K24 A;  2OP3 A;  2Y6E A;  3NHE A;  4W5C A;  2WBF X;  3PDF A;  1PIP A;  3OVZ A;  2XU4 A;  1NLJ A;  2HH5 A;  3RVX A;  2CB5 A;  5J94 A;  1A6R A;  2C0Y A;  3HHA A;  2PAD A;  1ATK A;  2GFO A;  4N79 A;  3CH3 X;  3KWB X;  3KW9 A;  3GCB A;  5A24 A;  2AIM A;  4I04 A;  1BQI A;  1KHP A;  3IUT A;  1O0E A;  1TL9 A;  4CDE B;  2DJF B;  2OZ2 A;  4WA6 A;  4W4U A;  3ERV A;  1AYU A;  4CDC B;  1POP A;  2IBI A;  2DCC A;  5CVM A;  4I07 A;  1PE6 A;  3CH2 X;  3LXS A;  3ZUA A;  3IEJ A;  3BWK A;  1QOL A;  4CDD B;  2VHS A;  5CVN B;  1ME3 A;  4HWY A;  1ME4 A;  2NQI A;  9PAP A;  1Y08 A;  4BPV A;  3F75 A;  4XR7 A;  1MEG A;  1VSN A;  3BOW A;  2YJB A;  3H89 A;  2ARY A;  2R9F A;  2DCA A;  3I06 A;  1NPZ A;  4DMX A;  2P0R A;  2G7Y A;  1AU0 A;  2PRE A;  2E03 A;  4X6H A;  2H7J A;  3BCN A;  3QJ3 A;  2F1G A;  4G54 A;  3HHI A;  2XU3 A;  2JQF R;  1PXV A;  3LFY A;  1AYW A;  1U9W A;  2AYO A;  2ACT A;  2FT2 A;  3AI8 A;  1THE A;  5FPW A;  1BY8 A;  4FIP A;  1VJV A;  3O1G A;  3P5U A;  1Q6K A;  4XUI A;  2YJC A;  3N4C A;  3PBH A;  2FYE A;  3D6S A;  1NB3 A;  1AIM A;  3N3G A;  4YYW A;  3CBK A;  2DZZ A;  3KX1 A;  3MHH A;  3OF8 A;  3USV A;  2O6X A;  1NB5 A;  2FO5 A;  1AYV A;  1MDW A;  4YYU A;  4CDF B;  3PW3 A;  4RY2 A;  4MZO A;  4BSQ A;  1PAD A;  1F2A A;  5K16 A;  1PPP A;  4YYQ A;  3O0U A;  2FTD A;  3P5V A;  3HWN A;  1MHW A;  2Y5B A;  4FJC A;  1DEU A;  4PP2 E;  1TU6 A;  2YJ9 A;  3KWZ A;  2G8J A;  5JA7 A;  2PBH A;  4OEM A;  3KKU A;  3K9M A;  4CZW A;  3H6S A;  4PP1 A;  4QRG A;  3QSD A;  2XU1 A;  3E1Z B;  5CHT A;  4YYV A;  1AEC A;  4Q8H A;  1CTE A;  1GMY A;  3BC3 A;  3BPM A;  1CB5 A;  3MTN A;  2R9N A;  4YYR A;  1PBH A;  3F5V A;  4BS6 A; 
#chains in the Genus database with same CATH topology
 4YYS A;  4QH6 A;  2G6D A;  4OVZ A;  5CVO B;  1FH0 A;  2ATO A;  4FK5 A;  1DKI A;  1PPD A;  2YJ8 A;  1EWM A;  1STF E;  1UKF A;  4QRX A;  5EZS A;  1NL6 A;  4OEL A;  3WXG A;  1QXP A;  4D8B A;  3IMA A;  6PAD A;  4QBB A;  2G8E A;  2DC8 A;  3MHS A;  1SNK A;  2AYN A;  4RF1 A;  2GHU A;  2AGA A;  4P6E A;  1YK7 A;  2BDL A;  1CPJ A;  3OF9 A;  1AU4 A;  1Y4H A;  2E00 A;  2DC9 A;  1YVB A;  4N8W A;  4AXM A;  1HUC B;  1EWP A;  1TLO A;  3KFQ A;  1KFU L;  2DCB A;  3H8C A;  2IPP B;  2J7Q A;  4REZ A;  2DC7 A;  2Z84 A;  2DC6 A;  3W30 A;  3WXE A;  4BQV A;  2F7D A;  2AUZ A;  2NQA A;  4PAD A;  5KO3 A;  4IUM A;  1U9X A;  2R9C A;  3PT2 A;  3P5X A;  3B79 A;  1GLO A;  5CHV A;  2HXZ A;  4WUR A;  3IOQ A;  1X9Y A;  2VHF A;  1BP4 A;  1K3B B;  3M99 A;  1CS8 A;  4DMY A;  3E9S A;  3W31 A;  3BBA A;  4ZTB A;  1ITO A;  3V6C A;  1EF7 A;  2FRA A;  2R9O A;  1KXR A;  4BOP A;  4X6I A;  5JH3 A;  3PRM A;  1XKG A;  1SP4 B;  3KSE A;  3RVW A;  3MOR A;  4ZUX U;  1M6D A;  3BPF A;  4MZS A;  1U9V A;  1F29 A;  5F02 A;  4M0W A;  2R6N A;  1ZIV A;  2R9M A;  2HHN A;  2FUD A;  1GEC E;  3WXF A;  1EWO A;  2PNS A;  2AU1 A;  3N3K A;  2E02 A;  1F2B A;  1CQD A;  3TNX A;  4PI3 A;  3V6E A;  2YJ2 A;  2P86 A;  1CV8 A;  1ZCM A;  2BTW A;  5JZE A;  1NQC A;  1F2C A;  3S3R A;  2AUX A;  3C9E A;  3PNR A;  2XU5 A;  1GCB A;  2E01 A;  1MS6 A;  3PSE A;  1YZB A;  8PCH A;  1PPN A;  2DZY A;  1JQP A;  2NQD B;  1YT7 A;  2BDZ A;  2FRQ A;  3IHP A;  1PPO A;  5EF4 A;  4YVA A;  2B1N A;  1PCI A;  2DJG B;  2AS8 A;  4HXD B;  1KFX L;  4W5B A;  3TMP A;  3DF0 A;  3RVV A;  4BOQ A;  2HWK A;  4QRV A;  1QMY A;  2NQG A;  2HD5 A;  2P7U A;  1CVZ A;  1IWD A;  7PCK A;  3S3Q A;  4MSX A;  1KHQ A;  2DCD A;  4X6J A;  4Q8G A;  4N4Z A;  4OW0 A;  5E6J A;  1AU2 A;  3QT4 A;  2B1M A;  1YAL A;  1U5I A;  3H8B A;  3OVX A;  1YK8 A;  3K8U A;  4RF0 A;  3B21 A;  3OIS A;  3P5W A;  4KLB A;  3H7D A;  1MIR A;  3HD3 A;  3CBJ A;  2AVW A;  3I3T A;  2OUL A;  5EZQ A;  3IV2 A;  3MJ5 A;  4AXL A;  4K7C A;  5EGW A;  1S4V A;  5PAD A;  1CJL A;  1MEM A;  4YV8 A;  4A5U A;  1AU3 A;  2J7Q C;  2CIO A;  1CSB B;  3U8E A;  2BTW B;  4BS5 A;  4I05 A;  1EWL A;  1DF0 A;  4P6G A;  4BOZ A;  1ICF A;  1U9Q X;  1QDQ A;  2JQG R;  1BGO A;  2FQ9 A;  4GUA A;  3K24 A;  2OP3 A;  2Y6E A;  3NHE A;  4W5C A;  2WBF X;  3PDF A;  1PIP A;  3OVZ A;  2XU4 A;  1NLJ A;  2HH5 A;  4R3D A;  3RVX A;  2BU3 A;  2CB5 A;  5J94 A;  1A6R A;  2C0Y A;  3HHA A;  3PRP A;  2PAD A;  1ATK A;  2GFO A;  4N79 A;  3CH3 X;  3KWB X;  3KW9 A;  3GCB A;  5A24 A;  2AIM A;  4I04 A;  1BQI A;  1KHP A;  3ZNH A;  3IUT A;  1O0E A;  1TL9 A;  4CDE B;  2DJF B;  2OZ2 A;  3MP2 A;  4WA6 A;  4W4U A;  3ERV A;  2FE8 A;  1AYU A;  4CDC B;  1POP A;  2IBI A;  2DCC A;  5CVM A;  4I07 A;  1PE6 A;  3CH2 X;  3LXS A;  3ZUA A;  3IEJ A;  3BWK A;  1QOL A;  3BB7 A;  4CDD B;  2VHS A;  5CVN B;  3BY4 A;  1ME3 A;  3TRK A;  4OVZ B;  4HWY A;  1ME4 A;  2NQI A;  9PAP A;  1Y08 A;  4BPV A;  3F75 A;  3C0R A;  4XR7 A;  1MEG A;  1VSN A;  3BOW A;  2YJB A;  3H89 A;  2ARY A;  2R9F A;  1PVJ A;  2DCA A;  4P16 A;  3I06 A;  1NPZ A;  4D8E A;  3O65 A;  4DMX A;  3PHW A;  2P0R A;  2G7Y A;  1AU0 A;  3MTV A;  2PRE A;  2E03 A;  4X6H A;  2H7J A;  3BCN A;  3QJ3 A;  2F1G A;  3PHU A;  3PHX A;  4G54 A;  3HHI A;  2XU3 A;  2JQF R;  1PXV A;  3LFY A;  1AYW A;  1U9W A;  2AYO A;  2ACT A;  3OQC A;  2FT2 A;  3AI8 A;  1THE A;  5FPW A;  1BY8 A;  4FIP A;  1VJV A;  3O1G A;  3IFU A;  2JTC A;  3P5U A;  1Q6K A;  4XUI A;  2YJC A;  3N4C A;  3PBH A;  2FYE A;  3D6S A;  1NB3 A;  1AIM A;  3N3G A;  4MI7 A;  2DOS A;  4YYW A;  3CBK A;  2UZJ A;  2DZZ A;  3KX1 A;  3MHH A;  4BOU A;  3OF8 A;  3USV A;  2O6X A;  1NB5 A;  2FO5 A;  1AYV A;  1MDW A;  4YYU A;  2JRI A;  4CDF B;  3PW3 A;  4RY2 A;  4IP3 A;  4MZO A;  4BSQ A;  1PAD A;  4BOS A;  1F2A A;  5K16 A;  4PT5 A;  1PPP A;  4YYQ A;  3O0U A;  2FTD A;  3P5V A;  4XZX A;  3HWN A;  1MHW A;  2Y5B A;  4FJC A;  1DEU A;  4PP2 E;  1TU6 A;  2YJ9 A;  3KWZ A;  3RNV A;  2G8J A;  5JA7 A;  2PBH A;  4OEM A;  3KKU A;  3K9M A;  4CZW A;  3H6S A;  4PP1 A;  4QRG A;  3QSD A;  4MM3 B;  2XU1 A;  4D8I A;  3E1Z B;  4RNA A;  5CHT A;  4YYV A;  1AEC A;  4Q8H A;  1CTE A;  1GMY A;  3BC3 A;  3BPM A;  1CB5 A;  3MTN A;  2R9N A;  4RKX A;  4YYR A;  1PBH A;  3F5V A;  4BS6 A; 
#chains in the Genus database with same CATH homology
 4YYS A;  4QH6 A;  2G6D A;  5CVO B;  1FH0 A;  2ATO A;  1PPD A;  4FK5 A;  2YJ8 A;  4GUZ A;  1EWM A;  1STF E;  4QRX A;  1NL6 A;  4OEL A;  3WXG A;  1QXP A;  6PAD A;  3IMA A;  4QBB A;  2G8E A;  2DC8 A;  3MHS A;  1SNK A;  4B55 A;  2AYN A;  2GHU A;  4P6E A;  1YK7 A;  2BDL A;  1CPJ A;  3OF9 A;  1AU4 A;  1Y4H A;  2E00 A;  2DC9 A;  1YVB A;  4N8W A;  4AXM A;  1HUC B;  1EWP A;  1TLO A;  3KFQ A;  1KFU L;  2DCB A;  3H8C A;  2IPP B;  2DC7 A;  2DC6 A;  3WXE A;  4C5P A;  4BQV A;  2F7D A;  2AUZ A;  2NQA A;  4PAD A;  1U9X A;  2R9C A;  3P5X A;  3B79 A;  1GLO A;  5CHV A;  2HXZ A;  3IOQ A;  1X9Y A;  2VHF A;  1BP4 A;  1K3B B;  3M99 A;  1CS8 A;  4DMY A;  1ITO A;  3V6C A;  1EF7 A;  2FRA A;  2R9O A;  1KXR A;  4X6I A;  5JH3 A;  1XKG A;  1SP4 B;  3KSE A;  3RVW A;  3MOR A;  4ZUX U;  1M6D A;  3BPF A;  4MZS A;  1W6F A;  1U9V A;  1F29 A;  5F02 A;  1W4T A;  2R6N A;  1ZIV A;  2R9M A;  2VFC A;  2HHN A;  2FUD A;  1GEC E;  3WXF A;  1EWO A;  2PNS A;  4BGF A;  2AU1 A;  3N3K A;  2E02 A;  1F2B A;  1CQD A;  3TNX A;  4PI3 A;  3V6E A;  2YJ2 A;  2P86 A;  1CV8 A;  1ZCM A;  1NQC A;  1F2C A;  3S3R A;  2AUX A;  3C9E A;  3PNR A;  2XU5 A;  1GCB A;  2E01 A;  1MS6 A;  8PCH A;  1PPN A;  2DZY A;  1JQP A;  2NQD B;  1E2T A;  1YT7 A;  2BDZ A;  2FRQ A;  3IHP A;  1PPO A;  5EF4 A;  4YVA A;  2B1N A;  1PCI A;  2DJG B;  2AS8 A;  1KFX L;  4W5B A;  3DF0 A;  3RVV A;  4QRV A;  1QMY A;  2NQG A;  2HD5 A;  2P7U A;  1CVZ A;  1IWD A;  7PCK A;  3S3Q A;  4MSX A;  1KHQ A;  2DCD A;  4X6J A;  4Q8G A;  4N4Z A;  1AU2 A;  3QT4 A;  2B1M A;  1YAL A;  1U5I A;  3H8B A;  3OVX A;  1YK8 A;  3K8U A;  3OIS A;  3P5W A;  4KLB A;  3H7D A;  1MIR A;  3HD3 A;  3CBJ A;  2AVW A;  3I3T A;  3LTW A;  2OUL A;  3IV2 A;  4AXL A;  4K7C A;  5EGW A;  2BSZ A;  1S4V A;  5PAD A;  1CJL A;  1MEM A;  4YV8 A;  1AU3 A;  2CIO A;  1CSB B;  3U8E A;  3D9W A;  4BS5 A;  4I05 A;  1EWL A;  1DF0 A;  4P6G A;  1ICF A;  1U9Q X;  1QDQ A;  2JQG R;  1BGO A;  2FQ9 A;  3K24 A;  2OP3 A;  2Y6E A;  3NHE A;  4W5C A;  2WBF X;  3PDF A;  1PIP A;  3OVZ A;  2XU4 A;  1NLJ A;  2HH5 A;  3RVX A;  2CB5 A;  5J94 A;  1A6R A;  2C0Y A;  3HHA A;  2PAD A;  1ATK A;  2GFO A;  4N79 A;  3CH3 X;  3KWB X;  3KW9 A;  3GCB A;  5A24 A;  2AIM A;  4I04 A;  1BQI A;  1KHP A;  3IUT A;  1O0E A;  1TL9 A;  4CDE B;  2DJF B;  2OZ2 A;  4WA6 A;  4W4U A;  3ERV A;  1AYU A;  4CDC B;  1POP A;  2IBI A;  2DCC A;  5CVM A;  4I07 A;  1PE6 A;  3CH2 X;  3LXS A;  4NV8 A;  3ZUA A;  3IEJ A;  3BWK A;  1QOL A;  4CDD B;  2VHS A;  5CVN B;  1ME3 A;  4HWY A;  1ME4 A;  2NQI A;  9PAP A;  1Y08 A;  4BPV A;  3F75 A;  4XR7 A;  1MEG A;  1VSN A;  3BOW A;  2YJB A;  3H89 A;  2ARY A;  2R9F A;  2VFB A;  2DCA A;  3I06 A;  1NPZ A;  4DMX A;  2P0R A;  2G7Y A;  1AU0 A;  2PRE A;  2E03 A;  4X6H A;  2H7J A;  3BCN A;  3QJ3 A;  2F1G A;  4G54 A;  3HHI A;  2XU3 A;  2JQF R;  1PXV A;  3LFY A;  1W5R A;  1AYW A;  1U9W A;  2AYO A;  2ACT A;  2FT2 A;  3AI8 A;  1GX3 A;  1THE A;  5FPW A;  1BY8 A;  4FIP A;  1VJV A;  3O1G A;  3P5U A;  1Q6K A;  4XUI A;  2YJC A;  3N4C A;  3PBH A;  2FYE A;  3D6S A;  1NB3 A;  1AIM A;  3N3G A;  4YYW A;  3CBK A;  2DZZ A;  3KX1 A;  3MHH A;  3OF8 A;  3USV A;  2O6X A;  1NB5 A;  2FO5 A;  1AYV A;  1MDW A;  4YYU A;  4CDF B;  3PW3 A;  4RY2 A;  4MZO A;  4BSQ A;  1PAD A;  1F2A A;  5K16 A;  1PPP A;  4YYQ A;  3O0U A;  2FTD A;  3P5V A;  3HWN A;  1MHW A;  2Y5B A;  4FJC A;  4NV7 A;  1DEU A;  4PP2 E;  1TU6 A;  2YJ9 A;  3KWZ A;  2G8J A;  5JA7 A;  2PBH A;  4OEM A;  3KKU A;  3K9M A;  4CZW A;  3H6S A;  4PP1 A;  4QRG A;  3QSD A;  2XU1 A;  3E1Z B;  5CHT A;  4YYV A;  1AEC A;  4Q8H A;  1CTE A;  1GMY A;  3BC3 A;  3BPM A;  1CB5 A;  3MTN A;  2R9N A;  4YYR A;  1PBH A;  3F5V A;  4BS6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...