5K16A

Crystal structure of free ubiquitin-specific protease 12
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
350
structure length
324
Chain Sequence
SALEKEIGPEQFPVNEHYFGLVNFGNTCYCNSVLQALYFCRPFREKVLAYKSQKKESLLTCLADLFHSIATQKKKVGVIPPKKFITRLRKENELFDNYMQQDAHEFLNYLLNTIADILQEERKQEKQNPDPTWVHEIFQGTLTNETRCLTCETISSKDEDFLDLSVDVEQNTSITHCLRGFSNTETKYYCEECRSKQEAHKRMKVKKLPMILALHLKRFKYMDQLHRYTKLSYRVVFPLELRLFNTSGDATNPDRMYDLVAVVVHCGSGPNRGHYIAIVKSHDFWLLFDDDIVEKIDAQAIEEFYGLTSKNSESGYILFYQSRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Allosteric Activation of Ubiquitin-Specific Proteases by beta-Propeller Proteins UAF1 and WDR20.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Ubiquitin carboxyl-terminal hydrolase 12
total genus 93
structure length 324
sequence length 350
chains with identical sequence B
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2016-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00443 UCH Ubiquitin carboxyl-terminal hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 5k16A00
2B1NA 4P6EA 4YYQA 4MZOA 2HXZA 1PIPA 1Y08A 1PPNA 3QJ3A 3F5VA 4HWYA 1VJVA 2DZYA 1ATKA 2WBFX 3KSEA 2FUDA 1TL9A 1GMYA 4BPVA 5JA7A 1VSNA 3N4CA 3HHIA 3OVZA 3HHAA 1DF0A 1Y4HA 2OULA 4YYSA 2DZZA 5CVNB 2AS8A 3AI8A 2GHUA 3DF0A 1F2CA 2JQFR 2PNSA 1NLJA 1Q6KA 2R9OA 4WA6A 2IBIA 4DMXA 1EWOA 2FQ9A 2XU1A 4X6IA 1IWDA 1CV8A 3MORA 3IEJA 2AYOA 3LXSA 3IUTA 1ME4A 2YJ8A 2PREA 2R9MA 3IHPA 1THEA 1BQIA 2B1MA 1AECA 2NQDB 7PCKA 5EF4A 1PCIA 4CDCB 1GCBA 3ZUAA 4I05A 2Y6EA 1S4VA 3KWZA 1NL6A 1CPJA 1DEUA 1F2BA 2XU4A 3IMAA 2YJ9A 3V6CA 1XKGA 3H7DA 1AYWA 1TU6A 3H8CA 3HWNA 4P6GA 1KXRA 2R9NA 3S3RA 1HUCB 4CZWA 1QMYA 4Q8GA 4KLBA 2DC9A 5JH3A 3I3TA 5CHTA 3OVXA 1U9WA 1CS8A 5F02A 1NB3A 2ARYA 2AUXA 4YYRA 2FO5A 1PPOA 3RVXA 2E00A 3BCNA 3P5WA 1AIMA 1NB5A 3OF8A 5CHVA 2C0YA 3OISA 2PBHA 8PCHA 1PXVA 3U8EA 1QXPA 4FK5A 2Y5BA 1NQCA 5K16A 2BDLA 3O1GA 4W5CA 1U9XA 3CH2X 3PDFA 4PP1A 2FTDA 4QRXA 3WXEA 2ATOA 1EWPA 1TLOA 4QBBA 1NPZA 4N8WA 1KHQA 2F7DA 2FRQA 3BPMA 1CTEA 2AUZA 2HH5A 2G8JA 4N79A 2PADA 1POPA 3BWKA 1MHWA 4YYUA 1SNKA 3D6SA 1GECE 2NQAA 3I06A 4CDEB 3K8UA 3NHEA 3PBHA 1AU3A 4W4UA 2OZ2A 1CVZA 1GLOA 1BP4A 2AU1A 1YVBA 2DCAA 3P5XA 3PW3A 2R6NA 4OEMA 3GCBA 3WXGA 2H7JA 2VHFA 9PAPA 4QRGA 4Q8HA 1PE6A 4ZUXU 3KW9A 2DC7A 2FRAA 1ICFA 1YK8A 3HD3A 2CB5A 4PP2E 1U9VA 1M6DA 2P86A 3CH3X 3WXFA 1BY8A 2G8EA 3P5VA 1CB5A 3CBJA 2YJ2A 3KKUA 4CDDB 2E02A 3KWBX 1YALA 2E01A 1QOLA 4AXLA 4BQVA 1CQDA 3QT4A 3CBKA 5J94A 3P5UA 1STFE 1EWLA 1F29A 3H8BA 3H89A 2DCBA 3USVA 1PPPA 2R9CA 4PADA 1JQPA 4RY2A 3N3KA 2BDZA 1AU4A 2NQGA 2YJCA 2JQGR 1KFUL 2FYEA 3IV2A 2AYNA 4QRVA 3B79A 4XR7A 4YV8A 1AU2A 4K7CA 2XU5A 3K9MA 2G6DA 4BSQA 2P0RA 3M99A 4G54A 2NQIA 1YK7A 2DC6A 1U9QX 2FT2A 2IPPB 1CJLA 2AIMA 3RVVA 2DCDA 4FJCA 2HD5A 4X6JA 2R9FA 1ITOA 4PI3A 3PNRA 5EGWA 1F2AA 2GFOA 3BPFA 2DC8A 3E1ZB 1YT7A 4OELA 3H6SA 2XU3A 1PPDA 2YJBA 3O0UA 3OF9A 3MHSA 2P7UA 4YVAA 4DMYA 4AXMA 3S3QA 2DJFB 4FIPA 4QH6A 1O0EA 2F1GA 4I04A 4BS5A 1MEMA 3C9EA 1MEGA 1CSBB 2AVWA 2HHNA 3MTNA 2CIOA 5A24A 2DJGB 3IOQA 1QDQA 4BS6A 1ZIVA 1K3BB 1SP4B 1ZCMA 1EF7A 4N4ZA 1MIRA 1MS6A 1MDWA 2G7YA 2ACTA 3F75A 4W5BA 3BOWA 3TNXA 5PADA 5CVOB 4XUIA 5CVMA 1KHPA 1AYVA 1FH0A 1KFXL 4X6HA 1PADA 5FPWA 3BC3A 1EWMA 1A6RA 1AYUA 3V6EA 4MSXA 1BGOA 2OP3A 3RVWA 1PBHA 3QSDA 4I07A 2VHSA 3LFYA 3ERVA 2DCCA 1X9YA 3KFQA 3N3GA 3MHHA 2E03A 4CDFB 1ME3A 2O6XA 4YYVA 6PADA 1AU0A 1U5IA 4YYWA 3K24A 4MZSA 3KX1A
chains in the Genus database with same CATH superfamily
2B1NA 4P6EA 4YYQA 4MZOA 2HXZA 5KO3A 1PIPA 4D8BA 1Y08A 1PPNA 3QJ3A 3F5VA 4HWYA 1VJVA 2DZYA 1ATKA 2WBFX 3KSEA 2FUDA 1TL9A 2J7QC 1GMYA 4BPVA 5JA7A 1VSNA 3N4CA 3HHIA 3OVZA 3HHAA 1DF0A 1Y4HA 2OULA 4YYSA 2DZZA 5CVNB 2AS8A 3AI8A 2GHUA 3DF0A 1F2CA 3PHWA 2JQFR 2PNSA 1NLJA 1Q6KA 2R9OA 4WA6A 2IBIA 4HXDB 4DMXA 1EWOA 2FQ9A 4BOUA 3MJ5A 1UKFA 2XU1A 4X6IA 1IWDA 1CV8A 3PHXA 3MORA 3IEJA 2AYOA 3LXSA 3IUTA 1ME4A 2YJ8A 2PREA 2R9MA 3IHPA 1THEA 3PSEA 1BQIA 2B1MA 1AECA 2NQDB 7PCKA 5EF4A 3OQCA 1PCIA 4CDCB 1GCBA 3ZUAA 2BU3A 4I05A 2Y6EA 1S4VA 3KWZA 1NL6A 3PRPA 1CPJA 1DEUA 1F2BA 2XU4A 3IMAA 2YJ9A 3V6CA 1XKGA 3H7DA 1AYWA 3PT2A 1TU6A 3H8CA 3HWNA 4P6GA 1KXRA 2R9NA 4OVZB 3S3RA 1HUCB 4REZA 4CZWA 5EZSA 1QMYA 4Q8GA 4KLBA 2DC9A 5JH3A 3I3TA 5CHTA 3OVXA 1U9WA 1CS8A 5F02A 1NB3A 2ARYA 2AUXA 4YYRA 2FO5A 1PPOA 3RVXA 4D8IA 2E00A 3BCNA 3P5WA 1AIMA 1NB5A 3OF8A 4BOQA 5CHVA 2C0YA 3OISA 2PBHA 8PCHA 1PXVA 3U8EA 1QXPA 4FK5A 2Y5BA 1NQCA 5K16A 2BDLA 3O1GA 4W5CA 1U9XA 3CH2X 3E9SA 3PDFA 4PP1A 2FTDA 4QRXA 3WXEA 2ATOA 1EWPA 1TLOA 4BOZA 4BOSA 4QBBA 1NPZA 2UZJA 4D8EA 4N8WA 1KHQA 4IUMA 5EZQA 4ZTBA 2F7DA 2FRQA 3BPMA 1CTEA 2AUZA 2HH5A 2JRIA 2G8JA 4N79A 2PADA 1POPA 3BWKA 1MHWA 4YYUA 5JZEA 1SNKA 3PHUA 3W30A 4MM3B 3D6SA 1GECE 2NQAA 3I06A 4CDEB 4RNAA 4WURA 3K8UA 3NHEA 3PBHA 1AU3A 4W4UA 2OZ2A 1CVZA 1GLOA 1BP4A 2AU1A 1YVBA 3MP2A 2DCAA 3P5XA 3PW3A 3C0RA 2R6NA 4OEMA 3GCBA 3WXGA 2H7JA 4BOPA 2VHFA 9PAPA 4QRGA 4Q8HA 1PE6A 4ZUXU 3KW9A 2DC7A 2FRAA 1ICFA 1YK8A 3HD3A 1DKIA 5E6JA 2CB5A 3MTVA 4PP2E 4RF1A 1U9VA 1M6DA 2P86A 3CH3X 3WXFA 2BTWA 1BY8A 2G8EA 3P5VA 1CB5A 4OW0A 3CBJA 2YJ2A 3KKUA 4CDDB 2FE8A 4P16A 2E02A 3KWBX 1YALA 2E01A 3BB7A 2DOSA 1QOLA 2J7QA 4AXLA 4BQVA 1CQDA 3QT4A 3CBKA 4IP3A 5J94A 4R3DA 3P5UA 1STFE 1EWLA 4XZXA 1F29A 4PT5A 3H8BA 3H89A 2DCBA 3USVA 1PPPA 3ZNHA 2R9CA 4PADA 3TMPA 1JQPA 4RY2A 3N3KA 2BDZA 1AU4A 2NQGA 2YJCA 2JQGR 1KFUL 2FYEA 3IV2A 2AYNA 4QRVA 3B79A 4XR7A 4YV8A 1AU2A 4K7CA 2XU5A 3K9MA 2G6DA 4BSQA 4MI7A 2P0RA 3M99A 4G54A 2NQIA 1YK7A 2DC6A 1U9QX 2FT2A 2IPPB 1CJLA 2AIMA 3RVVA 2DCDA 4FJCA 2HD5A 4X6JA 2R9FA 1ITOA 4PI3A 3PNRA 5EGWA 2BTWB 1F2AA 2GFOA 3BPFA 2DC8A 3E1ZB 1YT7A 3BY4A 4OELA 3H6SA 2XU3A 1PPDA 2YJBA 3O0UA 3OF9A 3PRMA 3MHSA 2P7UA 4YVAA 4DMYA 3TRKA 4AXMA 3S3QA 2DJFB 4A5UA 4FIPA 4QH6A 1PVJA 1O0EA 2F1GA 4I04A 4BS5A 1MEMA 3C9EA 1MEGA 1CSBB 2AVWA 2JTCA 2HHNA 4RKXA 3MTNA 2AGAA 2CIOA 5A24A 4OVZA 2DJGB 3IOQA 1QDQA 4BS6A 1ZIVA 1K3BB 1SP4B 1ZCMA 1EF7A 4N4ZA 1MIRA 1MS6A 1MDWA 2G7YA 4GUAA 2ACTA 3B21A 3F75A 4W5BA 3BOWA 3TNXA 2Z84A 5CVOB 5PADA 4XUIA 3IFUA 5CVMA 3RNVA 1KHPA 1AYVA 1FH0A 1KFXL 4X6HA 2HWKA 3BBAA 1PADA 5FPWA 3BC3A 1EWMA 1A6RA 1AYUA 4M0WA 4RF0A 3V6EA 4MSXA 1BGOA 2OP3A 3RVWA 1PBHA 3QSDA 4I07A 2VHSA 3LFYA 3ERVA 2DCCA 1X9YA 3KFQA 3N3GA 1YZBA 3MHHA 2E03A 4CDFB 1ME3A 2O6XA 4YYVA 3W31A 6PADA 1AU0A 1U5IA 4YYWA 3K24A 4MZSA 3O65A 3KX1A
chains in the Genus database with same CATH topology
2B1NA 4P6EA 4YYQA 4MZOA 2HXZA 1PIPA 1Y08A 1PPNA 3QJ3A 3F5VA 4HWYA 1VJVA 2DZYA 1ATKA 2WBFX 3KSEA 2FUDA 1TL9A 4C5PA 1GMYA 4BPVA 5JA7A 1VSNA 3N4CA 3HHIA 3OVZA 3HHAA 2VFBA 1DF0A 1Y4HA 2OULA 4YYSA 2DZZA 5CVNB 2AS8A 3AI8A 2GHUA 3DF0A 1F2CA 2JQFR 2PNSA 1NLJA 1Q6KA 2R9OA 4WA6A 2IBIA 4DMXA 1EWOA 2FQ9A 4B55A 4BGFA 4GUZA 2XU1A 4X6IA 1IWDA 1CV8A 3MORA 3IEJA 2AYOA 3LXSA 3IUTA 1ME4A 2YJ8A 2PREA 2R9MA 3IHPA 1THEA 1BQIA 2B1MA 1AECA 2NQDB 7PCKA 5EF4A 1PCIA 4CDCB 1GCBA 3ZUAA 4I05A 2Y6EA 1S4VA 3KWZA 1NL6A 1CPJA 1DEUA 1F2BA 2XU4A 3IMAA 2YJ9A 3V6CA 1XKGA 2VFCA 3H7DA 1AYWA 1TU6A 3H8CA 3HWNA 4P6GA 1KXRA 2R9NA 3S3RA 1HUCB 4CZWA 1QMYA 4Q8GA 4KLBA 2DC9A 5JH3A 3I3TA 5CHTA 3OVXA 1U9WA 4NV7A 1CS8A 5F02A 1NB3A 2ARYA 2AUXA 4YYRA 2FO5A 1PPOA 3RVXA 2E00A 3BCNA 3P5WA 1AIMA 1NB5A 3OF8A 5CHVA 2C0YA 3OISA 2PBHA 8PCHA 1PXVA 3U8EA 1QXPA 4FK5A 2Y5BA 1NQCA 5K16A 2BDLA 3O1GA 4W5CA 1U9XA 3CH2X 3PDFA 4PP1A 2FTDA 4QRXA 3WXEA 2ATOA 4NV8A 1EWPA 1TLOA 4QBBA 1NPZA 4N8WA 1KHQA 2F7DA 2FRQA 3BPMA 1CTEA 2AUZA 2HH5A 2G8JA 4N79A 2PADA 1POPA 3BWKA 1MHWA 4YYUA 1SNKA 3D6SA 1GECE 2NQAA 3I06A 4CDEB 3K8UA 3NHEA 3PBHA 1AU3A 4W4UA 2OZ2A 1CVZA 1GLOA 1BP4A 2AU1A 1YVBA 2DCAA 3P5XA 3PW3A 2R6NA 4OEMA 3GCBA 3WXGA 2H7JA 2VHFA 9PAPA 4QRGA 4Q8HA 1PE6A 4ZUXU 3KW9A 2DC7A 2FRAA 1ICFA 1YK8A 3HD3A 2BSZA 2CB5A 4PP2E 1U9VA 1M6DA 2P86A 3CH3X 3WXFA 1BY8A 3LTWA 2G8EA 3P5VA 1CB5A 3CBJA 2YJ2A 3KKUA 3D9WA 4CDDB 2E02A 3KWBX 1YALA 2E01A 1QOLA 4AXLA 4BQVA 1CQDA 3QT4A 3CBKA 5J94A 3P5UA 1STFE 1EWLA 1F29A 3H8BA 3H89A 2DCBA 3USVA 1PPPA 2R9CA 4PADA 1JQPA 4RY2A 1W6FA 3N3KA 2BDZA 1AU4A 2NQGA 2YJCA 2JQGR 1KFUL 2FYEA 3IV2A 2AYNA 4QRVA 3B79A 4XR7A 4YV8A 1AU2A 4K7CA 2XU5A 3K9MA 2G6DA 4BSQA 2P0RA 3M99A 4G54A 2NQIA 1YK7A 2DC6A 1E2TA 1U9QX 2FT2A 2IPPB 1CJLA 1GX3A 2AIMA 3RVVA 2DCDA 4FJCA 2HD5A 4X6JA 2R9FA 1ITOA 4PI3A 3PNRA 5EGWA 1F2AA 2GFOA 3BPFA 2DC8A 3E1ZB 1YT7A 4OELA 3H6SA 2XU3A 1PPDA 2YJBA 3O0UA 3OF9A 1W4TA 3MHSA 2P7UA 4YVAA 4DMYA 4AXMA 3S3QA 2DJFB 4FIPA 4QH6A 1O0EA 2F1GA 4I04A 4BS5A 1MEMA 3C9EA 1MEGA 1CSBB 2AVWA 1W5RA 2HHNA 3MTNA 2CIOA 5A24A 2DJGB 3IOQA 1QDQA 4BS6A 1ZIVA 1K3BB 1SP4B 1ZCMA 1EF7A 4N4ZA 1MIRA 1MS6A 1MDWA 2G7YA 2ACTA 3F75A 4W5BA 3BOWA 3TNXA 5PADA 5CVOB 4XUIA 5CVMA 1KHPA 1AYVA 1FH0A 1KFXL 4X6HA 1PADA 5FPWA 3BC3A 1EWMA 1A6RA 1AYUA 3V6EA 4MSXA 1BGOA 2OP3A 3RVWA 1PBHA 3QSDA 4I07A 2VHSA 3LFYA 3ERVA 2DCCA 1X9YA 3KFQA 3N3GA 3MHHA 2E03A 4CDFB 1ME3A 2O6XA 4YYVA 6PADA 1AU0A 1U5IA 4YYWA 3K24A 4MZSA 3KX1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B1N A;  4P6E A;  4YYQ A;  4MZO A;  2HXZ A;  1PIP A;  1Y08 A;  1PPN A;  3QJ3 A;  3F5V A;  4HWY A;  1VJV A;  2DZY A;  1ATK A;  2WBF X;  3KSE A;  2FUD A;  1TL9 A;  1GMY A;  4BPV A;  5JA7 A;  1VSN A;  3N4C A;  3HHI A;  3OVZ A;  3HHA A;  1DF0 A;  1Y4H A;  2OUL A;  4YYS A;  2DZZ A;  5CVN B;  2AS8 A;  3AI8 A;  2GHU A;  3DF0 A;  1F2C A;  2JQF R;  2PNS A;  1NLJ A;  1Q6K A;  2R9O A;  4WA6 A;  2IBI A;  4DMX A;  1EWO A;  2FQ9 A;  2XU1 A;  4X6I A;  1IWD A;  1CV8 A;  3MOR A;  3IEJ A;  2AYO A;  3LXS A;  3IUT A;  1ME4 A;  2YJ8 A;  2PRE A;  2R9M A;  3IHP A;  1THE A;  1BQI A;  2B1M A;  1AEC A;  2NQD B;  7PCK A;  5EF4 A;  1PCI A;  4CDC B;  1GCB A;  3ZUA A;  4I05 A;  2Y6E A;  1S4V A;  3KWZ A;  1NL6 A;  1CPJ A;  1DEU A;  1F2B A;  2XU4 A;  3IMA A;  2YJ9 A;  3V6C A;  1XKG A;  3H7D A;  1AYW A;  1TU6 A;  3H8C A;  3HWN A;  4P6G A;  1KXR A;  2R9N A;  3S3R A;  1HUC B;  4CZW A;  1QMY A;  4Q8G A;  4KLB A;  2DC9 A;  5JH3 A;  3I3T A;  5CHT A;  3OVX A;  1U9W A;  1CS8 A;  5F02 A;  1NB3 A;  2ARY A;  2AUX A;  4YYR A;  2FO5 A;  1PPO A;  3RVX A;  2E00 A;  3BCN A;  3P5W A;  1AIM A;  1NB5 A;  3OF8 A;  5CHV A;  2C0Y A;  3OIS A;  2PBH A;  8PCH A;  1PXV A;  3U8E A;  1QXP A;  4FK5 A;  2Y5B A;  1NQC A;  5K16 A;  2BDL A;  3O1G A;  4W5C A;  1U9X A;  3CH2 X;  3PDF A;  4PP1 A;  2FTD A;  4QRX A;  3WXE A;  2ATO A;  1EWP A;  1TLO A;  4QBB A;  1NPZ A;  4N8W A;  1KHQ A;  2F7D A;  2FRQ A;  3BPM A;  1CTE A;  2AUZ A;  2HH5 A;  2G8J A;  4N79 A;  2PAD A;  1POP A;  3BWK A;  1MHW A;  4YYU A;  1SNK A;  3D6S A;  1GEC E;  2NQA A;  3I06 A;  4CDE B;  3K8U A;  3NHE A;  3PBH A;  1AU3 A;  4W4U A;  2OZ2 A;  1CVZ A;  1GLO A;  1BP4 A;  2AU1 A;  1YVB A;  2DCA A;  3P5X A;  3PW3 A;  2R6N A;  4OEM A;  3GCB A;  3WXG A;  2H7J A;  2VHF A;  9PAP A;  4QRG A;  4Q8H A;  1PE6 A;  4ZUX U;  3KW9 A;  2DC7 A;  2FRA A;  1ICF A;  1YK8 A;  3HD3 A;  2CB5 A;  4PP2 E;  1U9V A;  1M6D A;  2P86 A;  3CH3 X;  3WXF A;  1BY8 A;  2G8E A;  3P5V A;  1CB5 A;  3CBJ A;  2YJ2 A;  3KKU A;  4CDD B;  2E02 A;  3KWB X;  1YAL A;  2E01 A;  1QOL A;  4AXL A;  4BQV A;  1CQD A;  3QT4 A;  3CBK A;  5J94 A;  3P5U A;  1STF E;  1EWL A;  1F29 A;  3H8B A;  3H89 A;  2DCB A;  3USV A;  1PPP A;  2R9C A;  4PAD A;  1JQP A;  4RY2 A;  3N3K A;  2BDZ A;  1AU4 A;  2NQG A;  2YJC A;  2JQG R;  1KFU L;  2FYE A;  3IV2 A;  2AYN A;  4QRV A;  3B79 A;  4XR7 A;  4YV8 A;  1AU2 A;  4K7C A;  2XU5 A;  3K9M A;  2G6D A;  4BSQ A;  2P0R A;  3M99 A;  4G54 A;  2NQI A;  1YK7 A;  2DC6 A;  1U9Q X;  2FT2 A;  2IPP B;  1CJL A;  2AIM A;  3RVV A;  2DCD A;  4FJC A;  2HD5 A;  4X6J A;  2R9F A;  1ITO A;  4PI3 A;  3PNR A;  5EGW A;  1F2A A;  2GFO A;  3BPF A;  2DC8 A;  3E1Z B;  1YT7 A;  4OEL A;  3H6S A;  2XU3 A;  1PPD A;  2YJB A;  3O0U A;  3OF9 A;  3MHS A;  2P7U A;  4YVA A;  4DMY A;  4AXM A;  3S3Q A;  2DJF B;  4FIP A;  4QH6 A;  1O0E A;  2F1G A;  4I04 A;  4BS5 A;  1MEM A;  3C9E A;  1MEG A;  1CSB B;  2AVW A;  2HHN A;  3MTN A;  2CIO A;  5A24 A;  2DJG B;  3IOQ A;  1QDQ A;  4BS6 A;  1ZIV A;  1K3B B;  1SP4 B;  1ZCM A;  1EF7 A;  4N4Z A;  1MIR A;  1MS6 A;  1MDW A;  2G7Y A;  2ACT A;  3F75 A;  4W5B A;  3BOW A;  3TNX A;  5PAD A;  5CVO B;  4XUI A;  5CVM A;  1KHP A;  1AYV A;  1FH0 A;  1KFX L;  4X6H A;  1PAD A;  5FPW A;  3BC3 A;  1EWM A;  1A6R A;  1AYU A;  3V6E A;  4MSX A;  1BGO A;  2OP3 A;  3RVW A;  1PBH A;  3QSD A;  4I07 A;  2VHS A;  3LFY A;  3ERV A;  2DCC A;  1X9Y A;  3KFQ A;  3N3G A;  3MHH A;  2E03 A;  4CDF B;  1ME3 A;  2O6X A;  4YYV A;  6PAD A;  1AU0 A;  1U5I A;  4YYW A;  3K24 A;  4MZS A;  3KX1 A; 
#chains in the Genus database with same CATH topology
 2B1N A;  4P6E A;  4YYQ A;  4MZO A;  2HXZ A;  5KO3 A;  1PIP A;  4D8B A;  1Y08 A;  1PPN A;  3QJ3 A;  3F5V A;  4HWY A;  1VJV A;  2DZY A;  1ATK A;  2WBF X;  3KSE A;  2FUD A;  1TL9 A;  2J7Q C;  1GMY A;  4BPV A;  5JA7 A;  1VSN A;  3N4C A;  3HHI A;  3OVZ A;  3HHA A;  1DF0 A;  1Y4H A;  2OUL A;  4YYS A;  2DZZ A;  5CVN B;  2AS8 A;  3AI8 A;  2GHU A;  3DF0 A;  1F2C A;  3PHW A;  2JQF R;  2PNS A;  1NLJ A;  1Q6K A;  2R9O A;  4WA6 A;  2IBI A;  4HXD B;  4DMX A;  1EWO A;  2FQ9 A;  4BOU A;  3MJ5 A;  1UKF A;  2XU1 A;  4X6I A;  1IWD A;  1CV8 A;  3PHX A;  3MOR A;  3IEJ A;  2AYO A;  3LXS A;  3IUT A;  1ME4 A;  2YJ8 A;  2PRE A;  2R9M A;  3IHP A;  1THE A;  3PSE A;  1BQI A;  2B1M A;  1AEC A;  2NQD B;  7PCK A;  5EF4 A;  3OQC A;  1PCI A;  4CDC B;  1GCB A;  3ZUA A;  2BU3 A;  4I05 A;  2Y6E A;  1S4V A;  3KWZ A;  1NL6 A;  3PRP A;  1CPJ A;  1DEU A;  1F2B A;  2XU4 A;  3IMA A;  2YJ9 A;  3V6C A;  1XKG A;  3H7D A;  1AYW A;  3PT2 A;  1TU6 A;  3H8C A;  3HWN A;  4P6G A;  1KXR A;  2R9N A;  4OVZ B;  3S3R A;  1HUC B;  4REZ A;  4CZW A;  5EZS A;  1QMY A;  4Q8G A;  4KLB A;  2DC9 A;  5JH3 A;  3I3T A;  5CHT A;  3OVX A;  1U9W A;  1CS8 A;  5F02 A;  1NB3 A;  2ARY A;  2AUX A;  4YYR A;  2FO5 A;  1PPO A;  3RVX A;  4D8I A;  2E00 A;  3BCN A;  3P5W A;  1AIM A;  1NB5 A;  3OF8 A;  4BOQ A;  5CHV A;  2C0Y A;  3OIS A;  2PBH A;  8PCH A;  1PXV A;  3U8E A;  1QXP A;  4FK5 A;  2Y5B A;  1NQC A;  5K16 A;  2BDL A;  3O1G A;  4W5C A;  1U9X A;  3CH2 X;  3E9S A;  3PDF A;  4PP1 A;  2FTD A;  4QRX A;  3WXE A;  2ATO A;  1EWP A;  1TLO A;  4BOZ A;  4BOS A;  4QBB A;  1NPZ A;  2UZJ A;  4D8E A;  4N8W A;  1KHQ A;  4IUM A;  5EZQ A;  4ZTB A;  2F7D A;  2FRQ A;  3BPM A;  1CTE A;  2AUZ A;  2HH5 A;  2JRI A;  2G8J A;  4N79 A;  2PAD A;  1POP A;  3BWK A;  1MHW A;  4YYU A;  5JZE A;  1SNK A;  3PHU A;  3W30 A;  4MM3 B;  3D6S A;  1GEC E;  2NQA A;  3I06 A;  4CDE B;  4RNA A;  4WUR A;  3K8U A;  3NHE A;  3PBH A;  1AU3 A;  4W4U A;  2OZ2 A;  1CVZ A;  1GLO A;  1BP4 A;  2AU1 A;  1YVB A;  3MP2 A;  2DCA A;  3P5X A;  3PW3 A;  3C0R A;  2R6N A;  4OEM A;  3GCB A;  3WXG A;  2H7J A;  4BOP A;  2VHF A;  9PAP A;  4QRG A;  4Q8H A;  1PE6 A;  4ZUX U;  3KW9 A;  2DC7 A;  2FRA A;  1ICF A;  1YK8 A;  3HD3 A;  1DKI A;  5E6J A;  2CB5 A;  3MTV A;  4PP2 E;  4RF1 A;  1U9V A;  1M6D A;  2P86 A;  3CH3 X;  3WXF A;  2BTW A;  1BY8 A;  2G8E A;  3P5V A;  1CB5 A;  4OW0 A;  3CBJ A;  2YJ2 A;  3KKU A;  4CDD B;  2FE8 A;  4P16 A;  2E02 A;  3KWB X;  1YAL A;  2E01 A;  3BB7 A;  2DOS A;  1QOL A;  2J7Q A;  4AXL A;  4BQV A;  1CQD A;  3QT4 A;  3CBK A;  4IP3 A;  5J94 A;  4R3D A;  3P5U A;  1STF E;  1EWL A;  4XZX A;  1F29 A;  4PT5 A;  3H8B A;  3H89 A;  2DCB A;  3USV A;  1PPP A;  3ZNH A;  2R9C A;  4PAD A;  3TMP A;  1JQP A;  4RY2 A;  3N3K A;  2BDZ A;  1AU4 A;  2NQG A;  2YJC A;  2JQG R;  1KFU L;  2FYE A;  3IV2 A;  2AYN A;  4QRV A;  3B79 A;  4XR7 A;  4YV8 A;  1AU2 A;  4K7C A;  2XU5 A;  3K9M A;  2G6D A;  4BSQ A;  4MI7 A;  2P0R A;  3M99 A;  4G54 A;  2NQI A;  1YK7 A;  2DC6 A;  1U9Q X;  2FT2 A;  2IPP B;  1CJL A;  2AIM A;  3RVV A;  2DCD A;  4FJC A;  2HD5 A;  4X6J A;  2R9F A;  1ITO A;  4PI3 A;  3PNR A;  5EGW A;  2BTW B;  1F2A A;  2GFO A;  3BPF A;  2DC8 A;  3E1Z B;  1YT7 A;  3BY4 A;  4OEL A;  3H6S A;  2XU3 A;  1PPD A;  2YJB A;  3O0U A;  3OF9 A;  3PRM A;  3MHS A;  2P7U A;  4YVA A;  4DMY A;  3TRK A;  4AXM A;  3S3Q A;  2DJF B;  4A5U A;  4FIP A;  4QH6 A;  1PVJ A;  1O0E A;  2F1G A;  4I04 A;  4BS5 A;  1MEM A;  3C9E A;  1MEG A;  1CSB B;  2AVW A;  2JTC A;  2HHN A;  4RKX A;  3MTN A;  2AGA A;  2CIO A;  5A24 A;  4OVZ A;  2DJG B;  3IOQ A;  1QDQ A;  4BS6 A;  1ZIV A;  1K3B B;  1SP4 B;  1ZCM A;  1EF7 A;  4N4Z A;  1MIR A;  1MS6 A;  1MDW A;  2G7Y A;  4GUA A;  2ACT A;  3B21 A;  3F75 A;  4W5B A;  3BOW A;  3TNX A;  2Z84 A;  5CVO B;  5PAD A;  4XUI A;  3IFU A;  5CVM A;  3RNV A;  1KHP A;  1AYV A;  1FH0 A;  1KFX L;  4X6H A;  2HWK A;  3BBA A;  1PAD A;  5FPW A;  3BC3 A;  1EWM A;  1A6R A;  1AYU A;  4M0W A;  4RF0 A;  3V6E A;  4MSX A;  1BGO A;  2OP3 A;  3RVW A;  1PBH A;  3QSD A;  4I07 A;  2VHS A;  3LFY A;  3ERV A;  2DCC A;  1X9Y A;  3KFQ A;  3N3G A;  1YZB A;  3MHH A;  2E03 A;  4CDF B;  1ME3 A;  2O6X A;  4YYV A;  3W31 A;  6PAD A;  1AU0 A;  1U5I A;  4YYW A;  3K24 A;  4MZS A;  3O65 A;  3KX1 A; 
#chains in the Genus database with same CATH homology
 2B1N A;  4P6E A;  4YYQ A;  4MZO A;  2HXZ A;  1PIP A;  1Y08 A;  1PPN A;  3QJ3 A;  3F5V A;  4HWY A;  1VJV A;  2DZY A;  1ATK A;  2WBF X;  3KSE A;  2FUD A;  1TL9 A;  4C5P A;  1GMY A;  4BPV A;  5JA7 A;  1VSN A;  3N4C A;  3HHI A;  3OVZ A;  3HHA A;  2VFB A;  1DF0 A;  1Y4H A;  2OUL A;  4YYS A;  2DZZ A;  5CVN B;  2AS8 A;  3AI8 A;  2GHU A;  3DF0 A;  1F2C A;  2JQF R;  2PNS A;  1NLJ A;  1Q6K A;  2R9O A;  4WA6 A;  2IBI A;  4DMX A;  1EWO A;  2FQ9 A;  4B55 A;  4BGF A;  4GUZ A;  2XU1 A;  4X6I A;  1IWD A;  1CV8 A;  3MOR A;  3IEJ A;  2AYO A;  3LXS A;  3IUT A;  1ME4 A;  2YJ8 A;  2PRE A;  2R9M A;  3IHP A;  1THE A;  1BQI A;  2B1M A;  1AEC A;  2NQD B;  7PCK A;  5EF4 A;  1PCI A;  4CDC B;  1GCB A;  3ZUA A;  4I05 A;  2Y6E A;  1S4V A;  3KWZ A;  1NL6 A;  1CPJ A;  1DEU A;  1F2B A;  2XU4 A;  3IMA A;  2YJ9 A;  3V6C A;  1XKG A;  2VFC A;  3H7D A;  1AYW A;  1TU6 A;  3H8C A;  3HWN A;  4P6G A;  1KXR A;  2R9N A;  3S3R A;  1HUC B;  4CZW A;  1QMY A;  4Q8G A;  4KLB A;  2DC9 A;  5JH3 A;  3I3T A;  5CHT A;  3OVX A;  1U9W A;  4NV7 A;  1CS8 A;  5F02 A;  1NB3 A;  2ARY A;  2AUX A;  4YYR A;  2FO5 A;  1PPO A;  3RVX A;  2E00 A;  3BCN A;  3P5W A;  1AIM A;  1NB5 A;  3OF8 A;  5CHV A;  2C0Y A;  3OIS A;  2PBH A;  8PCH A;  1PXV A;  3U8E A;  1QXP A;  4FK5 A;  2Y5B A;  1NQC A;  5K16 A;  2BDL A;  3O1G A;  4W5C A;  1U9X A;  3CH2 X;  3PDF A;  4PP1 A;  2FTD A;  4QRX A;  3WXE A;  2ATO A;  4NV8 A;  1EWP A;  1TLO A;  4QBB A;  1NPZ A;  4N8W A;  1KHQ A;  2F7D A;  2FRQ A;  3BPM A;  1CTE A;  2AUZ A;  2HH5 A;  2G8J A;  4N79 A;  2PAD A;  1POP A;  3BWK A;  1MHW A;  4YYU A;  1SNK A;  3D6S A;  1GEC E;  2NQA A;  3I06 A;  4CDE B;  3K8U A;  3NHE A;  3PBH A;  1AU3 A;  4W4U A;  2OZ2 A;  1CVZ A;  1GLO A;  1BP4 A;  2AU1 A;  1YVB A;  2DCA A;  3P5X A;  3PW3 A;  2R6N A;  4OEM A;  3GCB A;  3WXG A;  2H7J A;  2VHF A;  9PAP A;  4QRG A;  4Q8H A;  1PE6 A;  4ZUX U;  3KW9 A;  2DC7 A;  2FRA A;  1ICF A;  1YK8 A;  3HD3 A;  2BSZ A;  2CB5 A;  4PP2 E;  1U9V A;  1M6D A;  2P86 A;  3CH3 X;  3WXF A;  1BY8 A;  3LTW A;  2G8E A;  3P5V A;  1CB5 A;  3CBJ A;  2YJ2 A;  3KKU A;  3D9W A;  4CDD B;  2E02 A;  3KWB X;  1YAL A;  2E01 A;  1QOL A;  4AXL A;  4BQV A;  1CQD A;  3QT4 A;  3CBK A;  5J94 A;  3P5U A;  1STF E;  1EWL A;  1F29 A;  3H8B A;  3H89 A;  2DCB A;  3USV A;  1PPP A;  2R9C A;  4PAD A;  1JQP A;  4RY2 A;  1W6F A;  3N3K A;  2BDZ A;  1AU4 A;  2NQG A;  2YJC A;  2JQG R;  1KFU L;  2FYE A;  3IV2 A;  2AYN A;  4QRV A;  3B79 A;  4XR7 A;  4YV8 A;  1AU2 A;  4K7C A;  2XU5 A;  3K9M A;  2G6D A;  4BSQ A;  2P0R A;  3M99 A;  4G54 A;  2NQI A;  1YK7 A;  2DC6 A;  1E2T A;  1U9Q X;  2FT2 A;  2IPP B;  1CJL A;  1GX3 A;  2AIM A;  3RVV A;  2DCD A;  4FJC A;  2HD5 A;  4X6J A;  2R9F A;  1ITO A;  4PI3 A;  3PNR A;  5EGW A;  1F2A A;  2GFO A;  3BPF A;  2DC8 A;  3E1Z B;  1YT7 A;  4OEL A;  3H6S A;  2XU3 A;  1PPD A;  2YJB A;  3O0U A;  3OF9 A;  1W4T A;  3MHS A;  2P7U A;  4YVA A;  4DMY A;  4AXM A;  3S3Q A;  2DJF B;  4FIP A;  4QH6 A;  1O0E A;  2F1G A;  4I04 A;  4BS5 A;  1MEM A;  3C9E A;  1MEG A;  1CSB B;  2AVW A;  1W5R A;  2HHN A;  3MTN A;  2CIO A;  5A24 A;  2DJG B;  3IOQ A;  1QDQ A;  4BS6 A;  1ZIV A;  1K3B B;  1SP4 B;  1ZCM A;  1EF7 A;  4N4Z A;  1MIR A;  1MS6 A;  1MDW A;  2G7Y A;  2ACT A;  3F75 A;  4W5B A;  3BOW A;  3TNX A;  5PAD A;  5CVO B;  4XUI A;  5CVM A;  1KHP A;  1AYV A;  1FH0 A;  1KFX L;  4X6H A;  1PAD A;  5FPW A;  3BC3 A;  1EWM A;  1A6R A;  1AYU A;  3V6E A;  4MSX A;  1BGO A;  2OP3 A;  3RVW A;  1PBH A;  3QSD A;  4I07 A;  2VHS A;  3LFY A;  3ERV A;  2DCC A;  1X9Y A;  3KFQ A;  3N3G A;  3MHH A;  2E03 A;  4CDF B;  1ME3 A;  2O6X A;  4YYV A;  6PAD A;  1AU0 A;  1U5I A;  4YYW A;  3K24 A;  4MZS A;  3KX1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...