5K16A

Crystal structure of free ubiquitin-specific protease 12
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
350
structure length
324
Chain Sequence
SALEKEIGPEQFPVNEHYFGLVNFGNTCYCNSVLQALYFCRPFREKVLAYKSQKKESLLTCLADLFHSIATQKKKVGVIPPKKFITRLRKENELFDNYMQQDAHEFLNYLLNTIADILQEERKQEKQNPDPTWVHEIFQGTLTNETRCLTCETISSKDEDFLDLSVDVEQNTSITHCLRGFSNTETKYYCEECRSKQEAHKRMKVKKLPMILALHLKRFKYMDQLHRYTKLSYRVVFPLELRLFNTSGDATNPDRMYDLVAVVVHCGSGPNRGHYIAIVKSHDFWLLFDDDIVEKIDAQAIEEFYGLTSKNSESGYILFYQSRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin carboxyl-terminal hydrolase 12
publication title Allosteric Activation of Ubiquitin-Specific Proteases by beta-Propeller Proteins UAF1 and WDR20.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 93
structure length 324
sequence length 350
chains with identical sequence B
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2016-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00443 UCH Ubiquitin carboxyl-terminal hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 5k16A00
2DC6A 4QH6A 1QMYA 3B79A 1QXPA 3NHEA 5EF4A 1ZCMA 2E01A 4W4UA 4PI3A 4KLBA 4ZUXU 3K24A 1CS8A 4CDCB 2YJ8A 2AYOA 1CQDA 2DJGB 1TL9A 3N3KA 3ERVA 3IOQA 9PAPA 1Y08A 2GHUA 1YT7A 1KHQA 3H6SA 2IPPB 1IWDA 2NQDB 2FQ9A 2FT2A 2FTDA 3M99A 5JH3A 2E02A 2G7YA 4QRGA 3KX1A 2DC8A 4PADA 2R9OA 3P5XA 3KWZA 4XUIA 4BPVA 1PPNA 4OEMA 2OULA 2DCCA 2FRAA 1CTEA 1POPA 3QSDA 4QBBA 2H7JA 1F29A 1GMYA 2DCAA 2GFOA 3O1GA 4PP2E 2P7UA 3TNXA 2YJCA 3RVXA 3USVA 3V6CA 3BOWA 2FUDA 1U9XA 2DZYA 1S4VA 1NB3A 3P5WA 5FPWA 3BC3A 1AU2A 2AU1A 2WBFX 3MHHA 1CB5A 5CHVA 2B1NA 4YYWA 3H7DA 2C0YA 2IBIA 2OP3A 2F1GA 2O6XA 1M6DA 2AUZA 2G6DA 1GLOA 4FIPA 1KFXL 5CHTA 2Y5BA 4Q8HA 2ACTA 3OISA 4FK5A 3IV2A 5CVOB 3KSEA 2OZ2A 3OVXA 3OF8A 2DCDA 4CDEB 2AIMA 4HWYA 1MIRA 1ME3A 3E1ZB 3PW3A 1AU4A 1PPPA 1PPOA 1AU0A 1F2AA 1AU3A 2DJFB 1STFE 2NQGA 3BPMA 3PBHA 2DCBA 3HHIA 1PPDA 2CIOA 3KKUA 1TLOA 3S3RA 1CVZA 3WXFA 4CDFB 1GECE 3HWNA 2P86A 4MSXA 1PBHA 3HHAA 1PCIA 1F2BA 2VHSA 1NPZA 4I05A 2PREA 1K3BB 4YYVA 4X6JA 1U9WA 4G54A 3I06A 1AYUA 3H89A 1GCBA 2DC9A 2PNSA 1PIPA 4YVAA 3CBKA 4I04A 3S3QA 1A6RA 2R9NA 3AI8A 2G8JA 2XU4A 3WXGA 3MTNA 1O0EA 3PNRA 2R9MA 3N3GA 1MHWA 1BY8A 1CJLA 2BDZA 5EGWA 1ZIVA 2FYEA 4RY2A 3BWKA 7PCKA 3H8BA 5J94A 2G8EA 2YJBA 3BCNA 1KHPA 3KFQA 4N79A 1KFUL 3N4CA 2VHFA 2HH5A 1X9YA 2AVWA 4P6GA 3IUTA 2Y6EA 2HHNA 1YK7A 3CH2X 4DMYA 1DF0A 2XU5A 1BP4A 3OVZA 2HXZA 1EWPA 1Q6KA 5F02A 1QOLA 3DF0A 4CZWA 3BPFA 4X6HA 4BSQA 1ICFA 2YJ2A 2PADA 1MDWA 2AYNA 3WXEA 2DZZA 8PCHA 3F5VA 1ITOA 1SP4B 3KW9A 4YYSA 3K8UA 1U9QX 3C9EA 4Q8GA 1F2CA 4XR7A 4QRVA 3I3TA 2R6NA 2ATOA 1PE6A 3OF9A 1ME4A 3RVWA 2BDLA 3CH3X 4BS6A 3QT4A 1AECA 3D6SA 4BS5A 1CSBB 3K9MA 3ZUAA 1THEA 3MORA 4PP1A 3IEJA 1CV8A 4DMXA 5A24A 3O0UA 3RVVA 3PDFA 4I07A 5CVMA 4W5BA 2FRQA 2NQIA 4K7CA 2PBHA 1KXRA 4MZSA 4X6IA 3GCBA 4CDDB 3MHSA 1PADA 3LFYA 3CBJA 2JQGR 1EWLA 1BGOA 5PADA 4YYRA 1U9VA 1XKGA 2E00A 1ATKA 4BQVA 1NLJA 4W5CA 2R9FA 1QDQA 1CPJA 3P5UA 3V6EA 1HUCB 1AYVA 4MZOA 4YV8A 2CB5A 4WA6A 3IMAA 1NL6A 2XU3A 1EWOA 2YJ9A 1Y4HA 3F75A 2AUXA 2R9CA 3HD3A 3H8CA 1BQIA 1EWMA 1DEUA 2B1MA 2XU1A 4P6EA 3U8EA 1FH0A 3QJ3A 1JQPA 1PXVA 1VSNA 5K16A 4OELA 1AIMA 1MEGA 1MEMA 1EF7A 4AXLA 5JA7A 4YYUA 2AS8A 4FJCA 6PADA 1NB5A 2FO5A 4N8WA 4QRXA 2ARYA 1SNKA 4YYQA 5CVNB 1NQCA 1U5IA 2NQAA 1MS6A 3KWBX 3IHPA 4AXMA 1YK8A 1YVBA 2P0RA 1YALA 2E03A 2F7DA 2DC7A 1AYWA 2HD5A 3P5VA 2JQFR 1VJVA 4N4ZA 1TU6A 3LXSA
chains in the Genus database with same CATH superfamily
3MP2A 2DC6A 4QH6A 3MTVA 2Z84A 1QMYA 3PHXA 3B79A 1PVJA 1QXPA 3NHEA 5EF4A 1ZCMA 2E01A 4W4UA 4PI3A 4KLBA 4ZUXU 4ZTBA 3K24A 1CS8A 4CDCB 2YJ8A 2AYOA 1CQDA 2DJGB 4HXDB 1TL9A 2FE8A 3N3KA 3ERVA 3IOQA 9PAPA 1Y08A 2GHUA 1YT7A 1KHQA 3H6SA 2IPPB 1IWDA 2NQDB 2FQ9A 4OVZB 2FT2A 2FTDA 4BOZA 3M99A 5JH3A 2E02A 2G7YA 4QRGA 3KX1A 2DC8A 4PADA 2R9OA 3P5XA 3KWZA 4XUIA 4BPVA 1PPNA 4OEMA 2OULA 4REZA 2DCCA 2FRAA 1CTEA 1POPA 3QSDA 4QBBA 4MM3B 2H7JA 1F29A 1GMYA 4RF1A 2DCAA 2GFOA 3B21A 3O1GA 4PP2E 2P7UA 4BOSA 3TNXA 2HWKA 2J7QC 2YJCA 3RVXA 3USVA 4BOQA 4BOPA 3V6CA 3BOWA 2FUDA 1U9XA 2DZYA 1S4VA 1NB3A 3PHWA 3P5WA 2BTWA 5FPWA 3BC3A 1AU2A 2AU1A 2WBFX 3MHHA 1CB5A 3PRPA 5CHVA 2B1NA 4YYWA 3H7DA 2C0YA 2IBIA 2OP3A 2F1GA 2DOSA 2O6XA 1M6DA 2AUZA 2G6DA 1GLOA 4FIPA 1KFXL 4A5UA 2UZJA 5CHTA 5EZQA 2Y5BA 4Q8HA 2ACTA 3OISA 4FK5A 3IV2A 4RF0A 5CVOB 3KSEA 2OZ2A 3OVXA 3OF8A 2DCDA 4CDEB 2AIMA 4HWYA 1MIRA 1ME3A 3E1ZB 3PW3A 1AU4A 3PRMA 1PPPA 1PPOA 1AU0A 1F2AA 1AU3A 2DJFB 3MJ5A 1STFE 2NQGA 3BPMA 3PBHA 2DCBA 4IP3A 4OW0A 3HHIA 1PPDA 2CIOA 3KKUA 3PSEA 3W30A 1TLOA 3S3RA 1CVZA 3WXFA 4CDFB 1GECE 3HWNA 2P86A 4MSXA 1PBHA 3HHAA 4D8IA 1PCIA 1F2BA 2VHSA 1NPZA 2JRIA 4I05A 2PREA 1K3BB 4YYVA 4WURA 4X6JA 1U9WA 4G54A 3I06A 1AYUA 3H89A 1GCBA 2AGAA 2DC9A 2PNSA 1PIPA 4YVAA 3OQCA 3CBKA 4I04A 3S3QA 3BY4A 1A6RA 2R9NA 3AI8A 2G8JA 2XU4A 3WXGA 3MTNA 1O0EA 3PNRA 2R9MA 3N3GA 1MHWA 1BY8A 1CJLA 2BDZA 5EGWA 1ZIVA 2FYEA 4RY2A 3BWKA 7PCKA 3H8BA 4IUMA 5J94A 2G8EA 2YJBA 3BCNA 1KHPA 3KFQA 4N79A 1KFUL 3N4CA 2VHFA 2HH5A 1X9YA 2AVWA 4P6GA 3BB7A 3IUTA 2Y6EA 2HHNA 1YK7A 3CH2X 3O65A 4DMYA 1DF0A 2XU5A 1BP4A 3OVZA 2HXZA 1EWPA 1Q6KA 4MI7A 5F02A 1UKFA 1QOLA 3DF0A 4CZWA 3BPFA 4X6HA 4BSQA 1ICFA 2YJ2A 2PADA 1MDWA 2AYNA 3WXEA 2DZZA 4M0WA 8PCHA 3F5VA 1ITOA 1SP4B 3KW9A 4YYSA 3K8UA 1U9QX 3C9EA 4RNAA 4Q8GA 1F2CA 4XR7A 4QRVA 3I3TA 2R6NA 2JTCA 3TRKA 2ATOA 1PE6A 3OF9A 1ME4A 3RVWA 2BDLA 3CH3X 4BS6A 4D8BA 4D8EA 3QT4A 1AECA 3D6SA 4BS5A 1CSBB 3K9MA 3ZUAA 4P16A 1THEA 3MORA 4PP1A 3IEJA 2BU3A 3PT2A 1CV8A 4DMXA 5A24A 3O0UA 1DKIA 3RVVA 3PDFA 4I07A 5CVMA 4W5BA 3TMPA 2BTWB 2FRQA 2NQIA 4K7CA 2PBHA 3W31A 1KXRA 4MZSA 4X6IA 3GCBA 4CDDB 3MHSA 1PADA 3LFYA 3CBJA 2JQGR 1EWLA 1BGOA 3BBAA 5PADA 4YYRA 1U9VA 1XKGA 2E00A 2J7QA 1ATKA 4BQVA 1NLJA 4W5CA 2R9FA 5JZEA 1QDQA 1CPJA 3P5UA 3RNVA 5KO3A 3V6EA 1HUCB 1AYVA 4MZOA 1YZBA 4YV8A 2CB5A 4WA6A 3IMAA 4BOUA 1NL6A 2XU3A 1EWOA 2YJ9A 1Y4HA 4RKXA 3ZNHA 3F75A 3IFUA 2AUXA 2R9CA 3HD3A 3H8CA 3C0RA 1BQIA 1EWMA 5EZSA 3PHUA 4XZXA 1DEUA 2B1MA 2XU1A 4P6EA 3U8EA 4OVZA 1FH0A 4R3DA 3QJ3A 1JQPA 1PXVA 1VSNA 5K16A 3E9SA 4OELA 1AIMA 1MEGA 1MEMA 1EF7A 4AXLA 5JA7A 4YYUA 2AS8A 4FJCA 6PADA 1NB5A 2FO5A 4N8WA 4QRXA 2ARYA 1SNKA 4YYQA 4PT5A 5CVNB 1NQCA 1U5IA 2NQAA 1MS6A 3KWBX 3IHPA 4AXMA 1YK8A 1YVBA 2P0RA 5E6JA 1YALA 2E03A 2F7DA 2DC7A 1AYWA 2HD5A 3P5VA 2JQFR 1VJVA 4N4ZA 1TU6A 4GUAA 3LXSA
chains in the Genus database with same CATH topology
2DC6A 4QH6A 4BGFA 1QMYA 3B79A 1QXPA 3NHEA 5EF4A 1ZCMA 2E01A 4W4UA 4PI3A 4KLBA 4ZUXU 3K24A 1CS8A 4CDCB 2YJ8A 2AYOA 1CQDA 2DJGB 1TL9A 3N3KA 3ERVA 3IOQA 9PAPA 1Y08A 2GHUA 1YT7A 1KHQA 3H6SA 2BSZA 2IPPB 1IWDA 2NQDB 2FQ9A 2FT2A 2FTDA 3M99A 5JH3A 2E02A 2G7YA 4QRGA 3KX1A 2DC8A 4PADA 2R9OA 3P5XA 3KWZA 4XUIA 4BPVA 1PPNA 2VFCA 4OEMA 2OULA 2DCCA 2FRAA 1CTEA 1POPA 3QSDA 4QBBA 2H7JA 1F29A 1GMYA 2DCAA 2GFOA 4NV7A 3O1GA 4PP2E 2P7UA 3TNXA 1GX3A 2YJCA 3RVXA 3USVA 3V6CA 3BOWA 2FUDA 1U9XA 2DZYA 1S4VA 1NB3A 3P5WA 4GUZA 5FPWA 3BC3A 1AU2A 2AU1A 2WBFX 3MHHA 1CB5A 5CHVA 2B1NA 2VFBA 4YYWA 3H7DA 2C0YA 2IBIA 2OP3A 2F1GA 2O6XA 1M6DA 2AUZA 2G6DA 1GLOA 4FIPA 1KFXL 5CHTA 2Y5BA 4Q8HA 2ACTA 3OISA 4FK5A 3IV2A 5CVOB 3KSEA 2OZ2A 3OVXA 4NV8A 3OF8A 2DCDA 4CDEB 2AIMA 4HWYA 1MIRA 1ME3A 3E1ZB 3PW3A 1AU4A 1PPPA 1PPOA 1AU0A 1F2AA 1AU3A 2DJFB 1STFE 2NQGA 3BPMA 3PBHA 2DCBA 3HHIA 1PPDA 2CIOA 3KKUA 1TLOA 3S3RA 1CVZA 3WXFA 4CDFB 1GECE 3HWNA 2P86A 4MSXA 1PBHA 3HHAA 1PCIA 1F2BA 2VHSA 1NPZA 4I05A 2PREA 1K3BB 4YYVA 4X6JA 1U9WA 4G54A 3I06A 1AYUA 3H89A 1GCBA 2DC9A 2PNSA 1PIPA 1W5RA 4YVAA 3CBKA 4I04A 3S3QA 1A6RA 2R9NA 3AI8A 2G8JA 1E2TA 2XU4A 3WXGA 3MTNA 1O0EA 3PNRA 2R9MA 3N3GA 1MHWA 1BY8A 1CJLA 2BDZA 5EGWA 1ZIVA 2FYEA 4RY2A 3BWKA 7PCKA 3H8BA 5J94A 2G8EA 2YJBA 3BCNA 1KHPA 3KFQA 4N79A 1KFUL 3N4CA 2VHFA 2HH5A 1X9YA 2AVWA 4P6GA 3IUTA 2Y6EA 2HHNA 1YK7A 3CH2X 4DMYA 1DF0A 2XU5A 1BP4A 3OVZA 2HXZA 1EWPA 1Q6KA 5F02A 1QOLA 3DF0A 4CZWA 3BPFA 4X6HA 4BSQA 1ICFA 2YJ2A 2PADA 1MDWA 2AYNA 3WXEA 2DZZA 8PCHA 3F5VA 1ITOA 1SP4B 3KW9A 4YYSA 3K8UA 1U9QX 3C9EA 4Q8GA 1F2CA 4XR7A 4QRVA 3I3TA 2R6NA 2ATOA 1PE6A 3OF9A 1ME4A 3RVWA 2BDLA 3CH3X 4BS6A 3QT4A 1AECA 3D6SA 4BS5A 3LTWA 1CSBB 3K9MA 3ZUAA 1THEA 3MORA 4PP1A 3IEJA 3D9WA 1CV8A 4DMXA 5A24A 3O0UA 1W6FA 3RVVA 3PDFA 4I07A 5CVMA 4W5BA 2FRQA 2NQIA 4K7CA 2PBHA 1KXRA 4MZSA 4X6IA 3GCBA 4CDDB 3MHSA 1PADA 3LFYA 3CBJA 2JQGR 1EWLA 1BGOA 4C5PA 5PADA 4YYRA 1U9VA 1XKGA 2E00A 1ATKA 4BQVA 1NLJA 4W5CA 2R9FA 1QDQA 1CPJA 3P5UA 3V6EA 1HUCB 1AYVA 4MZOA 4YV8A 2CB5A 4WA6A 3IMAA 1NL6A 2XU3A 1EWOA 2YJ9A 1Y4HA 3F75A 2AUXA 2R9CA 3HD3A 3H8CA 1BQIA 1EWMA 1DEUA 2B1MA 2XU1A 4P6EA 3U8EA 1FH0A 3QJ3A 1JQPA 1PXVA 1VSNA 5K16A 4OELA 1AIMA 1MEGA 1MEMA 1EF7A 4AXLA 5JA7A 4YYUA 2AS8A 4FJCA 6PADA 1NB5A 2FO5A 4N8WA 4QRXA 2ARYA 1SNKA 4YYQA 5CVNB 1NQCA 1U5IA 2NQAA 1MS6A 3KWBX 3IHPA 4AXMA 1YK8A 1YVBA 2P0RA 4B55A 1YALA 2E03A 2F7DA 2DC7A 1AYWA 2HD5A 3P5VA 2JQFR 1VJVA 1W4TA 4N4ZA 1TU6A 3LXSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DC6 A;  4QH6 A;  1QMY A;  3B79 A;  1QXP A;  3NHE A;  5EF4 A;  1ZCM A;  2E01 A;  4W4U A;  4PI3 A;  4KLB A;  4ZUX U;  3K24 A;  1CS8 A;  4CDC B;  2YJ8 A;  2AYO A;  1CQD A;  2DJG B;  1TL9 A;  3N3K A;  3ERV A;  3IOQ A;  9PAP A;  1Y08 A;  2GHU A;  1YT7 A;  1KHQ A;  3H6S A;  2IPP B;  1IWD A;  2NQD B;  2FQ9 A;  2FT2 A;  2FTD A;  3M99 A;  5JH3 A;  2E02 A;  2G7Y A;  4QRG A;  3KX1 A;  2DC8 A;  4PAD A;  2R9O A;  3P5X A;  3KWZ A;  4XUI A;  4BPV A;  1PPN A;  4OEM A;  2OUL A;  2DCC A;  2FRA A;  1CTE A;  1POP A;  3QSD A;  4QBB A;  2H7J A;  1F29 A;  1GMY A;  2DCA A;  2GFO A;  3O1G A;  4PP2 E;  2P7U A;  3TNX A;  2YJC A;  3RVX A;  3USV A;  3V6C A;  3BOW A;  2FUD A;  1U9X A;  2DZY A;  1S4V A;  1NB3 A;  3P5W A;  5FPW A;  3BC3 A;  1AU2 A;  2AU1 A;  2WBF X;  3MHH A;  1CB5 A;  5CHV A;  2B1N A;  4YYW A;  3H7D A;  2C0Y A;  2IBI A;  2OP3 A;  2F1G A;  2O6X A;  1M6D A;  2AUZ A;  2G6D A;  1GLO A;  4FIP A;  1KFX L;  5CHT A;  2Y5B A;  4Q8H A;  2ACT A;  3OIS A;  4FK5 A;  3IV2 A;  5CVO B;  3KSE A;  2OZ2 A;  3OVX A;  3OF8 A;  2DCD A;  4CDE B;  2AIM A;  4HWY A;  1MIR A;  1ME3 A;  3E1Z B;  3PW3 A;  1AU4 A;  1PPP A;  1PPO A;  1AU0 A;  1F2A A;  1AU3 A;  2DJF B;  1STF E;  2NQG A;  3BPM A;  3PBH A;  2DCB A;  3HHI A;  1PPD A;  2CIO A;  3KKU A;  1TLO A;  3S3R A;  1CVZ A;  3WXF A;  4CDF B;  1GEC E;  3HWN A;  2P86 A;  4MSX A;  1PBH A;  3HHA A;  1PCI A;  1F2B A;  2VHS A;  1NPZ A;  4I05 A;  2PRE A;  1K3B B;  4YYV A;  4X6J A;  1U9W A;  4G54 A;  3I06 A;  1AYU A;  3H89 A;  1GCB A;  2DC9 A;  2PNS A;  1PIP A;  4YVA A;  3CBK A;  4I04 A;  3S3Q A;  1A6R A;  2R9N A;  3AI8 A;  2G8J A;  2XU4 A;  3WXG A;  3MTN A;  1O0E A;  3PNR A;  2R9M A;  3N3G A;  1MHW A;  1BY8 A;  1CJL A;  2BDZ A;  5EGW A;  1ZIV A;  2FYE A;  4RY2 A;  3BWK A;  7PCK A;  3H8B A;  5J94 A;  2G8E A;  2YJB A;  3BCN A;  1KHP A;  3KFQ A;  4N79 A;  1KFU L;  3N4C A;  2VHF A;  2HH5 A;  1X9Y A;  2AVW A;  4P6G A;  3IUT A;  2Y6E A;  2HHN A;  1YK7 A;  3CH2 X;  4DMY A;  1DF0 A;  2XU5 A;  1BP4 A;  3OVZ A;  2HXZ A;  1EWP A;  1Q6K A;  5F02 A;  1QOL A;  3DF0 A;  4CZW A;  3BPF A;  4X6H A;  4BSQ A;  1ICF A;  2YJ2 A;  2PAD A;  1MDW A;  2AYN A;  3WXE A;  2DZZ A;  8PCH A;  3F5V A;  1ITO A;  1SP4 B;  3KW9 A;  4YYS A;  3K8U A;  1U9Q X;  3C9E A;  4Q8G A;  1F2C A;  4XR7 A;  4QRV A;  3I3T A;  2R6N A;  2ATO A;  1PE6 A;  3OF9 A;  1ME4 A;  3RVW A;  2BDL A;  3CH3 X;  4BS6 A;  3QT4 A;  1AEC A;  3D6S A;  4BS5 A;  1CSB B;  3K9M A;  3ZUA A;  1THE A;  3MOR A;  4PP1 A;  3IEJ A;  1CV8 A;  4DMX A;  5A24 A;  3O0U A;  3RVV A;  3PDF A;  4I07 A;  5CVM A;  4W5B A;  2FRQ A;  2NQI A;  4K7C A;  2PBH A;  1KXR A;  4MZS A;  4X6I A;  3GCB A;  4CDD B;  3MHS A;  1PAD A;  3LFY A;  3CBJ A;  2JQG R;  1EWL A;  1BGO A;  5PAD A;  4YYR A;  1U9V A;  1XKG A;  2E00 A;  1ATK A;  4BQV A;  1NLJ A;  4W5C A;  2R9F A;  1QDQ A;  1CPJ A;  3P5U A;  3V6E A;  1HUC B;  1AYV A;  4MZO A;  4YV8 A;  2CB5 A;  4WA6 A;  3IMA A;  1NL6 A;  2XU3 A;  1EWO A;  2YJ9 A;  1Y4H A;  3F75 A;  2AUX A;  2R9C A;  3HD3 A;  3H8C A;  1BQI A;  1EWM A;  1DEU A;  2B1M A;  2XU1 A;  4P6E A;  3U8E A;  1FH0 A;  3QJ3 A;  1JQP A;  1PXV A;  1VSN A;  5K16 A;  4OEL A;  1AIM A;  1MEG A;  1MEM A;  1EF7 A;  4AXL A;  5JA7 A;  4YYU A;  2AS8 A;  4FJC A;  6PAD A;  1NB5 A;  2FO5 A;  4N8W A;  4QRX A;  2ARY A;  1SNK A;  4YYQ A;  5CVN B;  1NQC A;  1U5I A;  2NQA A;  1MS6 A;  3KWB X;  3IHP A;  4AXM A;  1YK8 A;  1YVB A;  2P0R A;  1YAL A;  2E03 A;  2F7D A;  2DC7 A;  1AYW A;  2HD5 A;  3P5V A;  2JQF R;  1VJV A;  4N4Z A;  1TU6 A;  3LXS A; 
#chains in the Genus database with same CATH topology
 3MP2 A;  2DC6 A;  4QH6 A;  3MTV A;  2Z84 A;  1QMY A;  3PHX A;  3B79 A;  1PVJ A;  1QXP A;  3NHE A;  5EF4 A;  1ZCM A;  2E01 A;  4W4U A;  4PI3 A;  4KLB A;  4ZUX U;  4ZTB A;  3K24 A;  1CS8 A;  4CDC B;  2YJ8 A;  2AYO A;  1CQD A;  2DJG B;  4HXD B;  1TL9 A;  2FE8 A;  3N3K A;  3ERV A;  3IOQ A;  9PAP A;  1Y08 A;  2GHU A;  1YT7 A;  1KHQ A;  3H6S A;  2IPP B;  1IWD A;  2NQD B;  2FQ9 A;  4OVZ B;  2FT2 A;  2FTD A;  4BOZ A;  3M99 A;  5JH3 A;  2E02 A;  2G7Y A;  4QRG A;  3KX1 A;  2DC8 A;  4PAD A;  2R9O A;  3P5X A;  3KWZ A;  4XUI A;  4BPV A;  1PPN A;  4OEM A;  2OUL A;  4REZ A;  2DCC A;  2FRA A;  1CTE A;  1POP A;  3QSD A;  4QBB A;  4MM3 B;  2H7J A;  1F29 A;  1GMY A;  4RF1 A;  2DCA A;  2GFO A;  3B21 A;  3O1G A;  4PP2 E;  2P7U A;  4BOS A;  3TNX A;  2HWK A;  2J7Q C;  2YJC A;  3RVX A;  3USV A;  4BOQ A;  4BOP A;  3V6C A;  3BOW A;  2FUD A;  1U9X A;  2DZY A;  1S4V A;  1NB3 A;  3PHW A;  3P5W A;  2BTW A;  5FPW A;  3BC3 A;  1AU2 A;  2AU1 A;  2WBF X;  3MHH A;  1CB5 A;  3PRP A;  5CHV A;  2B1N A;  4YYW A;  3H7D A;  2C0Y A;  2IBI A;  2OP3 A;  2F1G A;  2DOS A;  2O6X A;  1M6D A;  2AUZ A;  2G6D A;  1GLO A;  4FIP A;  1KFX L;  4A5U A;  2UZJ A;  5CHT A;  5EZQ A;  2Y5B A;  4Q8H A;  2ACT A;  3OIS A;  4FK5 A;  3IV2 A;  4RF0 A;  5CVO B;  3KSE A;  2OZ2 A;  3OVX A;  3OF8 A;  2DCD A;  4CDE B;  2AIM A;  4HWY A;  1MIR A;  1ME3 A;  3E1Z B;  3PW3 A;  1AU4 A;  3PRM A;  1PPP A;  1PPO A;  1AU0 A;  1F2A A;  1AU3 A;  2DJF B;  3MJ5 A;  1STF E;  2NQG A;  3BPM A;  3PBH A;  2DCB A;  4IP3 A;  4OW0 A;  3HHI A;  1PPD A;  2CIO A;  3KKU A;  3PSE A;  3W30 A;  1TLO A;  3S3R A;  1CVZ A;  3WXF A;  4CDF B;  1GEC E;  3HWN A;  2P86 A;  4MSX A;  1PBH A;  3HHA A;  4D8I A;  1PCI A;  1F2B A;  2VHS A;  1NPZ A;  2JRI A;  4I05 A;  2PRE A;  1K3B B;  4YYV A;  4WUR A;  4X6J A;  1U9W A;  4G54 A;  3I06 A;  1AYU A;  3H89 A;  1GCB A;  2AGA A;  2DC9 A;  2PNS A;  1PIP A;  4YVA A;  3OQC A;  3CBK A;  4I04 A;  3S3Q A;  3BY4 A;  1A6R A;  2R9N A;  3AI8 A;  2G8J A;  2XU4 A;  3WXG A;  3MTN A;  1O0E A;  3PNR A;  2R9M A;  3N3G A;  1MHW A;  1BY8 A;  1CJL A;  2BDZ A;  5EGW A;  1ZIV A;  2FYE A;  4RY2 A;  3BWK A;  7PCK A;  3H8B A;  4IUM A;  5J94 A;  2G8E A;  2YJB A;  3BCN A;  1KHP A;  3KFQ A;  4N79 A;  1KFU L;  3N4C A;  2VHF A;  2HH5 A;  1X9Y A;  2AVW A;  4P6G A;  3BB7 A;  3IUT A;  2Y6E A;  2HHN A;  1YK7 A;  3CH2 X;  3O65 A;  4DMY A;  1DF0 A;  2XU5 A;  1BP4 A;  3OVZ A;  2HXZ A;  1EWP A;  1Q6K A;  4MI7 A;  5F02 A;  1UKF A;  1QOL A;  3DF0 A;  4CZW A;  3BPF A;  4X6H A;  4BSQ A;  1ICF A;  2YJ2 A;  2PAD A;  1MDW A;  2AYN A;  3WXE A;  2DZZ A;  4M0W A;  8PCH A;  3F5V A;  1ITO A;  1SP4 B;  3KW9 A;  4YYS A;  3K8U A;  1U9Q X;  3C9E A;  4RNA A;  4Q8G A;  1F2C A;  4XR7 A;  4QRV A;  3I3T A;  2R6N A;  2JTC A;  3TRK A;  2ATO A;  1PE6 A;  3OF9 A;  1ME4 A;  3RVW A;  2BDL A;  3CH3 X;  4BS6 A;  4D8B A;  4D8E A;  3QT4 A;  1AEC A;  3D6S A;  4BS5 A;  1CSB B;  3K9M A;  3ZUA A;  4P16 A;  1THE A;  3MOR A;  4PP1 A;  3IEJ A;  2BU3 A;  3PT2 A;  1CV8 A;  4DMX A;  5A24 A;  3O0U A;  1DKI A;  3RVV A;  3PDF A;  4I07 A;  5CVM A;  4W5B A;  3TMP A;  2BTW B;  2FRQ A;  2NQI A;  4K7C A;  2PBH A;  3W31 A;  1KXR A;  4MZS A;  4X6I A;  3GCB A;  4CDD B;  3MHS A;  1PAD A;  3LFY A;  3CBJ A;  2JQG R;  1EWL A;  1BGO A;  3BBA A;  5PAD A;  4YYR A;  1U9V A;  1XKG A;  2E00 A;  2J7Q A;  1ATK A;  4BQV A;  1NLJ A;  4W5C A;  2R9F A;  5JZE A;  1QDQ A;  1CPJ A;  3P5U A;  3RNV A;  5KO3 A;  3V6E A;  1HUC B;  1AYV A;  4MZO A;  1YZB A;  4YV8 A;  2CB5 A;  4WA6 A;  3IMA A;  4BOU A;  1NL6 A;  2XU3 A;  1EWO A;  2YJ9 A;  1Y4H A;  4RKX A;  3ZNH A;  3F75 A;  3IFU A;  2AUX A;  2R9C A;  3HD3 A;  3H8C A;  3C0R A;  1BQI A;  1EWM A;  5EZS A;  3PHU A;  4XZX A;  1DEU A;  2B1M A;  2XU1 A;  4P6E A;  3U8E A;  4OVZ A;  1FH0 A;  4R3D A;  3QJ3 A;  1JQP A;  1PXV A;  1VSN A;  5K16 A;  3E9S A;  4OEL A;  1AIM A;  1MEG A;  1MEM A;  1EF7 A;  4AXL A;  5JA7 A;  4YYU A;  2AS8 A;  4FJC A;  6PAD A;  1NB5 A;  2FO5 A;  4N8W A;  4QRX A;  2ARY A;  1SNK A;  4YYQ A;  4PT5 A;  5CVN B;  1NQC A;  1U5I A;  2NQA A;  1MS6 A;  3KWB X;  3IHP A;  4AXM A;  1YK8 A;  1YVB A;  2P0R A;  5E6J A;  1YAL A;  2E03 A;  2F7D A;  2DC7 A;  1AYW A;  2HD5 A;  3P5V A;  2JQF R;  1VJV A;  4N4Z A;  1TU6 A;  4GUA A;  3LXS A; 
#chains in the Genus database with same CATH homology
 2DC6 A;  4QH6 A;  4BGF A;  1QMY A;  3B79 A;  1QXP A;  3NHE A;  5EF4 A;  1ZCM A;  2E01 A;  4W4U A;  4PI3 A;  4KLB A;  4ZUX U;  3K24 A;  1CS8 A;  4CDC B;  2YJ8 A;  2AYO A;  1CQD A;  2DJG B;  1TL9 A;  3N3K A;  3ERV A;  3IOQ A;  9PAP A;  1Y08 A;  2GHU A;  1YT7 A;  1KHQ A;  3H6S A;  2BSZ A;  2IPP B;  1IWD A;  2NQD B;  2FQ9 A;  2FT2 A;  2FTD A;  3M99 A;  5JH3 A;  2E02 A;  2G7Y A;  4QRG A;  3KX1 A;  2DC8 A;  4PAD A;  2R9O A;  3P5X A;  3KWZ A;  4XUI A;  4BPV A;  1PPN A;  2VFC A;  4OEM A;  2OUL A;  2DCC A;  2FRA A;  1CTE A;  1POP A;  3QSD A;  4QBB A;  2H7J A;  1F29 A;  1GMY A;  2DCA A;  2GFO A;  4NV7 A;  3O1G A;  4PP2 E;  2P7U A;  3TNX A;  1GX3 A;  2YJC A;  3RVX A;  3USV A;  3V6C A;  3BOW A;  2FUD A;  1U9X A;  2DZY A;  1S4V A;  1NB3 A;  3P5W A;  4GUZ A;  5FPW A;  3BC3 A;  1AU2 A;  2AU1 A;  2WBF X;  3MHH A;  1CB5 A;  5CHV A;  2B1N A;  2VFB A;  4YYW A;  3H7D A;  2C0Y A;  2IBI A;  2OP3 A;  2F1G A;  2O6X A;  1M6D A;  2AUZ A;  2G6D A;  1GLO A;  4FIP A;  1KFX L;  5CHT A;  2Y5B A;  4Q8H A;  2ACT A;  3OIS A;  4FK5 A;  3IV2 A;  5CVO B;  3KSE A;  2OZ2 A;  3OVX A;  4NV8 A;  3OF8 A;  2DCD A;  4CDE B;  2AIM A;  4HWY A;  1MIR A;  1ME3 A;  3E1Z B;  3PW3 A;  1AU4 A;  1PPP A;  1PPO A;  1AU0 A;  1F2A A;  1AU3 A;  2DJF B;  1STF E;  2NQG A;  3BPM A;  3PBH A;  2DCB A;  3HHI A;  1PPD A;  2CIO A;  3KKU A;  1TLO A;  3S3R A;  1CVZ A;  3WXF A;  4CDF B;  1GEC E;  3HWN A;  2P86 A;  4MSX A;  1PBH A;  3HHA A;  1PCI A;  1F2B A;  2VHS A;  1NPZ A;  4I05 A;  2PRE A;  1K3B B;  4YYV A;  4X6J A;  1U9W A;  4G54 A;  3I06 A;  1AYU A;  3H89 A;  1GCB A;  2DC9 A;  2PNS A;  1PIP A;  1W5R A;  4YVA A;  3CBK A;  4I04 A;  3S3Q A;  1A6R A;  2R9N A;  3AI8 A;  2G8J A;  1E2T A;  2XU4 A;  3WXG A;  3MTN A;  1O0E A;  3PNR A;  2R9M A;  3N3G A;  1MHW A;  1BY8 A;  1CJL A;  2BDZ A;  5EGW A;  1ZIV A;  2FYE A;  4RY2 A;  3BWK A;  7PCK A;  3H8B A;  5J94 A;  2G8E A;  2YJB A;  3BCN A;  1KHP A;  3KFQ A;  4N79 A;  1KFU L;  3N4C A;  2VHF A;  2HH5 A;  1X9Y A;  2AVW A;  4P6G A;  3IUT A;  2Y6E A;  2HHN A;  1YK7 A;  3CH2 X;  4DMY A;  1DF0 A;  2XU5 A;  1BP4 A;  3OVZ A;  2HXZ A;  1EWP A;  1Q6K A;  5F02 A;  1QOL A;  3DF0 A;  4CZW A;  3BPF A;  4X6H A;  4BSQ A;  1ICF A;  2YJ2 A;  2PAD A;  1MDW A;  2AYN A;  3WXE A;  2DZZ A;  8PCH A;  3F5V A;  1ITO A;  1SP4 B;  3KW9 A;  4YYS A;  3K8U A;  1U9Q X;  3C9E A;  4Q8G A;  1F2C A;  4XR7 A;  4QRV A;  3I3T A;  2R6N A;  2ATO A;  1PE6 A;  3OF9 A;  1ME4 A;  3RVW A;  2BDL A;  3CH3 X;  4BS6 A;  3QT4 A;  1AEC A;  3D6S A;  4BS5 A;  3LTW A;  1CSB B;  3K9M A;  3ZUA A;  1THE A;  3MOR A;  4PP1 A;  3IEJ A;  3D9W A;  1CV8 A;  4DMX A;  5A24 A;  3O0U A;  1W6F A;  3RVV A;  3PDF A;  4I07 A;  5CVM A;  4W5B A;  2FRQ A;  2NQI A;  4K7C A;  2PBH A;  1KXR A;  4MZS A;  4X6I A;  3GCB A;  4CDD B;  3MHS A;  1PAD A;  3LFY A;  3CBJ A;  2JQG R;  1EWL A;  1BGO A;  4C5P A;  5PAD A;  4YYR A;  1U9V A;  1XKG A;  2E00 A;  1ATK A;  4BQV A;  1NLJ A;  4W5C A;  2R9F A;  1QDQ A;  1CPJ A;  3P5U A;  3V6E A;  1HUC B;  1AYV A;  4MZO A;  4YV8 A;  2CB5 A;  4WA6 A;  3IMA A;  1NL6 A;  2XU3 A;  1EWO A;  2YJ9 A;  1Y4H A;  3F75 A;  2AUX A;  2R9C A;  3HD3 A;  3H8C A;  1BQI A;  1EWM A;  1DEU A;  2B1M A;  2XU1 A;  4P6E A;  3U8E A;  1FH0 A;  3QJ3 A;  1JQP A;  1PXV A;  1VSN A;  5K16 A;  4OEL A;  1AIM A;  1MEG A;  1MEM A;  1EF7 A;  4AXL A;  5JA7 A;  4YYU A;  2AS8 A;  4FJC A;  6PAD A;  1NB5 A;  2FO5 A;  4N8W A;  4QRX A;  2ARY A;  1SNK A;  4YYQ A;  5CVN B;  1NQC A;  1U5I A;  2NQA A;  1MS6 A;  3KWB X;  3IHP A;  4AXM A;  1YK8 A;  1YVB A;  2P0R A;  4B55 A;  1YAL A;  2E03 A;  2F7D A;  2DC7 A;  1AYW A;  2HD5 A;  3P5V A;  2JQF R;  1VJV A;  1W4T A;  4N4Z A;  1TU6 A;  3LXS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...