5K16A

Crystal structure of free ubiquitin-specific protease 12
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
350
structure length
324
Chain Sequence
SALEKEIGPEQFPVNEHYFGLVNFGNTCYCNSVLQALYFCRPFREKVLAYKSQKKESLLTCLADLFHSIATQKKKVGVIPPKKFITRLRKENELFDNYMQQDAHEFLNYLLNTIADILQEERKQEKQNPDPTWVHEIFQGTLTNETRCLTCETISSKDEDFLDLSVDVEQNTSITHCLRGFSNTETKYYCEECRSKQEAHKRMKVKKLPMILALHLKRFKYMDQLHRYTKLSYRVVFPLELRLFNTSGDATNPDRMYDLVAVVVHCGSGPNRGHYIAIVKSHDFWLLFDDDIVEKIDAQAIEEFYGLTSKNSESGYILFYQSRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Allosteric Activation of Ubiquitin-Specific Proteases by beta-Propeller Proteins UAF1 and WDR20.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Ubiquitin carboxyl-terminal hydrolase 12
total genus 93
structure length 324
sequence length 350
chains with identical sequence B
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2016-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00443 UCH Ubiquitin carboxyl-terminal hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 5k16A00
3D6SA 2DCCA 1GECE 1U5IA 4MZOA 4W5BA 3KKUA 2JQGR 2CIOA 3IV2A 1POPA 1F2AA 2R9CA 1KFXL 1PPPA 3AI8A 9PAPA 4DMXA 1AU2A 3KSEA 3P5VA 4QRVA 3BOWA 3HHAA 1PCIA 5JA7A 4OEMA 1CSBB 2R9FA 3QJ3A 3OF9A 2YJBA 3USVA 2P86A 2DJGB 4G54A 1MEMA 3MTNA 1PADA 5K16A 2NQAA 4BS5A 1MDWA 3S3RA 1NPZA 3TNXA 2OULA 1MEGA 2DC9A 3WXGA 1ATKA 2E00A 3WXEA 2YJ8A 3P5WA 1BP4A 2AYNA 4AXLA 1FH0A 1TL9A 3BPFA 1KXRA 1THEA 5JH3A 1NB3A 3WXFA 4BQVA 3DF0A 2FTDA 2AYOA 2FO5A 4K7CA 2B1MA 3ZUAA 1SNKA 2NQDB 1AU4A 1ITOA 3BC3A 1BY8A 5CHVA 2OZ2A 2P0RA 4QRGA 2P7UA 1YK7A 4DMYA 4P6GA 4CZWA 1YVBA 2FQ9A 1ZCMA 2PBHA 3KW9A 5CHTA 4Q8GA 1CS8A 2AUZA 1STFE 2G6DA 3I06A 3LFYA 3V6CA 2ATOA 1U9VA 2R9OA 3F5VA 2R9MA 3CBJA 4YV8A 2PADA 3PDFA 2OP3A 3KWZA 1AYVA 1BGOA 2DCAA 4WA6A 3M99A 4YYQA 1KHQA 2WBFX 3KFQA 4PP1A 2HD5A 3HD3A 4FIPA 1PE6A 1YK8A 4PP2E 5A24A 4PI3A 2AU1A 3OISA 1AECA 3QSDA 4BS6A 4HWYA 4N4ZA 1PXVA 3HHIA 1EWPA 2VHSA 3HWNA 1NB5A 2R9NA 4PADA 1VSNA 2IBIA 2XU5A 2VHFA 3H7DA 4CDEB 1PIPA 3CH2X 3I3TA 1S4VA 3B79A 3MORA 5EF4A 2DZZA 1EWOA 2F7DA 1QOLA 4I07A 1A6RA 2DZYA 3PNRA 1NLJA 5FPWA 3GCBA 1DEUA 1EWLA 2DC6A 1AIMA 3K9MA 4AXMA 1QDQA 4FK5A 5J94A 2FYEA 2FRAA 4YYUA 4OELA 5PADA 1EWMA 3P5XA 4YYWA 1AYWA 1Y4HA 2DCBA 1VJVA 1YALA 2FUDA 1QXPA 4QRXA 2Y6EA 3N4CA 2FRQA 4N8WA 2DJFB 2GFOA 2FT2A 1ICFA 3LXSA 2YJ2A 2GHUA 1KHPA 3N3KA 4ZUXU 4QH6A 7PCKA 3OF8A 3H89A 2HH5A 3NHEA 4FJCA 8PCHA 1PPOA 1ZIVA 1CVZA 1QMYA 1ME3A 3O1GA 1AYUA 2C0YA 1O0EA 5EGWA 4YYSA 5CVNB 2ACTA 3P5UA 3MHHA 4XUIA 1JQPA 1U9WA 3BWKA 2XU3A 3S3QA 1YT7A 1TLOA 3PBHA 3C9EA 3IOQA 2O6XA 4CDDB 1DF0A 1PBHA 3BPMA 4BSQA 3H6SA 3V6EA 2XU1A 3H8BA 2DCDA 3RVWA 1CQDA 3O0UA 2E02A 2YJCA 5F02A 3IMAA 4MSXA 4YVAA 3U8EA 4XR7A 1Y08A 2R6NA 4BPVA 2DC7A 3OVZA 3CH3X 1GCBA 2AVWA 2HHNA 4I04A 2G8EA 2AIMA 1CTEA 1F2BA 4YYVA 1NQCA 3IEJA 1Q6KA 3RVVA 3K8UA 2NQGA 4X6IA 1CB5A 1IWDA 1GLOA 2PREA 2YJ9A 1KFUL 1TU6A 6PADA 4I05A 3KWBX 4X6HA 2NQIA 4YYRA 1AU0A 1K3BB 2G8JA 3MHSA 2XU4A 2DC8A 5CVMA 4RY2A 1CV8A 1GMYA 2B1NA 1EF7A 2AS8A 3N3GA 2JQFR 1MS6A 1M6DA 4KLBA 2PNSA 1NL6A 1U9QX 1AU3A 1PPDA 3CBKA 1ME4A 4QBBA 2IPPB 1U9XA 2BDLA 3E1ZB 1X9YA 2Y5BA 3ERVA 4CDFB 2H7JA 1CPJA 3RVXA 1CJLA 4N79A 4Q8HA 3QT4A 4W5CA 3K24A 5CVOB 2HXZA 4X6JA 1F2CA 2E01A 3KX1A 4CDCB 2G7YA 1XKGA 1PPNA 3F75A 3H8CA 1MIRA 4P6EA 3IHPA 3OVXA 1SP4B 2AUXA 2CB5A 2BDZA 1F29A 3BCNA 1BQIA 1HUCB 4MZSA 3PW3A 2E03A 1MHWA 2ARYA 2F1GA 4W4UA 3IUTA
chains in the Genus database with same CATH superfamily
3D6SA 2DCCA 1GECE 1U5IA 4MZOA 4W5BA 4WURA 3KKUA 4XZXA 5JZEA 4PT5A 1UKFA 2JQGR 2CIOA 3IV2A 1POPA 1F2AA 2R9CA 4HXDB 1KFXL 1PPPA 3AI8A 9PAPA 4DMXA 1AU2A 3KSEA 3P5VA 4QRVA 3BOWA 3HHAA 3PHXA 1PCIA 5JA7A 4IUMA 4OEMA 1CSBB 2R9FA 3QJ3A 3OF9A 2YJBA 3USVA 2P86A 2DJGB 3MP2A 4G54A 3MTVA 1MEMA 3MTNA 1PADA 5K16A 2NQAA 4BS5A 1MDWA 3S3RA 1NPZA 4M0WA 3TNXA 4RNAA 2OULA 2DOSA 1MEGA 2DC9A 1DKIA 1ATKA 4IP3A 2E00A 3WXGA 3WXEA 2YJ8A 3P5WA 1BP4A 2AYNA 4AXLA 1FH0A 3BBAA 1TL9A 3BPFA 1KXRA 1THEA 5JH3A 1NB3A 3OQCA 4RKXA 3WXFA 3PSEA 4BQVA 3DF0A 2FTDA 2AYOA 2FO5A 4K7CA 2B1MA 3ZUAA 1SNKA 2NQDB 3C0RA 1AU4A 1ITOA 3BC3A 1BY8A 5CHVA 4BOQA 2OZ2A 2P0RA 4QRGA 2J7QA 1YK7A 2P7UA 4DMYA 4P6GA 4CZWA 1YVBA 3E9SA 2FQ9A 1ZCMA 2PBHA 3KW9A 5CHTA 4Q8GA 1CS8A 2AUZA 1STFE 2G6DA 3I06A 3LFYA 3V6CA 2ATOA 1U9VA 2R9OA 3F5VA 4BOUA 3BB7A 2R9MA 3CBJA 4YV8A 2PADA 2FE8A 3PDFA 2OP3A 3KWZA 1AYVA 1BGOA 2DCAA 4WA6A 3M99A 4YYQA 1KHQA 2WBFX 3KFQA 4PP1A 2HD5A 3HD3A 2UZJA 4FIPA 2JTCA 1PE6A 1YK8A 4PP2E 5A24A 4PI3A 4BOSA 2AU1A 3OISA 1AECA 3QSDA 4BS6A 4HWYA 4N4ZA 4REZA 5EZQA 1PXVA 3HHIA 1EWPA 2VHSA 3HWNA 1NB5A 2R9NA 4PADA 1VSNA 2Z84A 2IBIA 2XU5A 2VHFA 3H7DA 4OVZB 4CDEB 1PIPA 3CH2X 3TMPA 3I3TA 1S4VA 3B79A 3MORA 5EF4A 2DZZA 3MJ5A 1EWOA 2F7DA 1QOLA 4I07A 1A6RA 1PVJA 2DZYA 3PNRA 4D8IA 5E6JA 1NLJA 5FPWA 3GCBA 1DEUA 1EWLA 2DC6A 1AIMA 3K9MA 4AXMA 1QDQA 4FK5A 5J94A 2FYEA 2FRAA 4YYUA 4OELA 5PADA 1EWMA 3P5XA 4YYWA 3BY4A 1AYWA 1Y4HA 2DCBA 1VJVA 1YALA 2FUDA 1QXPA 4QRXA 2Y6EA 3N4CA 2FRQA 4N8WA 2DJFB 2GFOA 2FT2A 3O65A 2AGAA 1ICFA 3LXSA 2YJ2A 3PT2A 2GHUA 1KHPA 3N3KA 4ZUXU 4R3DA 4QH6A 4OVZA 7PCKA 3OF8A 3H89A 2HH5A 3NHEA 4MM3B 4FJCA 8PCHA 1PPOA 1ZIVA 1CVZA 1QMYA 1ME3A 3O1GA 1AYUA 2C0YA 1O0EA 2HWKA 5EGWA 5KO3A 3IFUA 4YYSA 5CVNB 2ACTA 2BTWA 3P5UA 3MHHA 4MI7A 4XUIA 1JQPA 1U9WA 3BWKA 2XU3A 3S3QA 1YT7A 2J7QC 1TLOA 3PBHA 4A5UA 4RF0A 3PHUA 3C9EA 3IOQA 4RF1A 2O6XA 4CDDB 1DF0A 1PBHA 4P16A 3BPMA 3ZNHA 4BOPA 4BSQA 3H6SA 3V6EA 2XU1A 3H8BA 2DCDA 3RVWA 1CQDA 3O0UA 2E02A 2YJCA 5F02A 3IMAA 4MSXA 4YVAA 3U8EA 4GUAA 4XR7A 1Y08A 2R6NA 4BPVA 2DC7A 3OVZA 2JRIA 3W31A 1YZBA 3CH3X 1GCBA 2AVWA 2HHNA 4I04A 2G8EA 2AIMA 1CTEA 1F2BA 4ZTBA 4YYVA 1NQCA 5EZSA 3IEJA 1Q6KA 3RVVA 3K8UA 2NQGA 4X6IA 1CB5A 1IWDA 1GLOA 2PREA 2YJ9A 1KFUL 1TU6A 6PADA 4I05A 3KWBX 4X6HA 2NQIA 4YYRA 1AU0A 1K3BB 3B21A 4OW0A 2G8JA 3MHSA 2XU4A 2DC8A 4BOZA 5CVMA 4RY2A 1CV8A 1GMYA 2B1NA 1EF7A 2AS8A 3N3GA 2JQFR 1MS6A 1M6DA 4KLBA 2PNSA 2BTWB 1NL6A 1U9QX 1AU3A 4D8EA 1PPDA 3CBKA 1ME4A 4QBBA 2IPPB 1U9XA 2BDLA 3E1ZB 1X9YA 2Y5BA 3ERVA 4CDFB 2H7JA 1CPJA 3RVXA 1CJLA 4N79A 4Q8HA 3QT4A 4W5CA 3K24A 5CVOB 2HXZA 4X6JA 1F2CA 2E01A 3KX1A 4CDCB 2G7YA 3PHWA 1XKGA 1PPNA 3F75A 3H8CA 1MIRA 4P6EA 3RNVA 2BU3A 3IHPA 3OVXA 1SP4B 3PRPA 2AUXA 2CB5A 2BDZA 3W30A 1F29A 3BCNA 3TRKA 3PRMA 1BQIA 1HUCB 4MZSA 3PW3A 2E03A 4D8BA 1MHWA 2ARYA 2F1GA 4W4UA 3IUTA
chains in the Genus database with same CATH topology
3D6SA 2DCCA 1GECE 1U5IA 4MZOA 4W5BA 3KKUA 3D9WA 2JQGR 2CIOA 3IV2A 1POPA 1F2AA 2R9CA 1KFXL 1PPPA 3AI8A 9PAPA 1E2TA 4DMXA 1AU2A 3KSEA 3P5VA 4QRVA 3BOWA 3HHAA 1PCIA 5JA7A 4OEMA 1CSBB 2R9FA 3QJ3A 1GX3A 3OF9A 2YJBA 3USVA 2P86A 2DJGB 4G54A 1MEMA 3MTNA 1PADA 5K16A 2NQAA 4BS5A 1MDWA 3S3RA 1NPZA 3TNXA 2OULA 1MEGA 2DC9A 3WXGA 1ATKA 2E00A 3WXEA 2YJ8A 1W5RA 3P5WA 1BP4A 2AYNA 4AXLA 1FH0A 1TL9A 3BPFA 1KXRA 1THEA 5JH3A 1NB3A 3WXFA 4BQVA 3DF0A 2FTDA 2AYOA 2FO5A 4K7CA 2B1MA 3ZUAA 1SNKA 2NQDB 1AU4A 2VFBA 1ITOA 4BGFA 3BC3A 1BY8A 5CHVA 2OZ2A 2P0RA 4QRGA 2P7UA 1YK7A 4DMYA 4P6GA 4CZWA 1YVBA 2FQ9A 1ZCMA 2PBHA 3KW9A 5CHTA 4Q8GA 1CS8A 2AUZA 1STFE 2G6DA 3I06A 3LFYA 3V6CA 2ATOA 1U9VA 2R9OA 3F5VA 2R9MA 3CBJA 4YV8A 2PADA 3PDFA 2OP3A 3KWZA 1AYVA 1BGOA 2DCAA 4WA6A 3M99A 4YYQA 1KHQA 2WBFX 3KFQA 1W4TA 4PP1A 2HD5A 3HD3A 4FIPA 1PE6A 1YK8A 4PP2E 5A24A 4PI3A 2AU1A 3OISA 2VFCA 1AECA 3QSDA 4BS6A 4HWYA 4N4ZA 1PXVA 2BSZA 3HHIA 1EWPA 2VHSA 3HWNA 1NB5A 2R9NA 4PADA 1VSNA 2IBIA 2XU5A 2VHFA 3H7DA 4CDEB 1PIPA 3CH2X 3I3TA 1S4VA 3B79A 3MORA 5EF4A 2DZZA 1EWOA 2F7DA 1QOLA 4I07A 1A6RA 2DZYA 3PNRA 1NLJA 5FPWA 3GCBA 1DEUA 1EWLA 2DC6A 1AIMA 3K9MA 4AXMA 1QDQA 4FK5A 5J94A 2FYEA 2FRAA 4YYUA 4OELA 5PADA 1EWMA 3P5XA 4YYWA 1AYWA 1Y4HA 2DCBA 1VJVA 1YALA 2FUDA 1QXPA 4QRXA 2Y6EA 3N4CA 2FRQA 4N8WA 2DJFB 2GFOA 2FT2A 1ICFA 3LXSA 2YJ2A 2GHUA 1KHPA 3N3KA 4ZUXU 4QH6A 7PCKA 3OF8A 3H89A 2HH5A 3NHEA 4FJCA 8PCHA 4B55A 1PPOA 1ZIVA 1CVZA 1QMYA 1ME3A 3O1GA 1AYUA 2C0YA 1O0EA 5EGWA 4YYSA 5CVNB 2ACTA 3P5UA 3MHHA 4XUIA 1JQPA 1U9WA 3BWKA 2XU3A 3S3QA 1YT7A 1TLOA 3PBHA 3C9EA 3IOQA 2O6XA 4NV7A 4CDDB 1DF0A 1PBHA 3BPMA 4GUZA 4BSQA 3H6SA 3V6EA 2XU1A 3H8BA 2DCDA 3RVWA 1CQDA 3O0UA 2E02A 2YJCA 5F02A 3IMAA 4MSXA 4YVAA 3U8EA 4XR7A 1Y08A 2R6NA 4BPVA 2DC7A 3OVZA 3CH3X 1GCBA 2AVWA 2HHNA 4I04A 2G8EA 2AIMA 1CTEA 1F2BA 4YYVA 1NQCA 3IEJA 1W6FA 1Q6KA 4NV8A 3RVVA 3K8UA 2NQGA 4X6IA 1CB5A 1IWDA 1GLOA 2PREA 2YJ9A 1KFUL 1TU6A 3LTWA 6PADA 4I05A 3KWBX 4X6HA 2NQIA 4YYRA 1AU0A 1K3BB 2G8JA 3MHSA 2XU4A 2DC8A 5CVMA 4RY2A 1CV8A 1GMYA 2B1NA 1EF7A 2AS8A 3N3GA 2JQFR 1MS6A 1M6DA 4KLBA 2PNSA 1NL6A 1U9QX 1AU3A 1PPDA 3CBKA 1ME4A 4QBBA 2IPPB 1U9XA 2BDLA 3E1ZB 1X9YA 2Y5BA 3ERVA 4CDFB 2H7JA 1CPJA 3RVXA 1CJLA 4N79A 4Q8HA 3QT4A 4W5CA 3K24A 5CVOB 2HXZA 4X6JA 1F2CA 2E01A 3KX1A 4CDCB 2G7YA 1XKGA 1PPNA 3F75A 3H8CA 1MIRA 4P6EA 4C5PA 3IHPA 3OVXA 1SP4B 2AUXA 2CB5A 2BDZA 1F29A 3BCNA 1BQIA 1HUCB 4MZSA 3PW3A 2E03A 1MHWA 2ARYA 2F1GA 4W4UA 3IUTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D6S A;  2DCC A;  1GEC E;  1U5I A;  4MZO A;  4W5B A;  3KKU A;  2JQG R;  2CIO A;  3IV2 A;  1POP A;  1F2A A;  2R9C A;  1KFX L;  1PPP A;  3AI8 A;  9PAP A;  4DMX A;  1AU2 A;  3KSE A;  3P5V A;  4QRV A;  3BOW A;  3HHA A;  1PCI A;  5JA7 A;  4OEM A;  1CSB B;  2R9F A;  3QJ3 A;  3OF9 A;  2YJB A;  3USV A;  2P86 A;  2DJG B;  4G54 A;  1MEM A;  3MTN A;  1PAD A;  5K16 A;  2NQA A;  4BS5 A;  1MDW A;  3S3R A;  1NPZ A;  3TNX A;  2OUL A;  1MEG A;  2DC9 A;  3WXG A;  1ATK A;  2E00 A;  3WXE A;  2YJ8 A;  3P5W A;  1BP4 A;  2AYN A;  4AXL A;  1FH0 A;  1TL9 A;  3BPF A;  1KXR A;  1THE A;  5JH3 A;  1NB3 A;  3WXF A;  4BQV A;  3DF0 A;  2FTD A;  2AYO A;  2FO5 A;  4K7C A;  2B1M A;  3ZUA A;  1SNK A;  2NQD B;  1AU4 A;  1ITO A;  3BC3 A;  1BY8 A;  5CHV A;  2OZ2 A;  2P0R A;  4QRG A;  2P7U A;  1YK7 A;  4DMY A;  4P6G A;  4CZW A;  1YVB A;  2FQ9 A;  1ZCM A;  2PBH A;  3KW9 A;  5CHT A;  4Q8G A;  1CS8 A;  2AUZ A;  1STF E;  2G6D A;  3I06 A;  3LFY A;  3V6C A;  2ATO A;  1U9V A;  2R9O A;  3F5V A;  2R9M A;  3CBJ A;  4YV8 A;  2PAD A;  3PDF A;  2OP3 A;  3KWZ A;  1AYV A;  1BGO A;  2DCA A;  4WA6 A;  3M99 A;  4YYQ A;  1KHQ A;  2WBF X;  3KFQ A;  4PP1 A;  2HD5 A;  3HD3 A;  4FIP A;  1PE6 A;  1YK8 A;  4PP2 E;  5A24 A;  4PI3 A;  2AU1 A;  3OIS A;  1AEC A;  3QSD A;  4BS6 A;  4HWY A;  4N4Z A;  1PXV A;  3HHI A;  1EWP A;  2VHS A;  3HWN A;  1NB5 A;  2R9N A;  4PAD A;  1VSN A;  2IBI A;  2XU5 A;  2VHF A;  3H7D A;  4CDE B;  1PIP A;  3CH2 X;  3I3T A;  1S4V A;  3B79 A;  3MOR A;  5EF4 A;  2DZZ A;  1EWO A;  2F7D A;  1QOL A;  4I07 A;  1A6R A;  2DZY A;  3PNR A;  1NLJ A;  5FPW A;  3GCB A;  1DEU A;  1EWL A;  2DC6 A;  1AIM A;  3K9M A;  4AXM A;  1QDQ A;  4FK5 A;  5J94 A;  2FYE A;  2FRA A;  4YYU A;  4OEL A;  5PAD A;  1EWM A;  3P5X A;  4YYW A;  1AYW A;  1Y4H A;  2DCB A;  1VJV A;  1YAL A;  2FUD A;  1QXP A;  4QRX A;  2Y6E A;  3N4C A;  2FRQ A;  4N8W A;  2DJF B;  2GFO A;  2FT2 A;  1ICF A;  3LXS A;  2YJ2 A;  2GHU A;  1KHP A;  3N3K A;  4ZUX U;  4QH6 A;  7PCK A;  3OF8 A;  3H89 A;  2HH5 A;  3NHE A;  4FJC A;  8PCH A;  1PPO A;  1ZIV A;  1CVZ A;  1QMY A;  1ME3 A;  3O1G A;  1AYU A;  2C0Y A;  1O0E A;  5EGW A;  4YYS A;  5CVN B;  2ACT A;  3P5U A;  3MHH A;  4XUI A;  1JQP A;  1U9W A;  3BWK A;  2XU3 A;  3S3Q A;  1YT7 A;  1TLO A;  3PBH A;  3C9E A;  3IOQ A;  2O6X A;  4CDD B;  1DF0 A;  1PBH A;  3BPM A;  4BSQ A;  3H6S A;  3V6E A;  2XU1 A;  3H8B A;  2DCD A;  3RVW A;  1CQD A;  3O0U A;  2E02 A;  2YJC A;  5F02 A;  3IMA A;  4MSX A;  4YVA A;  3U8E A;  4XR7 A;  1Y08 A;  2R6N A;  4BPV A;  2DC7 A;  3OVZ A;  3CH3 X;  1GCB A;  2AVW A;  2HHN A;  4I04 A;  2G8E A;  2AIM A;  1CTE A;  1F2B A;  4YYV A;  1NQC A;  3IEJ A;  1Q6K A;  3RVV A;  3K8U A;  2NQG A;  4X6I A;  1CB5 A;  1IWD A;  1GLO A;  2PRE A;  2YJ9 A;  1KFU L;  1TU6 A;  6PAD A;  4I05 A;  3KWB X;  4X6H A;  2NQI A;  4YYR A;  1AU0 A;  1K3B B;  2G8J A;  3MHS A;  2XU4 A;  2DC8 A;  5CVM A;  4RY2 A;  1CV8 A;  1GMY A;  2B1N A;  1EF7 A;  2AS8 A;  3N3G A;  2JQF R;  1MS6 A;  1M6D A;  4KLB A;  2PNS A;  1NL6 A;  1U9Q X;  1AU3 A;  1PPD A;  3CBK A;  1ME4 A;  4QBB A;  2IPP B;  1U9X A;  2BDL A;  3E1Z B;  1X9Y A;  2Y5B A;  3ERV A;  4CDF B;  2H7J A;  1CPJ A;  3RVX A;  1CJL A;  4N79 A;  4Q8H A;  3QT4 A;  4W5C A;  3K24 A;  5CVO B;  2HXZ A;  4X6J A;  1F2C A;  2E01 A;  3KX1 A;  4CDC B;  2G7Y A;  1XKG A;  1PPN A;  3F75 A;  3H8C A;  1MIR A;  4P6E A;  3IHP A;  3OVX A;  1SP4 B;  2AUX A;  2CB5 A;  2BDZ A;  1F29 A;  3BCN A;  1BQI A;  1HUC B;  4MZS A;  3PW3 A;  2E03 A;  1MHW A;  2ARY A;  2F1G A;  4W4U A;  3IUT A; 
#chains in the Genus database with same CATH topology
 3D6S A;  2DCC A;  1GEC E;  1U5I A;  4MZO A;  4W5B A;  4WUR A;  3KKU A;  4XZX A;  5JZE A;  4PT5 A;  1UKF A;  2JQG R;  2CIO A;  3IV2 A;  1POP A;  1F2A A;  2R9C A;  4HXD B;  1KFX L;  1PPP A;  3AI8 A;  9PAP A;  4DMX A;  1AU2 A;  3KSE A;  3P5V A;  4QRV A;  3BOW A;  3HHA A;  3PHX A;  1PCI A;  5JA7 A;  4IUM A;  4OEM A;  1CSB B;  2R9F A;  3QJ3 A;  3OF9 A;  2YJB A;  3USV A;  2P86 A;  2DJG B;  3MP2 A;  4G54 A;  3MTV A;  1MEM A;  3MTN A;  1PAD A;  5K16 A;  2NQA A;  4BS5 A;  1MDW A;  3S3R A;  1NPZ A;  4M0W A;  3TNX A;  4RNA A;  2OUL A;  2DOS A;  1MEG A;  2DC9 A;  1DKI A;  1ATK A;  4IP3 A;  2E00 A;  3WXG A;  3WXE A;  2YJ8 A;  3P5W A;  1BP4 A;  2AYN A;  4AXL A;  1FH0 A;  3BBA A;  1TL9 A;  3BPF A;  1KXR A;  1THE A;  5JH3 A;  1NB3 A;  3OQC A;  4RKX A;  3WXF A;  3PSE A;  4BQV A;  3DF0 A;  2FTD A;  2AYO A;  2FO5 A;  4K7C A;  2B1M A;  3ZUA A;  1SNK A;  2NQD B;  3C0R A;  1AU4 A;  1ITO A;  3BC3 A;  1BY8 A;  5CHV A;  4BOQ A;  2OZ2 A;  2P0R A;  4QRG A;  2J7Q A;  1YK7 A;  2P7U A;  4DMY A;  4P6G A;  4CZW A;  1YVB A;  3E9S A;  2FQ9 A;  1ZCM A;  2PBH A;  3KW9 A;  5CHT A;  4Q8G A;  1CS8 A;  2AUZ A;  1STF E;  2G6D A;  3I06 A;  3LFY A;  3V6C A;  2ATO A;  1U9V A;  2R9O A;  3F5V A;  4BOU A;  3BB7 A;  2R9M A;  3CBJ A;  4YV8 A;  2PAD A;  2FE8 A;  3PDF A;  2OP3 A;  3KWZ A;  1AYV A;  1BGO A;  2DCA A;  4WA6 A;  3M99 A;  4YYQ A;  1KHQ A;  2WBF X;  3KFQ A;  4PP1 A;  2HD5 A;  3HD3 A;  2UZJ A;  4FIP A;  2JTC A;  1PE6 A;  1YK8 A;  4PP2 E;  5A24 A;  4PI3 A;  4BOS A;  2AU1 A;  3OIS A;  1AEC A;  3QSD A;  4BS6 A;  4HWY A;  4N4Z A;  4REZ A;  5EZQ A;  1PXV A;  3HHI A;  1EWP A;  2VHS A;  3HWN A;  1NB5 A;  2R9N A;  4PAD A;  1VSN A;  2Z84 A;  2IBI A;  2XU5 A;  2VHF A;  3H7D A;  4OVZ B;  4CDE B;  1PIP A;  3CH2 X;  3TMP A;  3I3T A;  1S4V A;  3B79 A;  3MOR A;  5EF4 A;  2DZZ A;  3MJ5 A;  1EWO A;  2F7D A;  1QOL A;  4I07 A;  1A6R A;  1PVJ A;  2DZY A;  3PNR A;  4D8I A;  5E6J A;  1NLJ A;  5FPW A;  3GCB A;  1DEU A;  1EWL A;  2DC6 A;  1AIM A;  3K9M A;  4AXM A;  1QDQ A;  4FK5 A;  5J94 A;  2FYE A;  2FRA A;  4YYU A;  4OEL A;  5PAD A;  1EWM A;  3P5X A;  4YYW A;  3BY4 A;  1AYW A;  1Y4H A;  2DCB A;  1VJV A;  1YAL A;  2FUD A;  1QXP A;  4QRX A;  2Y6E A;  3N4C A;  2FRQ A;  4N8W A;  2DJF B;  2GFO A;  2FT2 A;  3O65 A;  2AGA A;  1ICF A;  3LXS A;  2YJ2 A;  3PT2 A;  2GHU A;  1KHP A;  3N3K A;  4ZUX U;  4R3D A;  4QH6 A;  4OVZ A;  7PCK A;  3OF8 A;  3H89 A;  2HH5 A;  3NHE A;  4MM3 B;  4FJC A;  8PCH A;  1PPO A;  1ZIV A;  1CVZ A;  1QMY A;  1ME3 A;  3O1G A;  1AYU A;  2C0Y A;  1O0E A;  2HWK A;  5EGW A;  5KO3 A;  3IFU A;  4YYS A;  5CVN B;  2ACT A;  2BTW A;  3P5U A;  3MHH A;  4MI7 A;  4XUI A;  1JQP A;  1U9W A;  3BWK A;  2XU3 A;  3S3Q A;  1YT7 A;  2J7Q C;  1TLO A;  3PBH A;  4A5U A;  4RF0 A;  3PHU A;  3C9E A;  3IOQ A;  4RF1 A;  2O6X A;  4CDD B;  1DF0 A;  1PBH A;  4P16 A;  3BPM A;  3ZNH A;  4BOP A;  4BSQ A;  3H6S A;  3V6E A;  2XU1 A;  3H8B A;  2DCD A;  3RVW A;  1CQD A;  3O0U A;  2E02 A;  2YJC A;  5F02 A;  3IMA A;  4MSX A;  4YVA A;  3U8E A;  4GUA A;  4XR7 A;  1Y08 A;  2R6N A;  4BPV A;  2DC7 A;  3OVZ A;  2JRI A;  3W31 A;  1YZB A;  3CH3 X;  1GCB A;  2AVW A;  2HHN A;  4I04 A;  2G8E A;  2AIM A;  1CTE A;  1F2B A;  4ZTB A;  4YYV A;  1NQC A;  5EZS A;  3IEJ A;  1Q6K A;  3RVV A;  3K8U A;  2NQG A;  4X6I A;  1CB5 A;  1IWD A;  1GLO A;  2PRE A;  2YJ9 A;  1KFU L;  1TU6 A;  6PAD A;  4I05 A;  3KWB X;  4X6H A;  2NQI A;  4YYR A;  1AU0 A;  1K3B B;  3B21 A;  4OW0 A;  2G8J A;  3MHS A;  2XU4 A;  2DC8 A;  4BOZ A;  5CVM A;  4RY2 A;  1CV8 A;  1GMY A;  2B1N A;  1EF7 A;  2AS8 A;  3N3G A;  2JQF R;  1MS6 A;  1M6D A;  4KLB A;  2PNS A;  2BTW B;  1NL6 A;  1U9Q X;  1AU3 A;  4D8E A;  1PPD A;  3CBK A;  1ME4 A;  4QBB A;  2IPP B;  1U9X A;  2BDL A;  3E1Z B;  1X9Y A;  2Y5B A;  3ERV A;  4CDF B;  2H7J A;  1CPJ A;  3RVX A;  1CJL A;  4N79 A;  4Q8H A;  3QT4 A;  4W5C A;  3K24 A;  5CVO B;  2HXZ A;  4X6J A;  1F2C A;  2E01 A;  3KX1 A;  4CDC B;  2G7Y A;  3PHW A;  1XKG A;  1PPN A;  3F75 A;  3H8C A;  1MIR A;  4P6E A;  3RNV A;  2BU3 A;  3IHP A;  3OVX A;  1SP4 B;  3PRP A;  2AUX A;  2CB5 A;  2BDZ A;  3W30 A;  1F29 A;  3BCN A;  3TRK A;  3PRM A;  1BQI A;  1HUC B;  4MZS A;  3PW3 A;  2E03 A;  4D8B A;  1MHW A;  2ARY A;  2F1G A;  4W4U A;  3IUT A; 
#chains in the Genus database with same CATH homology
 3D6S A;  2DCC A;  1GEC E;  1U5I A;  4MZO A;  4W5B A;  3KKU A;  3D9W A;  2JQG R;  2CIO A;  3IV2 A;  1POP A;  1F2A A;  2R9C A;  1KFX L;  1PPP A;  3AI8 A;  9PAP A;  1E2T A;  4DMX A;  1AU2 A;  3KSE A;  3P5V A;  4QRV A;  3BOW A;  3HHA A;  1PCI A;  5JA7 A;  4OEM A;  1CSB B;  2R9F A;  3QJ3 A;  1GX3 A;  3OF9 A;  2YJB A;  3USV A;  2P86 A;  2DJG B;  4G54 A;  1MEM A;  3MTN A;  1PAD A;  5K16 A;  2NQA A;  4BS5 A;  1MDW A;  3S3R A;  1NPZ A;  3TNX A;  2OUL A;  1MEG A;  2DC9 A;  3WXG A;  1ATK A;  2E00 A;  3WXE A;  2YJ8 A;  1W5R A;  3P5W A;  1BP4 A;  2AYN A;  4AXL A;  1FH0 A;  1TL9 A;  3BPF A;  1KXR A;  1THE A;  5JH3 A;  1NB3 A;  3WXF A;  4BQV A;  3DF0 A;  2FTD A;  2AYO A;  2FO5 A;  4K7C A;  2B1M A;  3ZUA A;  1SNK A;  2NQD B;  1AU4 A;  2VFB A;  1ITO A;  4BGF A;  3BC3 A;  1BY8 A;  5CHV A;  2OZ2 A;  2P0R A;  4QRG A;  2P7U A;  1YK7 A;  4DMY A;  4P6G A;  4CZW A;  1YVB A;  2FQ9 A;  1ZCM A;  2PBH A;  3KW9 A;  5CHT A;  4Q8G A;  1CS8 A;  2AUZ A;  1STF E;  2G6D A;  3I06 A;  3LFY A;  3V6C A;  2ATO A;  1U9V A;  2R9O A;  3F5V A;  2R9M A;  3CBJ A;  4YV8 A;  2PAD A;  3PDF A;  2OP3 A;  3KWZ A;  1AYV A;  1BGO A;  2DCA A;  4WA6 A;  3M99 A;  4YYQ A;  1KHQ A;  2WBF X;  3KFQ A;  1W4T A;  4PP1 A;  2HD5 A;  3HD3 A;  4FIP A;  1PE6 A;  1YK8 A;  4PP2 E;  5A24 A;  4PI3 A;  2AU1 A;  3OIS A;  2VFC A;  1AEC A;  3QSD A;  4BS6 A;  4HWY A;  4N4Z A;  1PXV A;  2BSZ A;  3HHI A;  1EWP A;  2VHS A;  3HWN A;  1NB5 A;  2R9N A;  4PAD A;  1VSN A;  2IBI A;  2XU5 A;  2VHF A;  3H7D A;  4CDE B;  1PIP A;  3CH2 X;  3I3T A;  1S4V A;  3B79 A;  3MOR A;  5EF4 A;  2DZZ A;  1EWO A;  2F7D A;  1QOL A;  4I07 A;  1A6R A;  2DZY A;  3PNR A;  1NLJ A;  5FPW A;  3GCB A;  1DEU A;  1EWL A;  2DC6 A;  1AIM A;  3K9M A;  4AXM A;  1QDQ A;  4FK5 A;  5J94 A;  2FYE A;  2FRA A;  4YYU A;  4OEL A;  5PAD A;  1EWM A;  3P5X A;  4YYW A;  1AYW A;  1Y4H A;  2DCB A;  1VJV A;  1YAL A;  2FUD A;  1QXP A;  4QRX A;  2Y6E A;  3N4C A;  2FRQ A;  4N8W A;  2DJF B;  2GFO A;  2FT2 A;  1ICF A;  3LXS A;  2YJ2 A;  2GHU A;  1KHP A;  3N3K A;  4ZUX U;  4QH6 A;  7PCK A;  3OF8 A;  3H89 A;  2HH5 A;  3NHE A;  4FJC A;  8PCH A;  4B55 A;  1PPO A;  1ZIV A;  1CVZ A;  1QMY A;  1ME3 A;  3O1G A;  1AYU A;  2C0Y A;  1O0E A;  5EGW A;  4YYS A;  5CVN B;  2ACT A;  3P5U A;  3MHH A;  4XUI A;  1JQP A;  1U9W A;  3BWK A;  2XU3 A;  3S3Q A;  1YT7 A;  1TLO A;  3PBH A;  3C9E A;  3IOQ A;  2O6X A;  4NV7 A;  4CDD B;  1DF0 A;  1PBH A;  3BPM A;  4GUZ A;  4BSQ A;  3H6S A;  3V6E A;  2XU1 A;  3H8B A;  2DCD A;  3RVW A;  1CQD A;  3O0U A;  2E02 A;  2YJC A;  5F02 A;  3IMA A;  4MSX A;  4YVA A;  3U8E A;  4XR7 A;  1Y08 A;  2R6N A;  4BPV A;  2DC7 A;  3OVZ A;  3CH3 X;  1GCB A;  2AVW A;  2HHN A;  4I04 A;  2G8E A;  2AIM A;  1CTE A;  1F2B A;  4YYV A;  1NQC A;  3IEJ A;  1W6F A;  1Q6K A;  4NV8 A;  3RVV A;  3K8U A;  2NQG A;  4X6I A;  1CB5 A;  1IWD A;  1GLO A;  2PRE A;  2YJ9 A;  1KFU L;  1TU6 A;  3LTW A;  6PAD A;  4I05 A;  3KWB X;  4X6H A;  2NQI A;  4YYR A;  1AU0 A;  1K3B B;  2G8J A;  3MHS A;  2XU4 A;  2DC8 A;  5CVM A;  4RY2 A;  1CV8 A;  1GMY A;  2B1N A;  1EF7 A;  2AS8 A;  3N3G A;  2JQF R;  1MS6 A;  1M6D A;  4KLB A;  2PNS A;  1NL6 A;  1U9Q X;  1AU3 A;  1PPD A;  3CBK A;  1ME4 A;  4QBB A;  2IPP B;  1U9X A;  2BDL A;  3E1Z B;  1X9Y A;  2Y5B A;  3ERV A;  4CDF B;  2H7J A;  1CPJ A;  3RVX A;  1CJL A;  4N79 A;  4Q8H A;  3QT4 A;  4W5C A;  3K24 A;  5CVO B;  2HXZ A;  4X6J A;  1F2C A;  2E01 A;  3KX1 A;  4CDC B;  2G7Y A;  1XKG A;  1PPN A;  3F75 A;  3H8C A;  1MIR A;  4P6E A;  4C5P A;  3IHP A;  3OVX A;  1SP4 B;  2AUX A;  2CB5 A;  2BDZ A;  1F29 A;  3BCN A;  1BQI A;  1HUC B;  4MZS A;  3PW3 A;  2E03 A;  1MHW A;  2ARY A;  2F1G A;  4W4U A;  3IUT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...