1AIMA

Cruzain inhibited by benzoyl-tyrosine-alanine-fluoromethylketone
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
215
structure length
215
Chain Sequence
APAAVDWRARGAVTAVKDQGQCGSCWAFSAIGNVECQWFLAGHPLTNLSEQMLVSCDKTDSGCSGGLMNNAFEWIVQENNGAVYTEDSYPYASGEGISPPCTTSGHTVGATITGHVELPQDEAQIAAWLAVNGPVAVAVDASSWMTYTGGVMTSCVSEALDHGVLLVGYNDSAAVPYWIIKNSWTTQWGEEGYIRIAKGSNQCLVKEEASSAVVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural determinants of specificity in the cysteine protease cruzain.
pubmed rcsb
source organism Trypanosoma cruzi
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords CRUZAIN
total genus 62
structure length 215
sequence length 215
ec nomenclature ec 3.4.22.51: Cruzipain.
pdb deposition date 1997-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1aimA00
1QMYA 1Q6KA 4X6IA 1PIPA 4ZUXU 4PP1A 1QDQA 3IV2A 3D6SA 1PPOA 2FRAA 2FRQA 1NB5A 3P5WA 1GLOA 4W5CA 2DCCA 2YJCA 1U9QX 1BQIA 5JA7A 3OVXA 2XU5A 3KKUA 2R9MA 1CSBB 1SP4B 2FO5A 1AU3A 4BS5A 2BDZA 1Y4HA 3GCBA 3N3GA 1PADA 2E00A 4DMXA 1AU4A 4X6HA 2HD5A 3CH3X 4MZSA 3KWZA 2F7DA 3H8CA 3LFYA 1KHQA 3KFQA 2DC9A 1U5IA 4OELA 2AUXA 1PPNA 2AYNA 1NQCA 1KHPA 2CB5A 1EF7A 4OEMA 1POPA 4YYUA 1F2AA 4N4ZA 3KSEA 1XKGA 2WBFX 1KFXL 3BC3A 3CBKA 2G6DA 2JQFR 1BY8A 3LXSA 2AVWA 2E01A 2O6XA 5CVMA 1S4VA 2FT2A 2Y6EA 3H7DA 1NLJA 4RY2A 4PP2E 4XR7A 1CV8A 4Q8GA 3BPMA 2YJ2A 1AYVA 3KX1A 1MIRA 1CVZA 5J94A 3IHPA 3S3QA 4DMYA 2GHUA 1AYWA 3RVVA 5EGWA 2DC6A 4YVAA 2IBIA 3BWKA 3PBHA 1TL9A 1X9YA 3IMAA 4WA6A 4QRGA 1F29A 1Y08A 5CHVA 3CBJA 1PPDA 2PBHA 3H6SA 1CS8A 2FQ9A 5JH3A 1MEGA 1CJLA 2R9CA 5CVOB 2PNSA 3N3KA 3RVXA 4BQVA 2NQAA 2DCBA 1DEUA 2H7JA 1ME4A 1JQPA 4CDDB 4I05A 4CDEB 1ICFA 1U9XA 8PCHA 3P5UA 3HD3A 1O0EA 2Y5BA 3U8EA 3PDFA 4FK5A 3QSDA 1ITOA 5CHTA 4QH6A 5FPWA 4QRVA 1KXRA 2FYEA 2NQGA 1U9VA 3K8UA 1EWMA 3K24A 1ZCMA 2FUDA 2GFOA 1HUCB 4X6JA 2FTDA 3O0UA 2AU1A 3B79A 1YVBA 1GECE 3N4CA 2VHFA 3AI8A 3RVWA 4YYVA 1CPJA 3NHEA 7PCKA 3DF0A 1U9WA 1F2CA 2YJBA 3ZUAA 2E03A 4FIPA 3ERVA 2NQIA 1MEMA 3IEJA 2NQDB 4BPVA 5F02A 2E02A 1ZIVA 3IOQA 1IWDA 3HHAA 3M99A 2AS8A 1KFUL 3MORA 2XU3A 3IUTA 3H8BA 3BOWA 3MHHA 1DF0A 2R9NA 3PNRA 3V6EA 2HXZA 1A6RA 1YK7A 1YK8A 2ARYA 1ME3A 2P0RA 2DC8A 3MHSA 5CVNB 1PCIA 1NPZA 1GMYA 3H89A 3K9MA 4Q8HA 4CDFB 1AU2A 2DCDA 1PE6A 2DZYA 4N79A 3S3RA 4I04A 3OISA 2ATOA 3CH2X 1AYUA 3HWNA 4PI3A 1AIMA 1CB5A 4BS6A 2DJGB 1QXPA 1THEA 1QOLA 4W5BA 2XU1A 4MSXA 1VJVA 1EWOA 1VSNA 4YYWA 5K16A 5A24A 4AXLA 2B1MA 1GCBA 3TNXA 3USVA 1TLOA 1FH0A 1PPPA 2ACTA 4FJCA 1AU0A 1F2BA 1PBHA 2B1NA 2IPPB 3O1GA 5EF4A 4K7CA 1EWLA 2YJ8A 1AECA 4AXMA 1NB3A 4YYQA 1CQDA 1SNKA 1BP4A 2R9OA 1TU6A 2OP3A 3PW3A 3V6CA 2VHSA 4XUIA 4KLBA 4QRXA 1BGOA 2DCAA 4YYSA 1PXVA 2R9FA 3OF9A 4I07A 2P7UA 3OF8A 4P6EA 2G7YA 1YALA 1ATKA 3WXEA 3QT4A 3HHIA 3MTNA 3F75A 4BSQA 2JQGR 4N8WA 3WXGA 2C0YA 4QBBA 1EWPA 3BPFA 2OULA 4YYRA 2F1GA 2R6NA 4G54A 3P5XA 2OZ2A 2AIMA 3KWBX 2PADA 1MS6A 6PADA 2CIOA 2AYOA 4YV8A 3C9EA 9PAPA 2G8EA 4P6GA 2DJFB 3OVZA 1MDWA 5PADA 2DZZA 2XU4A 3QJ3A 2G8JA 3E1ZB 3F5VA 1NL6A 1CTEA 3I3TA 1STFE 2HH5A 3I06A 3KW9A 4MZOA 2AUZA 2YJ9A 2PREA 4CZWA 2HHNA 2BDLA 3WXFA 1YT7A 4HWYA 1M6DA 3P5VA 4CDCB 1K3BB 4PADA 4W4UA 2P86A 1MHWA 3BCNA 2DC7A
chains in the Genus database with same CATH superfamily
1QMYA 1Q6KA 3PHUA 4X6IA 1PIPA 4ZUXU 3TMPA 4PP1A 1QDQA 3IV2A 3D6SA 1PPOA 2FRAA 2FRQA 2JRIA 4OVZA 3P5WA 1NB5A 5E6JA 1GLOA 4W5CA 4PT5A 2DCCA 2YJCA 1U9QX 1BQIA 5JA7A 3OVXA 2XU5A 4R3DA 3KKUA 2R9MA 1CSBB 1YZBA 1SP4B 2FO5A 1AU3A 4BS5A 2BDZA 1Y4HA 3GCBA 4A5UA 3N3GA 1PADA 2E00A 4DMXA 4WURA 1AU4A 4X6HA 4M0WA 2HD5A 3CH3X 4MZSA 3KWZA 2F7DA 3H8CA 3LFYA 1KHQA 2BTWB 3KFQA 2DC9A 1U5IA 1UKFA 4OELA 2AUXA 3PSEA 1PPNA 3PRMA 2AYNA 1NQCA 1KHPA 2CB5A 1EF7A 4OEMA 1POPA 5KO3A 4BOQA 4YYUA 1F2AA 4N4ZA 2UZJA 3KSEA 1XKGA 2WBFX 2AGAA 1KFXL 3BC3A 4BOUA 3CBKA 2G6DA 2JQFR 1BY8A 3LXSA 2AVWA 2E01A 2O6XA 2FT2A 1S4VA 2Y6EA 3H7DA 2BTWA 1NLJA 5CVMA 4RY2A 4PP2E 4XR7A 1CV8A 3OQCA 4Q8GA 3BPMA 2YJ2A 1AYVA 3KX1A 1MIRA 1CVZA 5J94A 3IHPA 3S3QA 4DMYA 2GHUA 1AYWA 3RVVA 5EGWA 2DC6A 4YVAA 2IBIA 3BWKA 3PBHA 1TL9A 1X9YA 3IMAA 4WA6A 4QRGA 1F29A 1Y08A 5CHVA 3CBJA 1PPDA 3PHWA 2PBHA 3H6SA 1CS8A 2FQ9A 5JH3A 1MEGA 1CJLA 2R9CA 5CVOB 2PNSA 3N3KA 3RVXA 2BU3A 4BQVA 2NQAA 2DCBA 4GUAA 3B21A 1DEUA 2H7JA 1ME4A 4REZA 1JQPA 4CDDB 4I05A 4CDEB 1ICFA 1U9XA 3MJ5A 3PT2A 8PCHA 3P5UA 4BOSA 4P16A 4BOPA 3HD3A 1O0EA 2Y5BA 3U8EA 3PDFA 1PVJA 4FK5A 3QSDA 4RKXA 4D8BA 1ITOA 5CHTA 4QH6A 5FPWA 4QRVA 1KXRA 2FYEA 2NQGA 1U9VA 3K8UA 1DKIA 1EWMA 3K24A 1ZCMA 2FUDA 2GFOA 1HUCB 4X6JA 2FTDA 3W30A 3O0UA 2AU1A 3B79A 1YVBA 1GECE 3N4CA 2VHFA 3AI8A 3RVWA 4ZTBA 4YYVA 1CPJA 3NHEA 7PCKA 5JZEA 3DF0A 1U9WA 1F2CA 2YJBA 3PHXA 2E03A 3ZUAA 4FIPA 3ERVA 2NQIA 4RF0A 1MEMA 3IEJA 2NQDB 4BPVA 4OVZB 5F02A 2J7QC 2E02A 1ZIVA 3IOQA 1IWDA 4RNAA 3BBAA 2HWKA 3M99A 3HHAA 2AS8A 1KFUL 3MORA 2XU3A 3IUTA 2Z84A 3H8BA 2J7QA 3BOWA 3MHHA 1DF0A 2R9NA 3PNRA 3V6EA 5EZSA 2HXZA 1A6RA 1YK7A 1YK8A 2ARYA 1ME3A 2P0RA 4IP3A 3E9SA 2DC8A 3IFUA 3MHSA 5CVNB 1PCIA 1NPZA 1GMYA 3H89A 3K9MA 3O65A 4D8EA 4Q8HA 4CDFB 1AU2A 2DCDA 1PE6A 2DZYA 4N79A 3S3RA 4I04A 3OISA 2ATOA 3CH2X 1AYUA 4RF1A 3BY4A 3ZNHA 3HWNA 4MI7A 4PI3A 1AIMA 1CB5A 4BS6A 2DJGB 1QXPA 1THEA 1QOLA 4W5BA 2XU1A 4D8IA 4MSXA 1VJVA 1EWOA 3MP2A 1VSNA 4XZXA 4YYWA 5K16A 5A24A 4AXLA 2B1MA 1GCBA 3TNXA 3USVA 1TLOA 2DOSA 1FH0A 1PPPA 2ACTA 4FJCA 1AU0A 1F2BA 1PBHA 2B1NA 2IPPB 3O1GA 5EF4A 4K7CA 1EWLA 2YJ8A 4HXDB 1AECA 4AXMA 1NB3A 4YYQA 1CQDA 1SNKA 1BP4A 2R9OA 1TU6A 2OP3A 3PW3A 3V6CA 2VHSA 4XUIA 4KLBA 4QRXA 1BGOA 2DCAA 4YYSA 3C0RA 1PXVA 2R9FA 4BOZA 3OF9A 4I07A 2P7UA 3OF8A 4P6EA 2G7YA 1YALA 1ATKA 3WXEA 4OW0A 3QT4A 3HHIA 3MTNA 3F75A 4BSQA 2JQGR 4N8WA 3WXGA 2C0YA 4QBBA 1EWPA 3BPFA 2OULA 3PRPA 4YYRA 2F1GA 2R6NA 3BB7A 4G54A 3P5XA 2OZ2A 2AIMA 3KWBX 2PADA 1MS6A 6PADA 2CIOA 2AYOA 3W31A 2FE8A 4YV8A 3C9EA 9PAPA 3RNVA 2JTCA 2G8EA 4P6GA 2DJFB 3OVZA 1MDWA 5PADA 2DZZA 2XU4A 5EZQA 3TRKA 3QJ3A 2G8JA 3E1ZB 3F5VA 1NL6A 1CTEA 3I3TA 1STFE 2HH5A 3I06A 3KW9A 4MZOA 2AUZA 2YJ9A 2PREA 4CZWA 2HHNA 2BDLA 3WXFA 4IUMA 1YT7A 4HWYA 1M6DA 3P5VA 4MM3B 3MTVA 4CDCB 1K3BB 4PADA 4W4UA 2P86A 1MHWA 3BCNA 2DC7A
chains in the Genus database with same CATH topology
1QMYA 1Q6KA 4NV7A 4X6IA 1PIPA 4ZUXU 4PP1A 1QDQA 3IV2A 3D6SA 1PPOA 2FRAA 2FRQA 1NB5A 3P5WA 4C5PA 1GLOA 4W5CA 2DCCA 2YJCA 1U9QX 1BQIA 5JA7A 3OVXA 2XU5A 3KKUA 2R9MA 1CSBB 1SP4B 4GUZA 2FO5A 1AU3A 4BS5A 2BDZA 1Y4HA 3GCBA 3N3GA 1PADA 2E00A 4DMXA 1AU4A 4X6HA 2HD5A 1W4TA 3CH3X 4MZSA 3KWZA 2F7DA 3H8CA 3LFYA 1KHQA 3KFQA 2DC9A 1U5IA 4OELA 2AUXA 1PPNA 2AYNA 1NQCA 1KHPA 2CB5A 1EF7A 4OEMA 1POPA 4YYUA 1F2AA 4N4ZA 3KSEA 1XKGA 2WBFX 1KFXL 3BC3A 3CBKA 2G6DA 2JQFR 1BY8A 3LXSA 2AVWA 2E01A 2O6XA 5CVMA 1S4VA 2FT2A 2Y6EA 3H7DA 1NLJA 4RY2A 4PP2E 4XR7A 1CV8A 4Q8GA 3BPMA 2YJ2A 1AYVA 3KX1A 1MIRA 1CVZA 5J94A 3IHPA 3S3QA 4DMYA 2GHUA 1E2TA 1AYWA 3RVVA 5EGWA 2DC6A 4YVAA 2IBIA 3BWKA 3PBHA 1TL9A 1X9YA 3IMAA 4WA6A 4QRGA 1F29A 1Y08A 5CHVA 3CBJA 1PPDA 4BGFA 2PBHA 3H6SA 1CS8A 2FQ9A 5JH3A 1MEGA 1CJLA 2R9CA 5CVOB 2PNSA 3N3KA 3RVXA 4BQVA 2NQAA 2DCBA 1DEUA 2H7JA 1ME4A 1JQPA 4CDDB 4I05A 4CDEB 1ICFA 1U9XA 8PCHA 3P5UA 3HD3A 1O0EA 2Y5BA 3U8EA 3PDFA 4FK5A 3QSDA 1ITOA 5CHTA 4QH6A 5FPWA 4QRVA 1KXRA 2FYEA 2NQGA 1U9VA 3K8UA 1EWMA 3K24A 1ZCMA 2FUDA 2GFOA 1HUCB 4X6JA 2FTDA 3O0UA 4B55A 2AU1A 3B79A 1YVBA 1GECE 3N4CA 2VHFA 3AI8A 3RVWA 4YYVA 2BSZA 1GX3A 1CPJA 3NHEA 7PCKA 3DF0A 1U9WA 1F2CA 2YJBA 3ZUAA 2E03A 4FIPA 3ERVA 2NQIA 1MEMA 3IEJA 2NQDB 4BPVA 1W5RA 4NV8A 5F02A 2VFCA 2E02A 1ZIVA 3IOQA 1IWDA 3HHAA 3M99A 2AS8A 1KFUL 3MORA 2XU3A 3IUTA 3H8BA 3BOWA 3MHHA 1DF0A 2R9NA 3PNRA 3V6EA 2HXZA 1A6RA 1YK7A 1YK8A 2ARYA 1ME3A 2P0RA 2DC8A 3MHSA 5CVNB 1PCIA 1NPZA 1GMYA 3H89A 3K9MA 4Q8HA 4CDFB 1AU2A 1W6FA 2DCDA 1PE6A 2DZYA 4N79A 3S3RA 4I04A 3OISA 2ATOA 3CH2X 1AYUA 3D9WA 3HWNA 4PI3A 1AIMA 1CB5A 4BS6A 2DJGB 1QXPA 1THEA 1QOLA 4W5BA 2XU1A 4MSXA 1VJVA 1EWOA 1VSNA 4YYWA 5K16A 5A24A 4AXLA 2B1MA 1GCBA 3TNXA 3USVA 1TLOA 1FH0A 1PPPA 2ACTA 4FJCA 1AU0A 1F2BA 1PBHA 2B1NA 2IPPB 3O1GA 5EF4A 4K7CA 1EWLA 2YJ8A 1AECA 4AXMA 1NB3A 4YYQA 1CQDA 1SNKA 1BP4A 2R9OA 1TU6A 2OP3A 3PW3A 3V6CA 2VHSA 4XUIA 4KLBA 4QRXA 1BGOA 2DCAA 4YYSA 1PXVA 2R9FA 3OF9A 4I07A 2P7UA 3OF8A 4P6EA 2G7YA 1YALA 1ATKA 3WXEA 3QT4A 3HHIA 3MTNA 3F75A 4BSQA 2JQGR 4N8WA 3WXGA 2C0YA 4QBBA 1EWPA 3BPFA 2OULA 4YYRA 2F1GA 2R6NA 4G54A 3P5XA 2OZ2A 2AIMA 3KWBX 2PADA 1MS6A 6PADA 2CIOA 2AYOA 4YV8A 3C9EA 9PAPA 2G8EA 4P6GA 2DJFB 3OVZA 1MDWA 5PADA 2DZZA 2XU4A 3QJ3A 2G8JA 3E1ZB 3F5VA 1NL6A 1CTEA 3I3TA 1STFE 2HH5A 3I06A 3KW9A 4MZOA 2AUZA 2VFBA 2YJ9A 2PREA 3LTWA 2HHNA 4CZWA 2BDLA 3WXFA 1YT7A 4HWYA 1M6DA 3P5VA 4CDCB 1K3BB 4PADA 4W4UA 2P86A 1MHWA 3BCNA 2DC7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QMY A;  1Q6K A;  4X6I A;  1PIP A;  4ZUX U;  4PP1 A;  1QDQ A;  3IV2 A;  3D6S A;  1PPO A;  2FRA A;  2FRQ A;  1NB5 A;  3P5W A;  1GLO A;  4W5C A;  2DCC A;  2YJC A;  1U9Q X;  1BQI A;  5JA7 A;  3OVX A;  2XU5 A;  3KKU A;  2R9M A;  1CSB B;  1SP4 B;  2FO5 A;  1AU3 A;  4BS5 A;  2BDZ A;  1Y4H A;  3GCB A;  3N3G A;  1PAD A;  2E00 A;  4DMX A;  1AU4 A;  4X6H A;  2HD5 A;  3CH3 X;  4MZS A;  3KWZ A;  2F7D A;  3H8C A;  3LFY A;  1KHQ A;  3KFQ A;  2DC9 A;  1U5I A;  4OEL A;  2AUX A;  1PPN A;  2AYN A;  1NQC A;  1KHP A;  2CB5 A;  1EF7 A;  4OEM A;  1POP A;  4YYU A;  1F2A A;  4N4Z A;  3KSE A;  1XKG A;  2WBF X;  1KFX L;  3BC3 A;  3CBK A;  2G6D A;  2JQF R;  1BY8 A;  3LXS A;  2AVW A;  2E01 A;  2O6X A;  5CVM A;  1S4V A;  2FT2 A;  2Y6E A;  3H7D A;  1NLJ A;  4RY2 A;  4PP2 E;  4XR7 A;  1CV8 A;  4Q8G A;  3BPM A;  2YJ2 A;  1AYV A;  3KX1 A;  1MIR A;  1CVZ A;  5J94 A;  3IHP A;  3S3Q A;  4DMY A;  2GHU A;  1AYW A;  3RVV A;  5EGW A;  2DC6 A;  4YVA A;  2IBI A;  3BWK A;  3PBH A;  1TL9 A;  1X9Y A;  3IMA A;  4WA6 A;  4QRG A;  1F29 A;  1Y08 A;  5CHV A;  3CBJ A;  1PPD A;  2PBH A;  3H6S A;  1CS8 A;  2FQ9 A;  5JH3 A;  1MEG A;  1CJL A;  2R9C A;  5CVO B;  2PNS A;  3N3K A;  3RVX A;  4BQV A;  2NQA A;  2DCB A;  1DEU A;  2H7J A;  1ME4 A;  1JQP A;  4CDD B;  4I05 A;  4CDE B;  1ICF A;  1U9X A;  8PCH A;  3P5U A;  3HD3 A;  1O0E A;  2Y5B A;  3U8E A;  3PDF A;  4FK5 A;  3QSD A;  1ITO A;  5CHT A;  4QH6 A;  5FPW A;  4QRV A;  1KXR A;  2FYE A;  2NQG A;  1U9V A;  3K8U A;  1EWM A;  3K24 A;  1ZCM A;  2FUD A;  2GFO A;  1HUC B;  4X6J A;  2FTD A;  3O0U A;  2AU1 A;  3B79 A;  1YVB A;  1GEC E;  3N4C A;  2VHF A;  3AI8 A;  3RVW A;  4YYV A;  1CPJ A;  3NHE A;  7PCK A;  3DF0 A;  1U9W A;  1F2C A;  2YJB A;  3ZUA A;  2E03 A;  4FIP A;  3ERV A;  2NQI A;  1MEM A;  3IEJ A;  2NQD B;  4BPV A;  5F02 A;  2E02 A;  1ZIV A;  3IOQ A;  1IWD A;  3HHA A;  3M99 A;  2AS8 A;  1KFU L;  3MOR A;  2XU3 A;  3IUT A;  3H8B A;  3BOW A;  3MHH A;  1DF0 A;  2R9N A;  3PNR A;  3V6E A;  2HXZ A;  1A6R A;  1YK7 A;  1YK8 A;  2ARY A;  1ME3 A;  2P0R A;  2DC8 A;  3MHS A;  5CVN B;  1PCI A;  1NPZ A;  1GMY A;  3H89 A;  3K9M A;  4Q8H A;  4CDF B;  1AU2 A;  2DCD A;  1PE6 A;  2DZY A;  4N79 A;  3S3R A;  4I04 A;  3OIS A;  2ATO A;  3CH2 X;  1AYU A;  3HWN A;  4PI3 A;  1AIM A;  1CB5 A;  4BS6 A;  2DJG B;  1QXP A;  1THE A;  1QOL A;  4W5B A;  2XU1 A;  4MSX A;  1VJV A;  1EWO A;  1VSN A;  4YYW A;  5K16 A;  5A24 A;  4AXL A;  2B1M A;  1GCB A;  3TNX A;  3USV A;  1TLO A;  1FH0 A;  1PPP A;  2ACT A;  4FJC A;  1AU0 A;  1F2B A;  1PBH A;  2B1N A;  2IPP B;  3O1G A;  5EF4 A;  4K7C A;  1EWL A;  2YJ8 A;  1AEC A;  4AXM A;  1NB3 A;  4YYQ A;  1CQD A;  1SNK A;  1BP4 A;  2R9O A;  1TU6 A;  2OP3 A;  3PW3 A;  3V6C A;  2VHS A;  4XUI A;  4KLB A;  4QRX A;  1BGO A;  2DCA A;  4YYS A;  1PXV A;  2R9F A;  3OF9 A;  4I07 A;  2P7U A;  3OF8 A;  4P6E A;  2G7Y A;  1YAL A;  1ATK A;  3WXE A;  3QT4 A;  3HHI A;  3MTN A;  3F75 A;  4BSQ A;  2JQG R;  4N8W A;  3WXG A;  2C0Y A;  4QBB A;  1EWP A;  3BPF A;  2OUL A;  4YYR A;  2F1G A;  2R6N A;  4G54 A;  3P5X A;  2OZ2 A;  2AIM A;  3KWB X;  2PAD A;  1MS6 A;  6PAD A;  2CIO A;  2AYO A;  4YV8 A;  3C9E A;  9PAP A;  2G8E A;  4P6G A;  2DJF B;  3OVZ A;  1MDW A;  5PAD A;  2DZZ A;  2XU4 A;  3QJ3 A;  2G8J A;  3E1Z B;  3F5V A;  1NL6 A;  1CTE A;  3I3T A;  1STF E;  2HH5 A;  3I06 A;  3KW9 A;  4MZO A;  2AUZ A;  2YJ9 A;  2PRE A;  4CZW A;  2HHN A;  2BDL A;  3WXF A;  1YT7 A;  4HWY A;  1M6D A;  3P5V A;  4CDC B;  1K3B B;  4PAD A;  4W4U A;  2P86 A;  1MHW A;  3BCN A;  2DC7 A; 
#chains in the Genus database with same CATH topology
 1QMY A;  1Q6K A;  3PHU A;  4X6I A;  1PIP A;  4ZUX U;  3TMP A;  4PP1 A;  1QDQ A;  3IV2 A;  3D6S A;  1PPO A;  2FRA A;  2FRQ A;  2JRI A;  4OVZ A;  3P5W A;  1NB5 A;  5E6J A;  1GLO A;  4W5C A;  4PT5 A;  2DCC A;  2YJC A;  1U9Q X;  1BQI A;  5JA7 A;  3OVX A;  2XU5 A;  4R3D A;  3KKU A;  2R9M A;  1CSB B;  1YZB A;  1SP4 B;  2FO5 A;  1AU3 A;  4BS5 A;  2BDZ A;  1Y4H A;  3GCB A;  4A5U A;  3N3G A;  1PAD A;  2E00 A;  4DMX A;  4WUR A;  1AU4 A;  4X6H A;  4M0W A;  2HD5 A;  3CH3 X;  4MZS A;  3KWZ A;  2F7D A;  3H8C A;  3LFY A;  1KHQ A;  2BTW B;  3KFQ A;  2DC9 A;  1U5I A;  1UKF A;  4OEL A;  2AUX A;  3PSE A;  1PPN A;  3PRM A;  2AYN A;  1NQC A;  1KHP A;  2CB5 A;  1EF7 A;  4OEM A;  1POP A;  5KO3 A;  4BOQ A;  4YYU A;  1F2A A;  4N4Z A;  2UZJ A;  3KSE A;  1XKG A;  2WBF X;  2AGA A;  1KFX L;  3BC3 A;  4BOU A;  3CBK A;  2G6D A;  2JQF R;  1BY8 A;  3LXS A;  2AVW A;  2E01 A;  2O6X A;  2FT2 A;  1S4V A;  2Y6E A;  3H7D A;  2BTW A;  1NLJ A;  5CVM A;  4RY2 A;  4PP2 E;  4XR7 A;  1CV8 A;  3OQC A;  4Q8G A;  3BPM A;  2YJ2 A;  1AYV A;  3KX1 A;  1MIR A;  1CVZ A;  5J94 A;  3IHP A;  3S3Q A;  4DMY A;  2GHU A;  1AYW A;  3RVV A;  5EGW A;  2DC6 A;  4YVA A;  2IBI A;  3BWK A;  3PBH A;  1TL9 A;  1X9Y A;  3IMA A;  4WA6 A;  4QRG A;  1F29 A;  1Y08 A;  5CHV A;  3CBJ A;  1PPD A;  3PHW A;  2PBH A;  3H6S A;  1CS8 A;  2FQ9 A;  5JH3 A;  1MEG A;  1CJL A;  2R9C A;  5CVO B;  2PNS A;  3N3K A;  3RVX A;  2BU3 A;  4BQV A;  2NQA A;  2DCB A;  4GUA A;  3B21 A;  1DEU A;  2H7J A;  1ME4 A;  4REZ A;  1JQP A;  4CDD B;  4I05 A;  4CDE B;  1ICF A;  1U9X A;  3MJ5 A;  3PT2 A;  8PCH A;  3P5U A;  4BOS A;  4P16 A;  4BOP A;  3HD3 A;  1O0E A;  2Y5B A;  3U8E A;  3PDF A;  1PVJ A;  4FK5 A;  3QSD A;  4RKX A;  4D8B A;  1ITO A;  5CHT A;  4QH6 A;  5FPW A;  4QRV A;  1KXR A;  2FYE A;  2NQG A;  1U9V A;  3K8U A;  1DKI A;  1EWM A;  3K24 A;  1ZCM A;  2FUD A;  2GFO A;  1HUC B;  4X6J A;  2FTD A;  3W30 A;  3O0U A;  2AU1 A;  3B79 A;  1YVB A;  1GEC E;  3N4C A;  2VHF A;  3AI8 A;  3RVW A;  4ZTB A;  4YYV A;  1CPJ A;  3NHE A;  7PCK A;  5JZE A;  3DF0 A;  1U9W A;  1F2C A;  2YJB A;  3PHX A;  2E03 A;  3ZUA A;  4FIP A;  3ERV A;  2NQI A;  4RF0 A;  1MEM A;  3IEJ A;  2NQD B;  4BPV A;  4OVZ B;  5F02 A;  2J7Q C;  2E02 A;  1ZIV A;  3IOQ A;  1IWD A;  4RNA A;  3BBA A;  2HWK A;  3M99 A;  3HHA A;  2AS8 A;  1KFU L;  3MOR A;  2XU3 A;  3IUT A;  2Z84 A;  3H8B A;  2J7Q A;  3BOW A;  3MHH A;  1DF0 A;  2R9N A;  3PNR A;  3V6E A;  5EZS A;  2HXZ A;  1A6R A;  1YK7 A;  1YK8 A;  2ARY A;  1ME3 A;  2P0R A;  4IP3 A;  3E9S A;  2DC8 A;  3IFU A;  3MHS A;  5CVN B;  1PCI A;  1NPZ A;  1GMY A;  3H89 A;  3K9M A;  3O65 A;  4D8E A;  4Q8H A;  4CDF B;  1AU2 A;  2DCD A;  1PE6 A;  2DZY A;  4N79 A;  3S3R A;  4I04 A;  3OIS A;  2ATO A;  3CH2 X;  1AYU A;  4RF1 A;  3BY4 A;  3ZNH A;  3HWN A;  4MI7 A;  4PI3 A;  1AIM A;  1CB5 A;  4BS6 A;  2DJG B;  1QXP A;  1THE A;  1QOL A;  4W5B A;  2XU1 A;  4D8I A;  4MSX A;  1VJV A;  1EWO A;  3MP2 A;  1VSN A;  4XZX A;  4YYW A;  5K16 A;  5A24 A;  4AXL A;  2B1M A;  1GCB A;  3TNX A;  3USV A;  1TLO A;  2DOS A;  1FH0 A;  1PPP A;  2ACT A;  4FJC A;  1AU0 A;  1F2B A;  1PBH A;  2B1N A;  2IPP B;  3O1G A;  5EF4 A;  4K7C A;  1EWL A;  2YJ8 A;  4HXD B;  1AEC A;  4AXM A;  1NB3 A;  4YYQ A;  1CQD A;  1SNK A;  1BP4 A;  2R9O A;  1TU6 A;  2OP3 A;  3PW3 A;  3V6C A;  2VHS A;  4XUI A;  4KLB A;  4QRX A;  1BGO A;  2DCA A;  4YYS A;  3C0R A;  1PXV A;  2R9F A;  4BOZ A;  3OF9 A;  4I07 A;  2P7U A;  3OF8 A;  4P6E A;  2G7Y A;  1YAL A;  1ATK A;  3WXE A;  4OW0 A;  3QT4 A;  3HHI A;  3MTN A;  3F75 A;  4BSQ A;  2JQG R;  4N8W A;  3WXG A;  2C0Y A;  4QBB A;  1EWP A;  3BPF A;  2OUL A;  3PRP A;  4YYR A;  2F1G A;  2R6N A;  3BB7 A;  4G54 A;  3P5X A;  2OZ2 A;  2AIM A;  3KWB X;  2PAD A;  1MS6 A;  6PAD A;  2CIO A;  2AYO A;  3W31 A;  2FE8 A;  4YV8 A;  3C9E A;  9PAP A;  3RNV A;  2JTC A;  2G8E A;  4P6G A;  2DJF B;  3OVZ A;  1MDW A;  5PAD A;  2DZZ A;  2XU4 A;  5EZQ A;  3TRK A;  3QJ3 A;  2G8J A;  3E1Z B;  3F5V A;  1NL6 A;  1CTE A;  3I3T A;  1STF E;  2HH5 A;  3I06 A;  3KW9 A;  4MZO A;  2AUZ A;  2YJ9 A;  2PRE A;  4CZW A;  2HHN A;  2BDL A;  3WXF A;  4IUM A;  1YT7 A;  4HWY A;  1M6D A;  3P5V A;  4MM3 B;  3MTV A;  4CDC B;  1K3B B;  4PAD A;  4W4U A;  2P86 A;  1MHW A;  3BCN A;  2DC7 A; 
#chains in the Genus database with same CATH homology
 1QMY A;  1Q6K A;  4NV7 A;  4X6I A;  1PIP A;  4ZUX U;  4PP1 A;  1QDQ A;  3IV2 A;  3D6S A;  1PPO A;  2FRA A;  2FRQ A;  1NB5 A;  3P5W A;  4C5P A;  1GLO A;  4W5C A;  2DCC A;  2YJC A;  1U9Q X;  1BQI A;  5JA7 A;  3OVX A;  2XU5 A;  3KKU A;  2R9M A;  1CSB B;  1SP4 B;  4GUZ A;  2FO5 A;  1AU3 A;  4BS5 A;  2BDZ A;  1Y4H A;  3GCB A;  3N3G A;  1PAD A;  2E00 A;  4DMX A;  1AU4 A;  4X6H A;  2HD5 A;  1W4T A;  3CH3 X;  4MZS A;  3KWZ A;  2F7D A;  3H8C A;  3LFY A;  1KHQ A;  3KFQ A;  2DC9 A;  1U5I A;  4OEL A;  2AUX A;  1PPN A;  2AYN A;  1NQC A;  1KHP A;  2CB5 A;  1EF7 A;  4OEM A;  1POP A;  4YYU A;  1F2A A;  4N4Z A;  3KSE A;  1XKG A;  2WBF X;  1KFX L;  3BC3 A;  3CBK A;  2G6D A;  2JQF R;  1BY8 A;  3LXS A;  2AVW A;  2E01 A;  2O6X A;  5CVM A;  1S4V A;  2FT2 A;  2Y6E A;  3H7D A;  1NLJ A;  4RY2 A;  4PP2 E;  4XR7 A;  1CV8 A;  4Q8G A;  3BPM A;  2YJ2 A;  1AYV A;  3KX1 A;  1MIR A;  1CVZ A;  5J94 A;  3IHP A;  3S3Q A;  4DMY A;  2GHU A;  1E2T A;  1AYW A;  3RVV A;  5EGW A;  2DC6 A;  4YVA A;  2IBI A;  3BWK A;  3PBH A;  1TL9 A;  1X9Y A;  3IMA A;  4WA6 A;  4QRG A;  1F29 A;  1Y08 A;  5CHV A;  3CBJ A;  1PPD A;  4BGF A;  2PBH A;  3H6S A;  1CS8 A;  2FQ9 A;  5JH3 A;  1MEG A;  1CJL A;  2R9C A;  5CVO B;  2PNS A;  3N3K A;  3RVX A;  4BQV A;  2NQA A;  2DCB A;  1DEU A;  2H7J A;  1ME4 A;  1JQP A;  4CDD B;  4I05 A;  4CDE B;  1ICF A;  1U9X A;  8PCH A;  3P5U A;  3HD3 A;  1O0E A;  2Y5B A;  3U8E A;  3PDF A;  4FK5 A;  3QSD A;  1ITO A;  5CHT A;  4QH6 A;  5FPW A;  4QRV A;  1KXR A;  2FYE A;  2NQG A;  1U9V A;  3K8U A;  1EWM A;  3K24 A;  1ZCM A;  2FUD A;  2GFO A;  1HUC B;  4X6J A;  2FTD A;  3O0U A;  4B55 A;  2AU1 A;  3B79 A;  1YVB A;  1GEC E;  3N4C A;  2VHF A;  3AI8 A;  3RVW A;  4YYV A;  2BSZ A;  1GX3 A;  1CPJ A;  3NHE A;  7PCK A;  3DF0 A;  1U9W A;  1F2C A;  2YJB A;  3ZUA A;  2E03 A;  4FIP A;  3ERV A;  2NQI A;  1MEM A;  3IEJ A;  2NQD B;  4BPV A;  1W5R A;  4NV8 A;  5F02 A;  2VFC A;  2E02 A;  1ZIV A;  3IOQ A;  1IWD A;  3HHA A;  3M99 A;  2AS8 A;  1KFU L;  3MOR A;  2XU3 A;  3IUT A;  3H8B A;  3BOW A;  3MHH A;  1DF0 A;  2R9N A;  3PNR A;  3V6E A;  2HXZ A;  1A6R A;  1YK7 A;  1YK8 A;  2ARY A;  1ME3 A;  2P0R A;  2DC8 A;  3MHS A;  5CVN B;  1PCI A;  1NPZ A;  1GMY A;  3H89 A;  3K9M A;  4Q8H A;  4CDF B;  1AU2 A;  1W6F A;  2DCD A;  1PE6 A;  2DZY A;  4N79 A;  3S3R A;  4I04 A;  3OIS A;  2ATO A;  3CH2 X;  1AYU A;  3D9W A;  3HWN A;  4PI3 A;  1AIM A;  1CB5 A;  4BS6 A;  2DJG B;  1QXP A;  1THE A;  1QOL A;  4W5B A;  2XU1 A;  4MSX A;  1VJV A;  1EWO A;  1VSN A;  4YYW A;  5K16 A;  5A24 A;  4AXL A;  2B1M A;  1GCB A;  3TNX A;  3USV A;  1TLO A;  1FH0 A;  1PPP A;  2ACT A;  4FJC A;  1AU0 A;  1F2B A;  1PBH A;  2B1N A;  2IPP B;  3O1G A;  5EF4 A;  4K7C A;  1EWL A;  2YJ8 A;  1AEC A;  4AXM A;  1NB3 A;  4YYQ A;  1CQD A;  1SNK A;  1BP4 A;  2R9O A;  1TU6 A;  2OP3 A;  3PW3 A;  3V6C A;  2VHS A;  4XUI A;  4KLB A;  4QRX A;  1BGO A;  2DCA A;  4YYS A;  1PXV A;  2R9F A;  3OF9 A;  4I07 A;  2P7U A;  3OF8 A;  4P6E A;  2G7Y A;  1YAL A;  1ATK A;  3WXE A;  3QT4 A;  3HHI A;  3MTN A;  3F75 A;  4BSQ A;  2JQG R;  4N8W A;  3WXG A;  2C0Y A;  4QBB A;  1EWP A;  3BPF A;  2OUL A;  4YYR A;  2F1G A;  2R6N A;  4G54 A;  3P5X A;  2OZ2 A;  2AIM A;  3KWB X;  2PAD A;  1MS6 A;  6PAD A;  2CIO A;  2AYO A;  4YV8 A;  3C9E A;  9PAP A;  2G8E A;  4P6G A;  2DJF B;  3OVZ A;  1MDW A;  5PAD A;  2DZZ A;  2XU4 A;  3QJ3 A;  2G8J A;  3E1Z B;  3F5V A;  1NL6 A;  1CTE A;  3I3T A;  1STF E;  2HH5 A;  3I06 A;  3KW9 A;  4MZO A;  2AUZ A;  2VFB A;  2YJ9 A;  2PRE A;  3LTW A;  2HHN A;  4CZW A;  2BDL A;  3WXF A;  1YT7 A;  4HWY A;  1M6D A;  3P5V A;  4CDC B;  1K3B B;  4PAD A;  4W4U A;  2P86 A;  1MHW A;  3BCN A;  2DC7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...