1AIMA

Cruzain inhibited by benzoyl-tyrosine-alanine-fluoromethylketone
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
215
structure length
215
Chain Sequence
b'APAAVDWRARGAVTAVKDQGQCGSCWAFSAIGNVECQWFLAGHPLTNLSEQMLVSCDKTDSGCSGGLMNNAFEWIVQENNGAVYTEDSYPYASGEGISPPCTTSGHTVGATITGHVELPQDEAQIAAWLAVNGPVAVAVDASSWMTYTGGVMTSCVSEALDHGVLLVGYNDSAAVPYWIIKNSWTTQWGEEGYIRIAKGSNQCLVKEEASSAVVG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CRUZAIN
publication title Structural determinants of specificity in the cysteine protease cruzain.
pubmed rcsb
source organism Trypanosoma cruzi
molecule tags Hydrolase/hydrolase inhibitor
total genus 62
structure length 215
sequence length 215
ec nomenclature ec 3.4.22.51: Cruzipain.
pdb deposition date 1997-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1aimA00
1ME4A 3IOQA 3BCNA 2DJGB 3S3RA 3U8EA 3BOWA 1STFE 4X6HA 3WXGA 5F02A 1EWMA 2DC8A 7PCKA 3F5VA 2BDLA 1AU4A 1Y4HA 3DF0A 1ZIVA 1NPZA 1Q6KA 3RVXA 1GECE 4MZSA 3WXFA 4P6GA 4CDDB 1DEUA 1F2CA 3ZUAA 4I04A 3HWNA 4FJCA 3OF8A 2AS8A 4YYVA 1MIRA 4BQVA 4BS5A 2E01A 3K8UA 2VHSA 3KFQA 1ME3A 1DF0A 1CJLA 2ATOA 2AVWA 1GLOA 4WA6A 4Q8GA 3OISA 3KSEA 2ACTA 1NL6A 4PP2E 3OF9A 2AYOA 2FTDA 1AYVA 1MEMA 1CS8A 3F75A 5CVNB 1PADA 4YV8A 3PDFA 6PADA 4PADA 2YJCA 3KWZA 1PXVA 4CDEB 2B1NA 1KHPA 1CTEA 1A6RA 2AUZA 1YVBA 4DMYA 3H8BA 2FO5A 3USVA 1TU6A 4I07A 1EF7A 2YJ2A 3WXEA 3I06A 3P5UA 1PPOA 3E1ZB 3C9EA 3H6SA 4YYUA 3IHPA 1BY8A 4W5BA 2NQGA 2YJ8A 2DJFB 5FPWA 2C0YA 3OVZA 4G54A 1CVZA 4DMXA 2HH5A 3CBJA 3D6SA 2XU3A 3QT4A 1PPNA 4QRVA 3CBKA 1NLJA 4N8WA 3O1GA 2OZ2A 1PCIA 3AI8A 2CB5A 2E00A 1MDWA 5EF4A 1QXPA 1YT7A 3P5WA 4QH6A 3H89A 1ICFA 2VHFA 3QSDA 4FIPA 2FT2A 3V6CA 3LFYA 2XU5A 4BSQA 1YALA 4YVAA 4YYWA 2HHNA 3CH2X 5PADA 1F29A 1BGOA 1CQDA 5J94A 2G8EA 2PNSA 4I05A 4ZUXU 2XU4A 1GCBA 3I3TA 3HHAA 3KX1A 3PW3A 4YYSA 1U9XA 2Y6EA 4CDFB 2F1GA 1QMYA 1NB5A 3IMAA 3IUTA 2FYEA 4OEMA 4FK5A 4MZOA 3BC3A 4QRGA 2GFOA 3M99A 3MTNA 3BPFA 1MS6A 1F2BA 4MSXA 2FUDA 1X9YA 2Y5BA 4PI3A 4X6IA 5JH3A 2DZZA 4KLBA 1U9VA 1MEGA 2XU1A 2P86A 1CPJA 1F2AA 1KFUL 1PIPA 2AU1A 1CB5A 1QDQA 1AIMA 2AIMA 1VJVA 4XUIA 4XR7A 3BWKA 2H7JA 2YJBA 1AYWA 3KKUA 1PBHA 2IBIA 1GMYA 4X6JA 1KFXL 1QOLA 1FH0A 1U9QX 3KW9A 2WBFX 3IV2A 5CVMA 2AYNA 4CZWA 2O6XA 2OULA 1POPA 4AXMA 1SP4B 2DC9A 3P5XA 4YYRA 1AU0A 3LXSA 4W4UA 2B1MA 1U5IA 1EWLA 1MHWA 3MHHA 4QRXA 1IWDA 2JQFR 3B79A 1ATKA 3ERVA 4W5CA 5CVOB 4OELA 2DCCA 2R6NA 1K3BB 1ITOA 2AUXA 2R9MA 1AYUA 2PBHA 2PREA 1CV8A 1KHQA 4BPVA 3N4CA 2R9NA 4BS6A 5A24A 1VSNA 2G8JA 3PNRA 2HXZA 3GCBA 3HHIA 2F7DA 1CSBB 3NHEA 4P6EA 1Y08A 5EGWA 2HD5A 5CHTA 5CHVA 3MORA 1XKGA 2DZYA 2DCBA 3CH3X 2YJ9A 3P5VA 1O0EA 1THEA 2FQ9A 2GHUA 1JQPA 1AU2A 3RVVA 2FRQA 4N79A 1PE6A 3KWBX 2OP3A 3BPMA 1EWOA 3PBHA 2G6DA 9PAPA 3O0UA 1PPPA 5K16A 2E03A 2P0RA 4RY2A 2DCAA 3TNXA 5JA7A 3K24A 2CIOA 4AXLA 2G7YA 4N4ZA 1ZCMA 3N3KA 3N3GA 2JQGR 3H8CA 1KXRA 2IPPB 1HUCB 1YK8A 3HD3A 4K7CA 3OVXA 1NQCA 2E02A 8PCHA 1BP4A 1U9WA 2DC6A 1YK7A 3RVWA 1AECA 2FRAA 2NQDB 3K9MA 3H7DA 3MHSA 2R9OA 1SNKA 1TLOA 2DC7A 1BQIA 2DCDA 1EWPA 3QJ3A 1S4VA 4CDCB 1M6DA 4Q8HA 1PPDA 2PADA 2P7UA 4PP1A 2BDZA 1TL9A 4QBBA 3V6EA 1AU3A 2NQAA 2NQIA 1NB3A 4HWYA 2ARYA 3S3QA 2R9CA 2R9FA 4YYQA 3IEJA
chains in the Genus database with same CATH superfamily
1ME4A 3IOQA 4PT5A 3BCNA 2DJGB 3S3RA 3U8EA 3BOWA 1STFE 4X6HA 3WXGA 5F02A 1EWMA 2DC8A 7PCKA 3F5VA 2BDLA 1AU4A 1Y4HA 4BOZA 3DF0A 1ZIVA 1NPZA 1Q6KA 3RVXA 1GECE 4MZSA 3WXFA 4BOUA 4P6GA 4CDDB 1DEUA 1F2CA 3ZUAA 4I04A 3MTVA 3HWNA 4FJCA 3OF8A 2AS8A 4YYVA 1MIRA 4BQVA 4BS5A 2E01A 3K8UA 2VHSA 2J7QA 3KFQA 1ME3A 1DF0A 1CJLA 2ATOA 2AVWA 1GLOA 4WA6A 2BTWA 4IUMA 4Q8GA 3OISA 4OW0A 3KSEA 2ACTA 1NL6A 4PP2E 3PHWA 1DKIA 3OF9A 4M0WA 2AYOA 2FTDA 4A5UA 1AYVA 1MEMA 1CS8A 3F75A 5CVNB 1PADA 4YV8A 3PDFA 3PRMA 6PADA 4PADA 2YJCA 3KWZA 1PXVA 4CDEB 2B1NA 1KHPA 1CTEA 1A6RA 2AUZA 1YVBA 4DMYA 3H8BA 3OQCA 5JZEA 4D8EA 2FO5A 3USVA 1TU6A 4BOQA 4I07A 4BOSA 1EF7A 2YJ2A 3WXEA 3I06A 2JTCA 3P5UA 1PPOA 3E1ZB 3C9EA 3PSEA 3H6SA 4YYUA 3IHPA 1BY8A 2BU3A 2NQGA 4W5BA 2YJ8A 2DJFB 5FPWA 2C0YA 3OVZA 4G54A 1CVZA 4DMXA 2HH5A 3CBJA 3D6SA 2XU3A 3QT4A 1PPNA 4QRVA 4P16A 3CBKA 1NLJA 4N8WA 3O1GA 2OZ2A 1PCIA 3AI8A 2CB5A 2E00A 1MDWA 3PT2A 5EF4A 1QXPA 1YT7A 3O65A 3P5WA 4QH6A 4GUAA 3H89A 2JRIA 1ICFA 2VHFA 3QSDA 4FIPA 2FT2A 3V6CA 3LFYA 2XU5A 4BSQA 1YALA 4YVAA 4YYWA 2HHNA 3CH2X 4RF1A 3BBAA 5PADA 1F29A 3C0RA 3E9SA 1BGOA 1CQDA 5J94A 2G8EA 2PNSA 4I05A 1PVJA 5EZSA 4ZUXU 2XU4A 1GCBA 3I3TA 3HHAA 3KX1A 3PW3A 4YYSA 1U9XA 2FE8A 2Y6EA 4CDFB 2F1GA 1QMYA 4RNAA 1NB5A 3IMAA 5KO3A 3IUTA 2FYEA 4REZA 2DOSA 3PHXA 4FK5A 4OEMA 4MZOA 4MI7A 3BC3A 4QRGA 2GFOA 3M99A 3MTNA 3BPFA 1MS6A 1F2BA 4MSXA 2FUDA 1X9YA 2Y5BA 4PI3A 4X6IA 4BOPA 5JH3A 2DZZA 4KLBA 1U9VA 1MEGA 2XU1A 2BTWB 2P86A 3MP2A 1CPJA 1F2AA 1KFUL 1PIPA 2AU1A 1CB5A 1QDQA 1AIMA 2AIMA 1VJVA 4XUIA 4XR7A 3BWKA 2H7JA 2YJBA 4OVZA 5EZQA 3RNVA 1AYWA 3KKUA 1PBHA 2IBIA 1GMYA 4D8BA 4X6JA 1KFXL 1QOLA 4D8IA 1FH0A 1U9QX 3KW9A 2WBFX 3IV2A 5CVMA 4IP3A 2AYNA 4CZWA 2O6XA 4XZXA 2OULA 1POPA 4AXMA 1SP4B 2DC9A 3P5XA 4YYRA 1AU0A 3LXSA 4W4UA 2B1MA 2AGAA 1U5IA 1EWLA 1MHWA 3MHHA 4QRXA 1IWDA 2JQFR 3B79A 4ZTBA 1ATKA 3ERVA 2J7QC 4W5CA 5CVOB 4OELA 2DCCA 2R6NA 2Z84A 3IFUA 1K3BB 1ITOA 2AUXA 2R9MA 1AYUA 2PBHA 3TMPA 2PREA 1CV8A 1KHQA 4RF0A 3W30A 4BPVA 3N4CA 2R9NA 4BS6A 5A24A 1VSNA 2G8JA 3PNRA 2HXZA 3GCBA 3HHIA 2F7DA 1CSBB 3NHEA 4P6EA 1UKFA 1Y08A 5EGWA 2HD5A 5CHTA 5CHVA 3MORA 1XKGA 2DZYA 2DCBA 3CH3X 2YJ9A 3P5VA 3ZNHA 1O0EA 1THEA 2FQ9A 2GHUA 4RKXA 1JQPA 1AU2A 3RVVA 2FRQA 4N79A 1PE6A 3KWBX 2OP3A 3BPMA 1EWOA 3PBHA 2G6DA 9PAPA 3BY4A 3O0UA 1PPPA 5E6JA 3PRPA 5K16A 2E03A 2P0RA 4RY2A 2DCAA 3TNXA 5JA7A 3K24A 2CIOA 4AXLA 2G7YA 3BB7A 4N4ZA 1ZCMA 3N3KA 3N3GA 2JQGR 3H8CA 1KXRA 2UZJA 2IPPB 1HUCB 2HWKA 1YK8A 4HXDB 3W31A 3HD3A 4K7CA 3OVXA 1NQCA 2E02A 8PCHA 1BP4A 1U9WA 2DC6A 1YK7A 3RVWA 1AECA 2FRAA 2NQDB 4R3DA 3K9MA 3H7DA 3MHSA 2R9OA 3B21A 1SNKA 4OVZB 1TLOA 2DC7A 1BQIA 2DCDA 1YZBA 1EWPA 3QJ3A 4MM3B 1S4VA 4CDCB 1M6DA 3TRKA 4Q8HA 1PPDA 2PADA 2P7UA 4PP1A 2BDZA 1TL9A 4QBBA 3V6EA 1AU3A 2NQAA 2NQIA 1NB3A 4HWYA 4WURA 2ARYA 3PHUA 3S3QA 2R9CA 2R9FA 3MJ5A 4YYQA 3IEJA
chains in the Genus database with same CATH topology
1ME4A 4BGFA 3IOQA 3BCNA 2DJGB 3S3RA 3U8EA 3BOWA 1STFE 4X6HA 3WXGA 5F02A 1EWMA 2DC8A 7PCKA 3F5VA 2BDLA 1AU4A 1Y4HA 3DF0A 1ZIVA 1NPZA 1Q6KA 3RVXA 1GECE 4MZSA 3WXFA 4P6GA 4CDDB 1DEUA 1F2CA 3ZUAA 4I04A 3HWNA 4FJCA 3OF8A 2AS8A 4YYVA 1MIRA 4BQVA 4BS5A 2E01A 3K8UA 2VHSA 3KFQA 1ME3A 1DF0A 1CJLA 2ATOA 2AVWA 1GLOA 4WA6A 4Q8GA 3OISA 3KSEA 2ACTA 1NL6A 4PP2E 3OF9A 2AYOA 2FTDA 1AYVA 1MEMA 1CS8A 3F75A 5CVNB 1PADA 4YV8A 3PDFA 6PADA 4PADA 2YJCA 3KWZA 1PXVA 4CDEB 2B1NA 1KHPA 1CTEA 1A6RA 2AUZA 1YVBA 4DMYA 3H8BA 2FO5A 3USVA 1TU6A 4I07A 1EF7A 2YJ2A 3WXEA 3I06A 3P5UA 1PPOA 3E1ZB 2VFBA 3C9EA 3H6SA 4YYUA 3IHPA 1BY8A 4W5BA 2NQGA 2YJ8A 2DJFB 5FPWA 2C0YA 3OVZA 4G54A 1CVZA 4DMXA 2HH5A 3CBJA 3D6SA 2XU3A 3QT4A 4B55A 1PPNA 4QRVA 4NV7A 3CBKA 1NLJA 4N8WA 3O1GA 2OZ2A 1PCIA 3AI8A 2CB5A 2E00A 1MDWA 5EF4A 1QXPA 1YT7A 3P5WA 4QH6A 3H89A 1ICFA 2VHFA 3QSDA 4FIPA 2FT2A 3V6CA 3LFYA 2XU5A 4BSQA 1YALA 4YVAA 4YYWA 2HHNA 3CH2X 5PADA 1F29A 1BGOA 1CQDA 5J94A 2G8EA 2PNSA 4I05A 4ZUXU 1W4TA 2XU4A 1GCBA 3I3TA 3HHAA 3KX1A 3PW3A 4YYSA 1U9XA 2Y6EA 4CDFB 2F1GA 1QMYA 1NB5A 3IMAA 3IUTA 2FYEA 1E2TA 4OEMA 4FK5A 4MZOA 3BC3A 4QRGA 2GFOA 3D9WA 3M99A 3MTNA 3BPFA 1MS6A 1F2BA 4MSXA 2FUDA 1X9YA 2Y5BA 4PI3A 4X6IA 5JH3A 4C5PA 2DZZA 4KLBA 1U9VA 1MEGA 2XU1A 2P86A 1CPJA 1F2AA 1KFUL 1PIPA 2AU1A 1CB5A 1QDQA 1AIMA 2AIMA 1VJVA 4XUIA 4XR7A 3BWKA 2H7JA 2YJBA 1AYWA 3KKUA 1PBHA 2IBIA 1GMYA 3LTWA 4X6JA 1KFXL 1W5RA 1QOLA 1FH0A 1U9QX 3KW9A 2WBFX 3IV2A 5CVMA 1W6FA 2AYNA 4CZWA 2O6XA 2OULA 1POPA 4AXMA 1SP4B 2DC9A 3P5XA 4YYRA 1AU0A 3LXSA 4W4UA 2B1MA 1U5IA 1EWLA 1GX3A 1MHWA 3MHHA 4QRXA 1IWDA 2JQFR 3B79A 1ATKA 3ERVA 4W5CA 5CVOB 4OELA 2DCCA 2R6NA 1K3BB 1ITOA 2AUXA 2R9MA 1AYUA 2PBHA 2PREA 1CV8A 1KHQA 4BPVA 3N4CA 2R9NA 4BS6A 5A24A 1VSNA 2G8JA 3PNRA 2HXZA 3GCBA 3HHIA 2F7DA 1CSBB 3NHEA 4P6EA 1Y08A 5EGWA 2HD5A 5CHTA 5CHVA 3MORA 1XKGA 2DZYA 2DCBA 3CH3X 2YJ9A 3P5VA 1O0EA 1THEA 2FQ9A 2GHUA 1JQPA 1AU2A 3RVVA 2FRQA 4N79A 1PE6A 3KWBX 2OP3A 3BPMA 1EWOA 3PBHA 2G6DA 9PAPA 3O0UA 1PPPA 5K16A 2E03A 2P0RA 4RY2A 2DCAA 3TNXA 5JA7A 3K24A 2CIOA 4AXLA 2G7YA 4N4ZA 1ZCMA 3N3KA 3N3GA 4NV8A 2JQGR 3H8CA 1KXRA 2IPPB 1HUCB 1YK8A 2VFCA 3HD3A 4K7CA 4GUZA 3OVXA 1NQCA 2E02A 8PCHA 1BP4A 1U9WA 2DC6A 1YK7A 3RVWA 1AECA 2BSZA 2FRAA 2NQDB 3K9MA 3H7DA 3MHSA 2R9OA 1SNKA 1TLOA 2DC7A 1BQIA 2DCDA 1EWPA 3QJ3A 1S4VA 4CDCB 1M6DA 4Q8HA 1PPDA 2PADA 2P7UA 4PP1A 2BDZA 1TL9A 4QBBA 3V6EA 1AU3A 2NQAA 2NQIA 1NB3A 4HWYA 2ARYA 3S3QA 2R9CA 2R9FA 4YYQA 3IEJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ME4 A;  3IOQ A;  3BCN A;  2DJG B;  3S3R A;  3U8E A;  3BOW A;  1STF E;  4X6H A;  3WXG A;  5F02 A;  1EWM A;  2DC8 A;  7PCK A;  3F5V A;  2BDL A;  1AU4 A;  1Y4H A;  3DF0 A;  1ZIV A;  1NPZ A;  1Q6K A;  3RVX A;  1GEC E;  4MZS A;  3WXF A;  4P6G A;  4CDD B;  1DEU A;  1F2C A;  3ZUA A;  4I04 A;  3HWN A;  4FJC A;  3OF8 A;  2AS8 A;  4YYV A;  1MIR A;  4BQV A;  4BS5 A;  2E01 A;  3K8U A;  2VHS A;  3KFQ A;  1ME3 A;  1DF0 A;  1CJL A;  2ATO A;  2AVW A;  1GLO A;  4WA6 A;  4Q8G A;  3OIS A;  3KSE A;  2ACT A;  1NL6 A;  4PP2 E;  3OF9 A;  2AYO A;  2FTD A;  1AYV A;  1MEM A;  1CS8 A;  3F75 A;  5CVN B;  1PAD A;  4YV8 A;  3PDF A;  6PAD A;  4PAD A;  2YJC A;  3KWZ A;  1PXV A;  4CDE B;  2B1N A;  1KHP A;  1CTE A;  1A6R A;  2AUZ A;  1YVB A;  4DMY A;  3H8B A;  2FO5 A;  3USV A;  1TU6 A;  4I07 A;  1EF7 A;  2YJ2 A;  3WXE A;  3I06 A;  3P5U A;  1PPO A;  3E1Z B;  3C9E A;  3H6S A;  4YYU A;  3IHP A;  1BY8 A;  4W5B A;  2NQG A;  2YJ8 A;  2DJF B;  5FPW A;  2C0Y A;  3OVZ A;  4G54 A;  1CVZ A;  4DMX A;  2HH5 A;  3CBJ A;  3D6S A;  2XU3 A;  3QT4 A;  1PPN A;  4QRV A;  3CBK A;  1NLJ A;  4N8W A;  3O1G A;  2OZ2 A;  1PCI A;  3AI8 A;  2CB5 A;  2E00 A;  1MDW A;  5EF4 A;  1QXP A;  1YT7 A;  3P5W A;  4QH6 A;  3H89 A;  1ICF A;  2VHF A;  3QSD A;  4FIP A;  2FT2 A;  3V6C A;  3LFY A;  2XU5 A;  4BSQ A;  1YAL A;  4YVA A;  4YYW A;  2HHN A;  3CH2 X;  5PAD A;  1F29 A;  1BGO A;  1CQD A;  5J94 A;  2G8E A;  2PNS A;  4I05 A;  4ZUX U;  2XU4 A;  1GCB A;  3I3T A;  3HHA A;  3KX1 A;  3PW3 A;  4YYS A;  1U9X A;  2Y6E A;  4CDF B;  2F1G A;  1QMY A;  1NB5 A;  3IMA A;  3IUT A;  2FYE A;  4OEM A;  4FK5 A;  4MZO A;  3BC3 A;  4QRG A;  2GFO A;  3M99 A;  3MTN A;  3BPF A;  1MS6 A;  1F2B A;  4MSX A;  2FUD A;  1X9Y A;  2Y5B A;  4PI3 A;  4X6I A;  5JH3 A;  2DZZ A;  4KLB A;  1U9V A;  1MEG A;  2XU1 A;  2P86 A;  1CPJ A;  1F2A A;  1KFU L;  1PIP A;  2AU1 A;  1CB5 A;  1QDQ A;  1AIM A;  2AIM A;  1VJV A;  4XUI A;  4XR7 A;  3BWK A;  2H7J A;  2YJB A;  1AYW A;  3KKU A;  1PBH A;  2IBI A;  1GMY A;  4X6J A;  1KFX L;  1QOL A;  1FH0 A;  1U9Q X;  3KW9 A;  2WBF X;  3IV2 A;  5CVM A;  2AYN A;  4CZW A;  2O6X A;  2OUL A;  1POP A;  4AXM A;  1SP4 B;  2DC9 A;  3P5X A;  4YYR A;  1AU0 A;  3LXS A;  4W4U A;  2B1M A;  1U5I A;  1EWL A;  1MHW A;  3MHH A;  4QRX A;  1IWD A;  2JQF R;  3B79 A;  1ATK A;  3ERV A;  4W5C A;  5CVO B;  4OEL A;  2DCC A;  2R6N A;  1K3B B;  1ITO A;  2AUX A;  2R9M A;  1AYU A;  2PBH A;  2PRE A;  1CV8 A;  1KHQ A;  4BPV A;  3N4C A;  2R9N A;  4BS6 A;  5A24 A;  1VSN A;  2G8J A;  3PNR A;  2HXZ A;  3GCB A;  3HHI A;  2F7D A;  1CSB B;  3NHE A;  4P6E A;  1Y08 A;  5EGW A;  2HD5 A;  5CHT A;  5CHV A;  3MOR A;  1XKG A;  2DZY A;  2DCB A;  3CH3 X;  2YJ9 A;  3P5V A;  1O0E A;  1THE A;  2FQ9 A;  2GHU A;  1JQP A;  1AU2 A;  3RVV A;  2FRQ A;  4N79 A;  1PE6 A;  3KWB X;  2OP3 A;  3BPM A;  1EWO A;  3PBH A;  2G6D A;  9PAP A;  3O0U A;  1PPP A;  5K16 A;  2E03 A;  2P0R A;  4RY2 A;  2DCA A;  3TNX A;  5JA7 A;  3K24 A;  2CIO A;  4AXL A;  2G7Y A;  4N4Z A;  1ZCM A;  3N3K A;  3N3G A;  2JQG R;  3H8C A;  1KXR A;  2IPP B;  1HUC B;  1YK8 A;  3HD3 A;  4K7C A;  3OVX A;  1NQC A;  2E02 A;  8PCH A;  1BP4 A;  1U9W A;  2DC6 A;  1YK7 A;  3RVW A;  1AEC A;  2FRA A;  2NQD B;  3K9M A;  3H7D A;  3MHS A;  2R9O A;  1SNK A;  1TLO A;  2DC7 A;  1BQI A;  2DCD A;  1EWP A;  3QJ3 A;  1S4V A;  4CDC B;  1M6D A;  4Q8H A;  1PPD A;  2PAD A;  2P7U A;  4PP1 A;  2BDZ A;  1TL9 A;  4QBB A;  3V6E A;  1AU3 A;  2NQA A;  2NQI A;  1NB3 A;  4HWY A;  2ARY A;  3S3Q A;  2R9C A;  2R9F A;  4YYQ A;  3IEJ A; 
#chains in the Genus database with same CATH topology
 1ME4 A;  3IOQ A;  4PT5 A;  3BCN A;  2DJG B;  3S3R A;  3U8E A;  3BOW A;  1STF E;  4X6H A;  3WXG A;  5F02 A;  1EWM A;  2DC8 A;  7PCK A;  3F5V A;  2BDL A;  1AU4 A;  1Y4H A;  4BOZ A;  3DF0 A;  1ZIV A;  1NPZ A;  1Q6K A;  3RVX A;  1GEC E;  4MZS A;  3WXF A;  4BOU A;  4P6G A;  4CDD B;  1DEU A;  1F2C A;  3ZUA A;  4I04 A;  3MTV A;  3HWN A;  4FJC A;  3OF8 A;  2AS8 A;  4YYV A;  1MIR A;  4BQV A;  4BS5 A;  2E01 A;  3K8U A;  2VHS A;  2J7Q A;  3KFQ A;  1ME3 A;  1DF0 A;  1CJL A;  2ATO A;  2AVW A;  1GLO A;  4WA6 A;  2BTW A;  4IUM A;  4Q8G A;  3OIS A;  4OW0 A;  3KSE A;  2ACT A;  1NL6 A;  4PP2 E;  3PHW A;  1DKI A;  3OF9 A;  4M0W A;  2AYO A;  2FTD A;  4A5U A;  1AYV A;  1MEM A;  1CS8 A;  3F75 A;  5CVN B;  1PAD A;  4YV8 A;  3PDF A;  3PRM A;  6PAD A;  4PAD A;  2YJC A;  3KWZ A;  1PXV A;  4CDE B;  2B1N A;  1KHP A;  1CTE A;  1A6R A;  2AUZ A;  1YVB A;  4DMY A;  3H8B A;  3OQC A;  5JZE A;  4D8E A;  2FO5 A;  3USV A;  1TU6 A;  4BOQ A;  4I07 A;  4BOS A;  1EF7 A;  2YJ2 A;  3WXE A;  3I06 A;  2JTC A;  3P5U A;  1PPO A;  3E1Z B;  3C9E A;  3PSE A;  3H6S A;  4YYU A;  3IHP A;  1BY8 A;  2BU3 A;  2NQG A;  4W5B A;  2YJ8 A;  2DJF B;  5FPW A;  2C0Y A;  3OVZ A;  4G54 A;  1CVZ A;  4DMX A;  2HH5 A;  3CBJ A;  3D6S A;  2XU3 A;  3QT4 A;  1PPN A;  4QRV A;  4P16 A;  3CBK A;  1NLJ A;  4N8W A;  3O1G A;  2OZ2 A;  1PCI A;  3AI8 A;  2CB5 A;  2E00 A;  1MDW A;  3PT2 A;  5EF4 A;  1QXP A;  1YT7 A;  3O65 A;  3P5W A;  4QH6 A;  4GUA A;  3H89 A;  2JRI A;  1ICF A;  2VHF A;  3QSD A;  4FIP A;  2FT2 A;  3V6C A;  3LFY A;  2XU5 A;  4BSQ A;  1YAL A;  4YVA A;  4YYW A;  2HHN A;  3CH2 X;  4RF1 A;  3BBA A;  5PAD A;  1F29 A;  3C0R A;  3E9S A;  1BGO A;  1CQD A;  5J94 A;  2G8E A;  2PNS A;  4I05 A;  1PVJ A;  5EZS A;  4ZUX U;  2XU4 A;  1GCB A;  3I3T A;  3HHA A;  3KX1 A;  3PW3 A;  4YYS A;  1U9X A;  2FE8 A;  2Y6E A;  4CDF B;  2F1G A;  1QMY A;  4RNA A;  1NB5 A;  3IMA A;  5KO3 A;  3IUT A;  2FYE A;  4REZ A;  2DOS A;  3PHX A;  4FK5 A;  4OEM A;  4MZO A;  4MI7 A;  3BC3 A;  4QRG A;  2GFO A;  3M99 A;  3MTN A;  3BPF A;  1MS6 A;  1F2B A;  4MSX A;  2FUD A;  1X9Y A;  2Y5B A;  4PI3 A;  4X6I A;  4BOP A;  5JH3 A;  2DZZ A;  4KLB A;  1U9V A;  1MEG A;  2XU1 A;  2BTW B;  2P86 A;  3MP2 A;  1CPJ A;  1F2A A;  1KFU L;  1PIP A;  2AU1 A;  1CB5 A;  1QDQ A;  1AIM A;  2AIM A;  1VJV A;  4XUI A;  4XR7 A;  3BWK A;  2H7J A;  2YJB A;  4OVZ A;  5EZQ A;  3RNV A;  1AYW A;  3KKU A;  1PBH A;  2IBI A;  1GMY A;  4D8B A;  4X6J A;  1KFX L;  1QOL A;  4D8I A;  1FH0 A;  1U9Q X;  3KW9 A;  2WBF X;  3IV2 A;  5CVM A;  4IP3 A;  2AYN A;  4CZW A;  2O6X A;  4XZX A;  2OUL A;  1POP A;  4AXM A;  1SP4 B;  2DC9 A;  3P5X A;  4YYR A;  1AU0 A;  3LXS A;  4W4U A;  2B1M A;  2AGA A;  1U5I A;  1EWL A;  1MHW A;  3MHH A;  4QRX A;  1IWD A;  2JQF R;  3B79 A;  4ZTB A;  1ATK A;  3ERV A;  2J7Q C;  4W5C A;  5CVO B;  4OEL A;  2DCC A;  2R6N A;  2Z84 A;  3IFU A;  1K3B B;  1ITO A;  2AUX A;  2R9M A;  1AYU A;  2PBH A;  3TMP A;  2PRE A;  1CV8 A;  1KHQ A;  4RF0 A;  3W30 A;  4BPV A;  3N4C A;  2R9N A;  4BS6 A;  5A24 A;  1VSN A;  2G8J A;  3PNR A;  2HXZ A;  3GCB A;  3HHI A;  2F7D A;  1CSB B;  3NHE A;  4P6E A;  1UKF A;  1Y08 A;  5EGW A;  2HD5 A;  5CHT A;  5CHV A;  3MOR A;  1XKG A;  2DZY A;  2DCB A;  3CH3 X;  2YJ9 A;  3P5V A;  3ZNH A;  1O0E A;  1THE A;  2FQ9 A;  2GHU A;  4RKX A;  1JQP A;  1AU2 A;  3RVV A;  2FRQ A;  4N79 A;  1PE6 A;  3KWB X;  2OP3 A;  3BPM A;  1EWO A;  3PBH A;  2G6D A;  9PAP A;  3BY4 A;  3O0U A;  1PPP A;  5E6J A;  3PRP A;  5K16 A;  2E03 A;  2P0R A;  4RY2 A;  2DCA A;  3TNX A;  5JA7 A;  3K24 A;  2CIO A;  4AXL A;  2G7Y A;  3BB7 A;  4N4Z A;  1ZCM A;  3N3K A;  3N3G A;  2JQG R;  3H8C A;  1KXR A;  2UZJ A;  2IPP B;  1HUC B;  2HWK A;  1YK8 A;  4HXD B;  3W31 A;  3HD3 A;  4K7C A;  3OVX A;  1NQC A;  2E02 A;  8PCH A;  1BP4 A;  1U9W A;  2DC6 A;  1YK7 A;  3RVW A;  1AEC A;  2FRA A;  2NQD B;  4R3D A;  3K9M A;  3H7D A;  3MHS A;  2R9O A;  3B21 A;  1SNK A;  4OVZ B;  1TLO A;  2DC7 A;  1BQI A;  2DCD A;  1YZB A;  1EWP A;  3QJ3 A;  4MM3 B;  1S4V A;  4CDC B;  1M6D A;  3TRK A;  4Q8H A;  1PPD A;  2PAD A;  2P7U A;  4PP1 A;  2BDZ A;  1TL9 A;  4QBB A;  3V6E A;  1AU3 A;  2NQA A;  2NQI A;  1NB3 A;  4HWY A;  4WUR A;  2ARY A;  3PHU A;  3S3Q A;  2R9C A;  2R9F A;  3MJ5 A;  4YYQ A;  3IEJ A; 
#chains in the Genus database with same CATH homology
 1ME4 A;  4BGF A;  3IOQ A;  3BCN A;  2DJG B;  3S3R A;  3U8E A;  3BOW A;  1STF E;  4X6H A;  3WXG A;  5F02 A;  1EWM A;  2DC8 A;  7PCK A;  3F5V A;  2BDL A;  1AU4 A;  1Y4H A;  3DF0 A;  1ZIV A;  1NPZ A;  1Q6K A;  3RVX A;  1GEC E;  4MZS A;  3WXF A;  4P6G A;  4CDD B;  1DEU A;  1F2C A;  3ZUA A;  4I04 A;  3HWN A;  4FJC A;  3OF8 A;  2AS8 A;  4YYV A;  1MIR A;  4BQV A;  4BS5 A;  2E01 A;  3K8U A;  2VHS A;  3KFQ A;  1ME3 A;  1DF0 A;  1CJL A;  2ATO A;  2AVW A;  1GLO A;  4WA6 A;  4Q8G A;  3OIS A;  3KSE A;  2ACT A;  1NL6 A;  4PP2 E;  3OF9 A;  2AYO A;  2FTD A;  1AYV A;  1MEM A;  1CS8 A;  3F75 A;  5CVN B;  1PAD A;  4YV8 A;  3PDF A;  6PAD A;  4PAD A;  2YJC A;  3KWZ A;  1PXV A;  4CDE B;  2B1N A;  1KHP A;  1CTE A;  1A6R A;  2AUZ A;  1YVB A;  4DMY A;  3H8B A;  2FO5 A;  3USV A;  1TU6 A;  4I07 A;  1EF7 A;  2YJ2 A;  3WXE A;  3I06 A;  3P5U A;  1PPO A;  3E1Z B;  2VFB A;  3C9E A;  3H6S A;  4YYU A;  3IHP A;  1BY8 A;  4W5B A;  2NQG A;  2YJ8 A;  2DJF B;  5FPW A;  2C0Y A;  3OVZ A;  4G54 A;  1CVZ A;  4DMX A;  2HH5 A;  3CBJ A;  3D6S A;  2XU3 A;  3QT4 A;  4B55 A;  1PPN A;  4QRV A;  4NV7 A;  3CBK A;  1NLJ A;  4N8W A;  3O1G A;  2OZ2 A;  1PCI A;  3AI8 A;  2CB5 A;  2E00 A;  1MDW A;  5EF4 A;  1QXP A;  1YT7 A;  3P5W A;  4QH6 A;  3H89 A;  1ICF A;  2VHF A;  3QSD A;  4FIP A;  2FT2 A;  3V6C A;  3LFY A;  2XU5 A;  4BSQ A;  1YAL A;  4YVA A;  4YYW A;  2HHN A;  3CH2 X;  5PAD A;  1F29 A;  1BGO A;  1CQD A;  5J94 A;  2G8E A;  2PNS A;  4I05 A;  4ZUX U;  1W4T A;  2XU4 A;  1GCB A;  3I3T A;  3HHA A;  3KX1 A;  3PW3 A;  4YYS A;  1U9X A;  2Y6E A;  4CDF B;  2F1G A;  1QMY A;  1NB5 A;  3IMA A;  3IUT A;  2FYE A;  1E2T A;  4OEM A;  4FK5 A;  4MZO A;  3BC3 A;  4QRG A;  2GFO A;  3D9W A;  3M99 A;  3MTN A;  3BPF A;  1MS6 A;  1F2B A;  4MSX A;  2FUD A;  1X9Y A;  2Y5B A;  4PI3 A;  4X6I A;  5JH3 A;  4C5P A;  2DZZ A;  4KLB A;  1U9V A;  1MEG A;  2XU1 A;  2P86 A;  1CPJ A;  1F2A A;  1KFU L;  1PIP A;  2AU1 A;  1CB5 A;  1QDQ A;  1AIM A;  2AIM A;  1VJV A;  4XUI A;  4XR7 A;  3BWK A;  2H7J A;  2YJB A;  1AYW A;  3KKU A;  1PBH A;  2IBI A;  1GMY A;  3LTW A;  4X6J A;  1KFX L;  1W5R A;  1QOL A;  1FH0 A;  1U9Q X;  3KW9 A;  2WBF X;  3IV2 A;  5CVM A;  1W6F A;  2AYN A;  4CZW A;  2O6X A;  2OUL A;  1POP A;  4AXM A;  1SP4 B;  2DC9 A;  3P5X A;  4YYR A;  1AU0 A;  3LXS A;  4W4U A;  2B1M A;  1U5I A;  1EWL A;  1GX3 A;  1MHW A;  3MHH A;  4QRX A;  1IWD A;  2JQF R;  3B79 A;  1ATK A;  3ERV A;  4W5C A;  5CVO B;  4OEL A;  2DCC A;  2R6N A;  1K3B B;  1ITO A;  2AUX A;  2R9M A;  1AYU A;  2PBH A;  2PRE A;  1CV8 A;  1KHQ A;  4BPV A;  3N4C A;  2R9N A;  4BS6 A;  5A24 A;  1VSN A;  2G8J A;  3PNR A;  2HXZ A;  3GCB A;  3HHI A;  2F7D A;  1CSB B;  3NHE A;  4P6E A;  1Y08 A;  5EGW A;  2HD5 A;  5CHT A;  5CHV A;  3MOR A;  1XKG A;  2DZY A;  2DCB A;  3CH3 X;  2YJ9 A;  3P5V A;  1O0E A;  1THE A;  2FQ9 A;  2GHU A;  1JQP A;  1AU2 A;  3RVV A;  2FRQ A;  4N79 A;  1PE6 A;  3KWB X;  2OP3 A;  3BPM A;  1EWO A;  3PBH A;  2G6D A;  9PAP A;  3O0U A;  1PPP A;  5K16 A;  2E03 A;  2P0R A;  4RY2 A;  2DCA A;  3TNX A;  5JA7 A;  3K24 A;  2CIO A;  4AXL A;  2G7Y A;  4N4Z A;  1ZCM A;  3N3K A;  3N3G A;  4NV8 A;  2JQG R;  3H8C A;  1KXR A;  2IPP B;  1HUC B;  1YK8 A;  2VFC A;  3HD3 A;  4K7C A;  4GUZ A;  3OVX A;  1NQC A;  2E02 A;  8PCH A;  1BP4 A;  1U9W A;  2DC6 A;  1YK7 A;  3RVW A;  1AEC A;  2BSZ A;  2FRA A;  2NQD B;  3K9M A;  3H7D A;  3MHS A;  2R9O A;  1SNK A;  1TLO A;  2DC7 A;  1BQI A;  2DCD A;  1EWP A;  3QJ3 A;  1S4V A;  4CDC B;  1M6D A;  4Q8H A;  1PPD A;  2PAD A;  2P7U A;  4PP1 A;  2BDZ A;  1TL9 A;  4QBB A;  3V6E A;  1AU3 A;  2NQA A;  2NQI A;  1NB3 A;  4HWY A;  2ARY A;  3S3Q A;  2R9C A;  2R9F A;  4YYQ A;  3IEJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...