1AIMA

Cruzain inhibited by benzoyl-tyrosine-alanine-fluoromethylketone
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
215
structure length
215
Chain Sequence
APAAVDWRARGAVTAVKDQGQCGSCWAFSAIGNVECQWFLAGHPLTNLSEQMLVSCDKTDSGCSGGLMNNAFEWIVQENNGAVYTEDSYPYASGEGISPPCTTSGHTVGATITGHVELPQDEAQIAAWLAVNGPVAVAVDASSWMTYTGGVMTSCVSEALDHGVLLVGYNDSAAVPYWIIKNSWTTQWGEEGYIRIAKGSNQCLVKEEASSAVVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural determinants of specificity in the cysteine protease cruzain.
pubmed rcsb
source organism Trypanosoma cruzi
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords CRUZAIN
total genus 62
structure length 215
sequence length 215
ec nomenclature ec 3.4.22.51: Cruzipain.
pdb deposition date 1997-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1aimA00
1DF0A 1O0EA 1ZCMA 3P5XA 5J94A 3U8EA 1STFE 2FQ9A 2PREA 3KFQA 2OULA 4QRVA 1AU3A 1M6DA 3HD3A 3N3KA 1TL9A 4KLBA 1U9QX 5CVNB 3N4CA 1MEMA 5CHTA 4QRGA 1BGOA 4W5CA 1CVZA 1AYVA 3P5WA 4BS6A 1POPA 4X6JA 3IV2A 3MHHA 3IOQA 4I05A 4DMYA 3S3RA 3KW9A 1CV8A 2NQAA 3BOWA 2PADA 3B79A 3LXSA 1KXRA 1PBHA 3K9MA 4BQVA 3H8CA 2R9CA 2PNSA 4FJCA 3ERVA 2JQGR 3LFYA 4I04A 2JQFR 2O6XA 3MORA 1F2AA 3AI8A 2E01A 4CDDB 2Y6EA 4YYRA 3K8UA 1YALA 1AU0A 3M99A 3F5VA 1BY8A 1GECE 3S3QA 4CDCB 3KSEA 5PADA 1CB5A 2FRQA 4K7CA 4BPVA 5A24A 1QXPA 1JQPA 1DEUA 2XU3A 2DZYA 1MHWA 1AYWA 5FPWA 4N79A 1VSNA 4PP1A 3WXFA 1EWOA 4G54A 3WXGA 5JH3A 1F2CA 1U9VA 3F75A 2E00A 1PPOA 4P6GA 2B1NA 4DMXA 2AVWA 4YV8A 2WBFX 2AIMA 3HHIA 7PCKA 4YYSA 3I3TA 5F02A 4CDFB 2DCBA 2OZ2A 1NB3A 2G7YA 4Q8HA 1NB5A 1GMYA 3D6SA 4ZUXU 4YYQA 3BWKA 4MZSA 3RVVA 1CSBB 1MDWA 3BC3A 4MZOA 4MSXA 3QT4A 1HUCB 3KWZA 3HWNA 3PDFA 1AU2A 3QSDA 3O1GA 3O0UA 2YJ9A 4Q8GA 2R9MA 2E02A 1EF7A 2G8EA 2P86A 4AXLA 3CH2X 4CZWA 5EF4A 2Y5BA 1GCBA 4OEMA 3WXEA 4AXMA 1YK8A 2G8JA 4QH6A 1AYUA 1CPJA 3H8BA 1KFUL 2CB5A 1MS6A 5K16A 1PPNA 9PAPA 2XU1A 3QJ3A 1SP4B 1U9WA 2F7DA 3GCBA 1KHPA 4QBBA 3H7DA 1ZIVA 2BDLA 2YJCA 1U9XA 4HWYA 3DF0A 1KHQA 2VHFA 5CHVA 1CQDA 2FUDA 3RVXA 2PBHA 2DJFB 3PBHA 2R9OA 1Y4HA 1NPZA 3KWBX 1GLOA 4QRXA 2R9NA 4YYVA 1BP4A 3BPMA 1PADA 4FK5A 1IWDA 3K24A 1QDQA 2ARYA 2R9FA 1ITOA 2ACTA 3OVXA 1NQCA 1TU6A 2DC6A 1S4VA 2P7UA 1SNKA 3CBJA 2F1GA 1CS8A 2OP3A 1EWPA 4FIPA 2E03A 3PW3A 8PCHA 1F2BA 2AU1A 1Y08A 1ME4A 1ME3A 1A6RA 2DZZA 4YYWA 3I06A 1NL6A 1YVBA 2BDZA 2XU4A 4X6IA 1PCIA 4W5BA 3CH3X 4WA6A 2VHSA 4RY2A 2DCDA 1AECA 2H7JA 2DC8A 3V6EA 2FT2A 3H6SA 3C9EA 1CJLA 4OELA 2FO5A 2XU5A 3IEJA 1XKGA 2P0RA 1EWLA 1PIPA 4YYUA 4P6EA 3P5VA 3USVA 4XR7A 4PI3A 3KX1A 4N4ZA 2ATOA 4YVAA 1TLOA 1YK7A 1BQIA 2IPPB 4PP2E 4BS5A 3MTNA 3PNRA 1NLJA 2GFOA 5JA7A 1Q6KA 2AUZA 5EGWA 3IUTA 1THEA 3IHPA 4I07A 4N8WA 1MIRA 1PPPA 1F29A 3TNXA 5CVMA 3OISA 3KKUA 2G6DA 4W4UA 1U5IA 1ICFA 3BPFA 1AU4A 6PADA 2NQGA 2GHUA 2HD5A 3OF9A 2C0YA 4BSQA 3N3GA 3NHEA 3RVWA 2AYNA 2FYEA 4PADA 1PPDA 4X6HA 3OF8A 2DC7A 3CBKA 3P5UA 1QOLA 1FH0A 1K3BB 2CIOA 2FRAA 2IBIA 2FTDA 1X9YA 2YJ8A 1KFXL 3ZUAA 2R6NA 2DCAA 2HH5A 2AS8A 3OVZA 1ATKA 1VJVA 4CDEB 3H89A 2HXZA 2YJBA 1MEGA 1PXVA 2NQIA 1YT7A 2AYOA 1PE6A 2DCCA 1EWMA 1QMYA 2AUXA 3IMAA 3V6CA 3E1ZB 4XUIA 3MHSA 1AIMA 2HHNA 2YJ2A 5CVOB 3HHAA 2DJGB 3BCNA 1CTEA 2NQDB 2DC9A 2B1MA
chains in the Genus database with same CATH superfamily
1DF0A 1O0EA 1ZCMA 3P5XA 5J94A 3U8EA 1STFE 2FQ9A 2PREA 3KFQA 2OULA 4QRVA 3PRMA 1AU3A 1M6DA 4A5UA 3HD3A 3N3KA 1TL9A 4RF1A 3PHWA 2Z84A 4KLBA 1U9QX 5CVNB 3N4CA 1MEMA 5JZEA 5CHTA 4QRGA 1BGOA 4W5CA 1CVZA 1AYVA 3P5WA 4BS6A 3ZNHA 1POPA 4X6JA 3IV2A 3MHHA 3IOQA 4I05A 4DMYA 3S3RA 3KW9A 4IUMA 1CV8A 2NQAA 3BOWA 2PADA 3B79A 3LXSA 1KXRA 1PBHA 3K9MA 4RF0A 4BQVA 3H8CA 2R9CA 2PNSA 2HWKA 2FE8A 4FJCA 3ERVA 2JQGR 4OVZB 3LFYA 4I04A 2JQFR 3MP2A 2O6XA 3MORA 1F2AA 3AI8A 2E01A 4CDDB 2Y6EA 4YYRA 3K8UA 1YALA 4RNAA 1AU0A 3M99A 3F5VA 1BY8A 4GUAA 1GECE 3S3QA 3PSEA 4CDCB 3KSEA 5PADA 1CB5A 2FRQA 4K7CA 4BPVA 5A24A 1QXPA 1JQPA 3IFUA 1DEUA 2XU3A 2DZYA 1MHWA 1AYWA 5FPWA 4N79A 1VSNA 4PP1A 3WXFA 4ZTBA 1EWOA 4G54A 3WXGA 5JH3A 1F2CA 4MI7A 1U9VA 3F75A 2E00A 1PPOA 4P6GA 4RKXA 2B1NA 4DMXA 2AVWA 4YV8A 2WBFX 2AIMA 3HHIA 7PCKA 4YYSA 3I3TA 4OVZA 5F02A 4CDFB 2DCBA 2OZ2A 1NB3A 3W30A 2G7YA 4Q8HA 2BTWA 1NB5A 4BOZA 1GMYA 3D6SA 4ZUXU 5EZSA 3BWKA 4MZSA 3RVVA 4YYQA 1CSBB 1MDWA 3BC3A 4MZOA 4MSXA 3QT4A 1HUCB 3KWZA 2J7QA 3HWNA 3PRPA 3PDFA 1AU2A 3E9SA 3QSDA 3O1GA 3O0UA 2YJ9A 4Q8GA 2R9MA 2E02A 1EF7A 2G8EA 4R3DA 2P86A 4AXLA 3CH2X 4CZWA 2AGAA 2J7QC 5EF4A 2Y5BA 1GCBA 4OEMA 4PT5A 4D8BA 3WXEA 4AXMA 4REZA 1YK8A 2BU3A 1UKFA 2G8JA 4QH6A 1AYUA 1CPJA 3O65A 3H8BA 1KFUL 2CB5A 1MS6A 5K16A 1PPNA 9PAPA 2XU1A 3QJ3A 1SP4B 1U9WA 2F7DA 3GCBA 1KHPA 3W31A 4WURA 4QBBA 3H7DA 1ZIVA 2BDLA 2YJCA 3RNVA 1U9XA 4HWYA 3DF0A 1KHQA 2VHFA 5CHVA 1CQDA 2FUDA 3RVXA 2PBHA 2DJFB 3PBHA 2R9OA 1Y4HA 1NPZA 3KWBX 1GLOA 3PT2A 4QRXA 2JTCA 3MJ5A 2R9NA 3BY4A 4YYVA 1BP4A 3BPMA 2UZJA 1PADA 4FK5A 1IWDA 3PHUA 5KO3A 2DOSA 3K24A 1QDQA 2ARYA 2R9FA 1ITOA 2ACTA 3OVXA 1NQCA 1TU6A 2DC6A 3BBAA 1S4VA 2P7UA 1SNKA 3CBJA 2F1GA 1CS8A 3TRKA 4FIPA 2OP3A 1EWPA 2E03A 1DKIA 4MM3B 3PW3A 2JRIA 8PCHA 1F2BA 2AU1A 1Y08A 4BOPA 1ME4A 1ME3A 1A6RA 2DZZA 4YYWA 3I06A 1NL6A 1YVBA 2BDZA 2XU4A 4X6IA 1PCIA 4W5BA 3CH3X 4IP3A 4WA6A 2VHSA 4RY2A 2DCDA 1AECA 2H7JA 2DC8A 3V6EA 2FT2A 3H6SA 3C9EA 3C0RA 1CJLA 4OELA 2FO5A 2XU5A 3IEJA 1XKGA 2P0RA 4BOSA 1EWLA 1PIPA 4YYUA 4P6EA 3P5VA 4P16A 3USVA 4XR7A 4PI3A 3KX1A 4N4ZA 2ATOA 4YVAA 1TLOA 1YK7A 1BQIA 2IPPB 4PP2E 4BS5A 3MTNA 3PNRA 1NLJA 2GFOA 5E6JA 5JA7A 1Q6KA 2AUZA 5EGWA 3IUTA 1THEA 3IHPA 4I07A 4N8WA 1MIRA 1PPPA 1YZBA 1F29A 4XZXA 3TNXA 5CVMA 3OISA 3KKUA 2G6DA 4W4UA 1U5IA 1ICFA 3BPFA 1AU4A 1PVJA 6PADA 2NQGA 2GHUA 2HD5A 3OF9A 2C0YA 4BSQA 3N3GA 3NHEA 3RVWA 2AYNA 2BTWB 2FYEA 4PADA 1PPDA 4X6HA 3OF8A 3OQCA 2DC7A 3CBKA 3P5UA 1QOLA 1FH0A 1K3BB 2CIOA 2FRAA 2IBIA 3B21A 2FTDA 1X9YA 2YJ8A 1KFXL 3ZUAA 4BOUA 4HXDB 2R6NA 2DCAA 4D8IA 2HH5A 2AS8A 3OVZA 1ATKA 1VJVA 4CDEB 3H89A 2HXZA 2YJBA 4BOQA 4M0WA 5EZQA 1MEGA 1PXVA 2NQIA 1YT7A 3BB7A 2AYOA 1PE6A 2DCCA 1EWMA 3TMPA 1QMYA 2AUXA 3IMAA 4OW0A 3V6CA 3E1ZB 4XUIA 3MHSA 1AIMA 3MTVA 2HHNA 2YJ2A 5CVOB 3PHXA 4D8EA 3HHAA 2DJGB 3BCNA 1CTEA 2NQDB 2DC9A 2B1MA
chains in the Genus database with same CATH topology
1DF0A 1O0EA 1ZCMA 3P5XA 5J94A 3U8EA 1STFE 2FQ9A 2PREA 3KFQA 2OULA 4QRVA 1AU3A 1E2TA 1M6DA 3HD3A 3N3KA 1TL9A 4KLBA 1U9QX 5CVNB 3N4CA 1MEMA 5CHTA 4QRGA 1BGOA 4W5CA 1CVZA 1AYVA 3P5WA 4BS6A 1POPA 4X6JA 3IV2A 3MHHA 3IOQA 4I05A 1W4TA 4DMYA 3S3RA 3KW9A 4NV7A 1CV8A 2NQAA 3BOWA 2PADA 4C5PA 1W6FA 3B79A 3LXSA 1KXRA 1PBHA 3K9MA 4BQVA 3H8CA 2R9CA 2PNSA 4FJCA 3ERVA 2JQGR 3LFYA 4I04A 2JQFR 2O6XA 3MORA 1F2AA 3AI8A 2E01A 4CDDB 2Y6EA 4YYRA 3K8UA 1YALA 1AU0A 3M99A 3F5VA 1BY8A 1W5RA 1GECE 3S3QA 4CDCB 3KSEA 5PADA 1CB5A 2FRQA 4K7CA 4BPVA 5A24A 1QXPA 1JQPA 1DEUA 2XU3A 2DZYA 1MHWA 1AYWA 5FPWA 4N79A 1VSNA 4PP1A 3WXFA 1EWOA 4G54A 3WXGA 5JH3A 1F2CA 2VFCA 1U9VA 3F75A 2E00A 1PPOA 4P6GA 2B1NA 4DMXA 2AVWA 4YV8A 2WBFX 2AIMA 2VFBA 3HHIA 7PCKA 4YYSA 3I3TA 5F02A 4CDFB 2DCBA 2OZ2A 1NB3A 2G7YA 4Q8HA 1NB5A 1GMYA 3D6SA 4ZUXU 4YYQA 3BWKA 4MZSA 3RVVA 1CSBB 1MDWA 3BC3A 4MZOA 4MSXA 3QT4A 1HUCB 3KWZA 3HWNA 3PDFA 1AU2A 3QSDA 3O1GA 3O0UA 2YJ9A 4Q8GA 2R9MA 2E02A 1EF7A 2G8EA 2P86A 4AXLA 3CH2X 4CZWA 5EF4A 2Y5BA 1GCBA 4OEMA 3WXEA 4AXMA 1YK8A 4B55A 2G8JA 4QH6A 1AYUA 1CPJA 3H8BA 1KFUL 2CB5A 1MS6A 5K16A 1PPNA 9PAPA 3D9WA 2XU1A 3QJ3A 1SP4B 1U9WA 2F7DA 3GCBA 1KHPA 4QBBA 3H7DA 1ZIVA 2BDLA 2YJCA 1U9XA 4HWYA 3DF0A 1KHQA 2VHFA 5CHVA 1CQDA 2FUDA 3RVXA 2PBHA 2DJFB 3PBHA 2R9OA 1Y4HA 1NPZA 3KWBX 1GLOA 4QRXA 2BSZA 2R9NA 4YYVA 1BP4A 3BPMA 1PADA 4FK5A 1IWDA 3K24A 1QDQA 2ARYA 2R9FA 1ITOA 2ACTA 3OVXA 1NQCA 1TU6A 2DC6A 1S4VA 2P7UA 1SNKA 3CBJA 2F1GA 1CS8A 2OP3A 1EWPA 4FIPA 2E03A 3LTWA 3PW3A 8PCHA 1F2BA 2AU1A 1Y08A 1ME4A 1ME3A 1A6RA 2DZZA 4YYWA 3I06A 1NL6A 1YVBA 2BDZA 2XU4A 4X6IA 1PCIA 4W5BA 3CH3X 4WA6A 2VHSA 4RY2A 2DCDA 1AECA 2H7JA 2DC8A 3V6EA 2FT2A 3H6SA 3C9EA 1CJLA 4OELA 2FO5A 2XU5A 3IEJA 1XKGA 2P0RA 1EWLA 1PIPA 4YYUA 4P6EA 3P5VA 3USVA 4XR7A 4PI3A 3KX1A 4N4ZA 2ATOA 4YVAA 1TLOA 1YK7A 1BQIA 2IPPB 4PP2E 4BS5A 3MTNA 1GX3A 3PNRA 1NLJA 2GFOA 5JA7A 1Q6KA 2AUZA 5EGWA 3IUTA 1THEA 3IHPA 4I07A 4N8WA 4NV8A 1MIRA 1PPPA 1F29A 3TNXA 5CVMA 3OISA 3KKUA 2G6DA 4W4UA 1U5IA 1ICFA 3BPFA 1AU4A 4BGFA 6PADA 2NQGA 2GHUA 4GUZA 2HD5A 3OF9A 2C0YA 4BSQA 3N3GA 3NHEA 3RVWA 2AYNA 2FYEA 4PADA 1PPDA 4X6HA 3OF8A 2DC7A 3CBKA 3P5UA 1QOLA 1FH0A 1K3BB 2CIOA 2FRAA 2IBIA 2FTDA 1X9YA 2YJ8A 1KFXL 3ZUAA 2R6NA 2DCAA 2HH5A 2AS8A 3OVZA 1ATKA 1VJVA 4CDEB 3H89A 2HXZA 2YJBA 1MEGA 1PXVA 2NQIA 1YT7A 2AYOA 1PE6A 2DCCA 1EWMA 1QMYA 2AUXA 3IMAA 3V6CA 3E1ZB 4XUIA 3MHSA 1AIMA 2HHNA 2YJ2A 5CVOB 3HHAA 2DJGB 3BCNA 1CTEA 2NQDB 2DC9A 2B1MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DF0 A;  1O0E A;  1ZCM A;  3P5X A;  5J94 A;  3U8E A;  1STF E;  2FQ9 A;  2PRE A;  3KFQ A;  2OUL A;  4QRV A;  1AU3 A;  1M6D A;  3HD3 A;  3N3K A;  1TL9 A;  4KLB A;  1U9Q X;  5CVN B;  3N4C A;  1MEM A;  5CHT A;  4QRG A;  1BGO A;  4W5C A;  1CVZ A;  1AYV A;  3P5W A;  4BS6 A;  1POP A;  4X6J A;  3IV2 A;  3MHH A;  3IOQ A;  4I05 A;  4DMY A;  3S3R A;  3KW9 A;  1CV8 A;  2NQA A;  3BOW A;  2PAD A;  3B79 A;  3LXS A;  1KXR A;  1PBH A;  3K9M A;  4BQV A;  3H8C A;  2R9C A;  2PNS A;  4FJC A;  3ERV A;  2JQG R;  3LFY A;  4I04 A;  2JQF R;  2O6X A;  3MOR A;  1F2A A;  3AI8 A;  2E01 A;  4CDD B;  2Y6E A;  4YYR A;  3K8U A;  1YAL A;  1AU0 A;  3M99 A;  3F5V A;  1BY8 A;  1GEC E;  3S3Q A;  4CDC B;  3KSE A;  5PAD A;  1CB5 A;  2FRQ A;  4K7C A;  4BPV A;  5A24 A;  1QXP A;  1JQP A;  1DEU A;  2XU3 A;  2DZY A;  1MHW A;  1AYW A;  5FPW A;  4N79 A;  1VSN A;  4PP1 A;  3WXF A;  1EWO A;  4G54 A;  3WXG A;  5JH3 A;  1F2C A;  1U9V A;  3F75 A;  2E00 A;  1PPO A;  4P6G A;  2B1N A;  4DMX A;  2AVW A;  4YV8 A;  2WBF X;  2AIM A;  3HHI A;  7PCK A;  4YYS A;  3I3T A;  5F02 A;  4CDF B;  2DCB A;  2OZ2 A;  1NB3 A;  2G7Y A;  4Q8H A;  1NB5 A;  1GMY A;  3D6S A;  4ZUX U;  4YYQ A;  3BWK A;  4MZS A;  3RVV A;  1CSB B;  1MDW A;  3BC3 A;  4MZO A;  4MSX A;  3QT4 A;  1HUC B;  3KWZ A;  3HWN A;  3PDF A;  1AU2 A;  3QSD A;  3O1G A;  3O0U A;  2YJ9 A;  4Q8G A;  2R9M A;  2E02 A;  1EF7 A;  2G8E A;  2P86 A;  4AXL A;  3CH2 X;  4CZW A;  5EF4 A;  2Y5B A;  1GCB A;  4OEM A;  3WXE A;  4AXM A;  1YK8 A;  2G8J A;  4QH6 A;  1AYU A;  1CPJ A;  3H8B A;  1KFU L;  2CB5 A;  1MS6 A;  5K16 A;  1PPN A;  9PAP A;  2XU1 A;  3QJ3 A;  1SP4 B;  1U9W A;  2F7D A;  3GCB A;  1KHP A;  4QBB A;  3H7D A;  1ZIV A;  2BDL A;  2YJC A;  1U9X A;  4HWY A;  3DF0 A;  1KHQ A;  2VHF A;  5CHV A;  1CQD A;  2FUD A;  3RVX A;  2PBH A;  2DJF B;  3PBH A;  2R9O A;  1Y4H A;  1NPZ A;  3KWB X;  1GLO A;  4QRX A;  2R9N A;  4YYV A;  1BP4 A;  3BPM A;  1PAD A;  4FK5 A;  1IWD A;  3K24 A;  1QDQ A;  2ARY A;  2R9F A;  1ITO A;  2ACT A;  3OVX A;  1NQC A;  1TU6 A;  2DC6 A;  1S4V A;  2P7U A;  1SNK A;  3CBJ A;  2F1G A;  1CS8 A;  2OP3 A;  1EWP A;  4FIP A;  2E03 A;  3PW3 A;  8PCH A;  1F2B A;  2AU1 A;  1Y08 A;  1ME4 A;  1ME3 A;  1A6R A;  2DZZ A;  4YYW A;  3I06 A;  1NL6 A;  1YVB A;  2BDZ A;  2XU4 A;  4X6I A;  1PCI A;  4W5B A;  3CH3 X;  4WA6 A;  2VHS A;  4RY2 A;  2DCD A;  1AEC A;  2H7J A;  2DC8 A;  3V6E A;  2FT2 A;  3H6S A;  3C9E A;  1CJL A;  4OEL A;  2FO5 A;  2XU5 A;  3IEJ A;  1XKG A;  2P0R A;  1EWL A;  1PIP A;  4YYU A;  4P6E A;  3P5V A;  3USV A;  4XR7 A;  4PI3 A;  3KX1 A;  4N4Z A;  2ATO A;  4YVA A;  1TLO A;  1YK7 A;  1BQI A;  2IPP B;  4PP2 E;  4BS5 A;  3MTN A;  3PNR A;  1NLJ A;  2GFO A;  5JA7 A;  1Q6K A;  2AUZ A;  5EGW A;  3IUT A;  1THE A;  3IHP A;  4I07 A;  4N8W A;  1MIR A;  1PPP A;  1F29 A;  3TNX A;  5CVM A;  3OIS A;  3KKU A;  2G6D A;  4W4U A;  1U5I A;  1ICF A;  3BPF A;  1AU4 A;  6PAD A;  2NQG A;  2GHU A;  2HD5 A;  3OF9 A;  2C0Y A;  4BSQ A;  3N3G A;  3NHE A;  3RVW A;  2AYN A;  2FYE A;  4PAD A;  1PPD A;  4X6H A;  3OF8 A;  2DC7 A;  3CBK A;  3P5U A;  1QOL A;  1FH0 A;  1K3B B;  2CIO A;  2FRA A;  2IBI A;  2FTD A;  1X9Y A;  2YJ8 A;  1KFX L;  3ZUA A;  2R6N A;  2DCA A;  2HH5 A;  2AS8 A;  3OVZ A;  1ATK A;  1VJV A;  4CDE B;  3H89 A;  2HXZ A;  2YJB A;  1MEG A;  1PXV A;  2NQI A;  1YT7 A;  2AYO A;  1PE6 A;  2DCC A;  1EWM A;  1QMY A;  2AUX A;  3IMA A;  3V6C A;  3E1Z B;  4XUI A;  3MHS A;  1AIM A;  2HHN A;  2YJ2 A;  5CVO B;  3HHA A;  2DJG B;  3BCN A;  1CTE A;  2NQD B;  2DC9 A;  2B1M A; 
#chains in the Genus database with same CATH topology
 1DF0 A;  1O0E A;  1ZCM A;  3P5X A;  5J94 A;  3U8E A;  1STF E;  2FQ9 A;  2PRE A;  3KFQ A;  2OUL A;  4QRV A;  3PRM A;  1AU3 A;  1M6D A;  4A5U A;  3HD3 A;  3N3K A;  1TL9 A;  4RF1 A;  3PHW A;  2Z84 A;  4KLB A;  1U9Q X;  5CVN B;  3N4C A;  1MEM A;  5JZE A;  5CHT A;  4QRG A;  1BGO A;  4W5C A;  1CVZ A;  1AYV A;  3P5W A;  4BS6 A;  3ZNH A;  1POP A;  4X6J A;  3IV2 A;  3MHH A;  3IOQ A;  4I05 A;  4DMY A;  3S3R A;  3KW9 A;  4IUM A;  1CV8 A;  2NQA A;  3BOW A;  2PAD A;  3B79 A;  3LXS A;  1KXR A;  1PBH A;  3K9M A;  4RF0 A;  4BQV A;  3H8C A;  2R9C A;  2PNS A;  2HWK A;  2FE8 A;  4FJC A;  3ERV A;  2JQG R;  4OVZ B;  3LFY A;  4I04 A;  2JQF R;  3MP2 A;  2O6X A;  3MOR A;  1F2A A;  3AI8 A;  2E01 A;  4CDD B;  2Y6E A;  4YYR A;  3K8U A;  1YAL A;  4RNA A;  1AU0 A;  3M99 A;  3F5V A;  1BY8 A;  4GUA A;  1GEC E;  3S3Q A;  3PSE A;  4CDC B;  3KSE A;  5PAD A;  1CB5 A;  2FRQ A;  4K7C A;  4BPV A;  5A24 A;  1QXP A;  1JQP A;  3IFU A;  1DEU A;  2XU3 A;  2DZY A;  1MHW A;  1AYW A;  5FPW A;  4N79 A;  1VSN A;  4PP1 A;  3WXF A;  4ZTB A;  1EWO A;  4G54 A;  3WXG A;  5JH3 A;  1F2C A;  4MI7 A;  1U9V A;  3F75 A;  2E00 A;  1PPO A;  4P6G A;  4RKX A;  2B1N A;  4DMX A;  2AVW A;  4YV8 A;  2WBF X;  2AIM A;  3HHI A;  7PCK A;  4YYS A;  3I3T A;  4OVZ A;  5F02 A;  4CDF B;  2DCB A;  2OZ2 A;  1NB3 A;  3W30 A;  2G7Y A;  4Q8H A;  2BTW A;  1NB5 A;  4BOZ A;  1GMY A;  3D6S A;  4ZUX U;  5EZS A;  3BWK A;  4MZS A;  3RVV A;  4YYQ A;  1CSB B;  1MDW A;  3BC3 A;  4MZO A;  4MSX A;  3QT4 A;  1HUC B;  3KWZ A;  2J7Q A;  3HWN A;  3PRP A;  3PDF A;  1AU2 A;  3E9S A;  3QSD A;  3O1G A;  3O0U A;  2YJ9 A;  4Q8G A;  2R9M A;  2E02 A;  1EF7 A;  2G8E A;  4R3D A;  2P86 A;  4AXL A;  3CH2 X;  4CZW A;  2AGA A;  2J7Q C;  5EF4 A;  2Y5B A;  1GCB A;  4OEM A;  4PT5 A;  4D8B A;  3WXE A;  4AXM A;  4REZ A;  1YK8 A;  2BU3 A;  1UKF A;  2G8J A;  4QH6 A;  1AYU A;  1CPJ A;  3O65 A;  3H8B A;  1KFU L;  2CB5 A;  1MS6 A;  5K16 A;  1PPN A;  9PAP A;  2XU1 A;  3QJ3 A;  1SP4 B;  1U9W A;  2F7D A;  3GCB A;  1KHP A;  3W31 A;  4WUR A;  4QBB A;  3H7D A;  1ZIV A;  2BDL A;  2YJC A;  3RNV A;  1U9X A;  4HWY A;  3DF0 A;  1KHQ A;  2VHF A;  5CHV A;  1CQD A;  2FUD A;  3RVX A;  2PBH A;  2DJF B;  3PBH A;  2R9O A;  1Y4H A;  1NPZ A;  3KWB X;  1GLO A;  3PT2 A;  4QRX A;  2JTC A;  3MJ5 A;  2R9N A;  3BY4 A;  4YYV A;  1BP4 A;  3BPM A;  2UZJ A;  1PAD A;  4FK5 A;  1IWD A;  3PHU A;  5KO3 A;  2DOS A;  3K24 A;  1QDQ A;  2ARY A;  2R9F A;  1ITO A;  2ACT A;  3OVX A;  1NQC A;  1TU6 A;  2DC6 A;  3BBA A;  1S4V A;  2P7U A;  1SNK A;  3CBJ A;  2F1G A;  1CS8 A;  3TRK A;  4FIP A;  2OP3 A;  1EWP A;  2E03 A;  1DKI A;  4MM3 B;  3PW3 A;  2JRI A;  8PCH A;  1F2B A;  2AU1 A;  1Y08 A;  4BOP A;  1ME4 A;  1ME3 A;  1A6R A;  2DZZ A;  4YYW A;  3I06 A;  1NL6 A;  1YVB A;  2BDZ A;  2XU4 A;  4X6I A;  1PCI A;  4W5B A;  3CH3 X;  4IP3 A;  4WA6 A;  2VHS A;  4RY2 A;  2DCD A;  1AEC A;  2H7J A;  2DC8 A;  3V6E A;  2FT2 A;  3H6S A;  3C9E A;  3C0R A;  1CJL A;  4OEL A;  2FO5 A;  2XU5 A;  3IEJ A;  1XKG A;  2P0R A;  4BOS A;  1EWL A;  1PIP A;  4YYU A;  4P6E A;  3P5V A;  4P16 A;  3USV A;  4XR7 A;  4PI3 A;  3KX1 A;  4N4Z A;  2ATO A;  4YVA A;  1TLO A;  1YK7 A;  1BQI A;  2IPP B;  4PP2 E;  4BS5 A;  3MTN A;  3PNR A;  1NLJ A;  2GFO A;  5E6J A;  5JA7 A;  1Q6K A;  2AUZ A;  5EGW A;  3IUT A;  1THE A;  3IHP A;  4I07 A;  4N8W A;  1MIR A;  1PPP A;  1YZB A;  1F29 A;  4XZX A;  3TNX A;  5CVM A;  3OIS A;  3KKU A;  2G6D A;  4W4U A;  1U5I A;  1ICF A;  3BPF A;  1AU4 A;  1PVJ A;  6PAD A;  2NQG A;  2GHU A;  2HD5 A;  3OF9 A;  2C0Y A;  4BSQ A;  3N3G A;  3NHE A;  3RVW A;  2AYN A;  2BTW B;  2FYE A;  4PAD A;  1PPD A;  4X6H A;  3OF8 A;  3OQC A;  2DC7 A;  3CBK A;  3P5U A;  1QOL A;  1FH0 A;  1K3B B;  2CIO A;  2FRA A;  2IBI A;  3B21 A;  2FTD A;  1X9Y A;  2YJ8 A;  1KFX L;  3ZUA A;  4BOU A;  4HXD B;  2R6N A;  2DCA A;  4D8I A;  2HH5 A;  2AS8 A;  3OVZ A;  1ATK A;  1VJV A;  4CDE B;  3H89 A;  2HXZ A;  2YJB A;  4BOQ A;  4M0W A;  5EZQ A;  1MEG A;  1PXV A;  2NQI A;  1YT7 A;  3BB7 A;  2AYO A;  1PE6 A;  2DCC A;  1EWM A;  3TMP A;  1QMY A;  2AUX A;  3IMA A;  4OW0 A;  3V6C A;  3E1Z B;  4XUI A;  3MHS A;  1AIM A;  3MTV A;  2HHN A;  2YJ2 A;  5CVO B;  3PHX A;  4D8E A;  3HHA A;  2DJG B;  3BCN A;  1CTE A;  2NQD B;  2DC9 A;  2B1M A; 
#chains in the Genus database with same CATH homology
 1DF0 A;  1O0E A;  1ZCM A;  3P5X A;  5J94 A;  3U8E A;  1STF E;  2FQ9 A;  2PRE A;  3KFQ A;  2OUL A;  4QRV A;  1AU3 A;  1E2T A;  1M6D A;  3HD3 A;  3N3K A;  1TL9 A;  4KLB A;  1U9Q X;  5CVN B;  3N4C A;  1MEM A;  5CHT A;  4QRG A;  1BGO A;  4W5C A;  1CVZ A;  1AYV A;  3P5W A;  4BS6 A;  1POP A;  4X6J A;  3IV2 A;  3MHH A;  3IOQ A;  4I05 A;  1W4T A;  4DMY A;  3S3R A;  3KW9 A;  4NV7 A;  1CV8 A;  2NQA A;  3BOW A;  2PAD A;  4C5P A;  1W6F A;  3B79 A;  3LXS A;  1KXR A;  1PBH A;  3K9M A;  4BQV A;  3H8C A;  2R9C A;  2PNS A;  4FJC A;  3ERV A;  2JQG R;  3LFY A;  4I04 A;  2JQF R;  2O6X A;  3MOR A;  1F2A A;  3AI8 A;  2E01 A;  4CDD B;  2Y6E A;  4YYR A;  3K8U A;  1YAL A;  1AU0 A;  3M99 A;  3F5V A;  1BY8 A;  1W5R A;  1GEC E;  3S3Q A;  4CDC B;  3KSE A;  5PAD A;  1CB5 A;  2FRQ A;  4K7C A;  4BPV A;  5A24 A;  1QXP A;  1JQP A;  1DEU A;  2XU3 A;  2DZY A;  1MHW A;  1AYW A;  5FPW A;  4N79 A;  1VSN A;  4PP1 A;  3WXF A;  1EWO A;  4G54 A;  3WXG A;  5JH3 A;  1F2C A;  2VFC A;  1U9V A;  3F75 A;  2E00 A;  1PPO A;  4P6G A;  2B1N A;  4DMX A;  2AVW A;  4YV8 A;  2WBF X;  2AIM A;  2VFB A;  3HHI A;  7PCK A;  4YYS A;  3I3T A;  5F02 A;  4CDF B;  2DCB A;  2OZ2 A;  1NB3 A;  2G7Y A;  4Q8H A;  1NB5 A;  1GMY A;  3D6S A;  4ZUX U;  4YYQ A;  3BWK A;  4MZS A;  3RVV A;  1CSB B;  1MDW A;  3BC3 A;  4MZO A;  4MSX A;  3QT4 A;  1HUC B;  3KWZ A;  3HWN A;  3PDF A;  1AU2 A;  3QSD A;  3O1G A;  3O0U A;  2YJ9 A;  4Q8G A;  2R9M A;  2E02 A;  1EF7 A;  2G8E A;  2P86 A;  4AXL A;  3CH2 X;  4CZW A;  5EF4 A;  2Y5B A;  1GCB A;  4OEM A;  3WXE A;  4AXM A;  1YK8 A;  4B55 A;  2G8J A;  4QH6 A;  1AYU A;  1CPJ A;  3H8B A;  1KFU L;  2CB5 A;  1MS6 A;  5K16 A;  1PPN A;  9PAP A;  3D9W A;  2XU1 A;  3QJ3 A;  1SP4 B;  1U9W A;  2F7D A;  3GCB A;  1KHP A;  4QBB A;  3H7D A;  1ZIV A;  2BDL A;  2YJC A;  1U9X A;  4HWY A;  3DF0 A;  1KHQ A;  2VHF A;  5CHV A;  1CQD A;  2FUD A;  3RVX A;  2PBH A;  2DJF B;  3PBH A;  2R9O A;  1Y4H A;  1NPZ A;  3KWB X;  1GLO A;  4QRX A;  2BSZ A;  2R9N A;  4YYV A;  1BP4 A;  3BPM A;  1PAD A;  4FK5 A;  1IWD A;  3K24 A;  1QDQ A;  2ARY A;  2R9F A;  1ITO A;  2ACT A;  3OVX A;  1NQC A;  1TU6 A;  2DC6 A;  1S4V A;  2P7U A;  1SNK A;  3CBJ A;  2F1G A;  1CS8 A;  2OP3 A;  1EWP A;  4FIP A;  2E03 A;  3LTW A;  3PW3 A;  8PCH A;  1F2B A;  2AU1 A;  1Y08 A;  1ME4 A;  1ME3 A;  1A6R A;  2DZZ A;  4YYW A;  3I06 A;  1NL6 A;  1YVB A;  2BDZ A;  2XU4 A;  4X6I A;  1PCI A;  4W5B A;  3CH3 X;  4WA6 A;  2VHS A;  4RY2 A;  2DCD A;  1AEC A;  2H7J A;  2DC8 A;  3V6E A;  2FT2 A;  3H6S A;  3C9E A;  1CJL A;  4OEL A;  2FO5 A;  2XU5 A;  3IEJ A;  1XKG A;  2P0R A;  1EWL A;  1PIP A;  4YYU A;  4P6E A;  3P5V A;  3USV A;  4XR7 A;  4PI3 A;  3KX1 A;  4N4Z A;  2ATO A;  4YVA A;  1TLO A;  1YK7 A;  1BQI A;  2IPP B;  4PP2 E;  4BS5 A;  3MTN A;  1GX3 A;  3PNR A;  1NLJ A;  2GFO A;  5JA7 A;  1Q6K A;  2AUZ A;  5EGW A;  3IUT A;  1THE A;  3IHP A;  4I07 A;  4N8W A;  4NV8 A;  1MIR A;  1PPP A;  1F29 A;  3TNX A;  5CVM A;  3OIS A;  3KKU A;  2G6D A;  4W4U A;  1U5I A;  1ICF A;  3BPF A;  1AU4 A;  4BGF A;  6PAD A;  2NQG A;  2GHU A;  4GUZ A;  2HD5 A;  3OF9 A;  2C0Y A;  4BSQ A;  3N3G A;  3NHE A;  3RVW A;  2AYN A;  2FYE A;  4PAD A;  1PPD A;  4X6H A;  3OF8 A;  2DC7 A;  3CBK A;  3P5U A;  1QOL A;  1FH0 A;  1K3B B;  2CIO A;  2FRA A;  2IBI A;  2FTD A;  1X9Y A;  2YJ8 A;  1KFX L;  3ZUA A;  2R6N A;  2DCA A;  2HH5 A;  2AS8 A;  3OVZ A;  1ATK A;  1VJV A;  4CDE B;  3H89 A;  2HXZ A;  2YJB A;  1MEG A;  1PXV A;  2NQI A;  1YT7 A;  2AYO A;  1PE6 A;  2DCC A;  1EWM A;  1QMY A;  2AUX A;  3IMA A;  3V6C A;  3E1Z B;  4XUI A;  3MHS A;  1AIM A;  2HHN A;  2YJ2 A;  5CVO B;  3HHA A;  2DJG B;  3BCN A;  1CTE A;  2NQD B;  2DC9 A;  2B1M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...