1AIMA

Cruzain inhibited by benzoyl-tyrosine-alanine-fluoromethylketone
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
215
structure length
215
Chain Sequence
APAAVDWRARGAVTAVKDQGQCGSCWAFSAIGNVECQWFLAGHPLTNLSEQMLVSCDKTDSGCSGGLMNNAFEWIVQENNGAVYTEDSYPYASGEGISPPCTTSGHTVGATITGHVELPQDEAQIAAWLAVNGPVAVAVDASSWMTYTGGVMTSCVSEALDHGVLLVGYNDSAAVPYWIIKNSWTTQWGEEGYIRIAKGSNQCLVKEEASSAVVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural determinants of specificity in the cysteine protease cruzain.
pubmed rcsb
source organism Trypanosoma cruzi
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords CRUZAIN
total genus 62
structure length 215
sequence length 215
ec nomenclature ec 3.4.22.51: Cruzipain.
pdb deposition date 1997-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1aimA00
1MEMA 5CHVA 1MDWA 4YYWA 1HUCB 3QJ3A 2PADA 2VHSA 2PNSA 3PNRA 5EF4A 3ZUAA 4YYVA 4N79A 3TNXA 2FQ9A 3P5WA 2WBFX 2DC9A 2IBIA 3OVZA 2CIOA 1PXVA 3DF0A 4KLBA 1MHWA 1IWDA 2DJGB 3QT4A 2G8EA 1CB5A 4MZSA 1BGOA 3HHAA 1PCIA 4MSXA 3F5VA 4PP1A 2E03A 3HHIA 4DMYA 2AVWA 1AECA 3KFQA 3V6CA 3KWZA 2GFOA 2R9MA 3OISA 1PPOA 3HWNA 4WA6A 4QBBA 4FIPA 2DC7A 2F1GA 3KWBX 2HXZA 2JQFR 3BPMA 3RVWA 4QRVA 3CH2X 4FJCA 3RVXA 5EGWA 2ACTA 1BQIA 4W5BA 3BC3A 3O1GA 4X6IA 2R6NA 1ME3A 3WXGA 1EWOA 1THEA 1QMYA 3IOQA 1CSBB 1CJLA 2DZZA 1QOLA 2YJ2A 1NLJA 1U9VA 4RY2A 1KHPA 2NQGA 3P5UA 3I06A 1EF7A 3CBJA 1X9YA 1S4VA 1Q6KA 2AIMA 2Y6EA 2XU4A 1KHQA 3ERVA 2DC8A 4I05A 5CVNB 2XU3A 1NPZA 1TU6A 1STFE 5A24A 1SP4B 2C0YA 1TLOA 1Y08A 1EWMA 3AI8A 4FK5A 3MHHA 2BDLA 3MTNA 2OULA 1PPNA 4CDEB 1MIRA 2ATOA 4CZWA 1F29A 3GCBA 1KFXL 4PADA 1POPA 4PI3A 1ZCMA 3C9EA 3KW9A 1TL9A 3BPFA 4PP2E 2IPPB 1EWLA 3H8CA 2DCDA 4YYSA 1KFUL 5JA7A 4BPVA 1PADA 4X6HA 4DMXA 1NB5A 1BY8A 5JH3A 2FUDA 2R9FA 1EWPA 2AUZA 2H7JA 3BOWA 4OEMA 3QSDA 3WXFA 3CBKA 1AU0A 3N3KA 4ZUXU 4BS6A 3RVVA 3OVXA 1SNKA 1AU4A 3I3TA 2VHFA 1CVZA 4Q8GA 4I04A 2AYOA 2HHNA 2DCBA 3B79A 2XU5A 3O0UA 1A6RA 1M6DA 1MS6A 4AXMA 2B1MA 2AUXA 1VJVA 1MEGA 4MZOA 1PBHA 1GCBA 3KSEA 1YALA 2AS8A 3OF9A 2DJFB 2CB5A 2E00A 1DEUA 1GLOA 1AU2A 1F2BA 2DCAA 4W5CA 1AYWA 5PADA 3LFYA 2YJ9A 4CDFB 3NHEA 5F02A 4Q8HA 3S3RA 3H89A 4QRGA 1F2CA 1ICFA 1AYUA 4XUIA 6PADA 3PBHA 3KKUA 2F7DA 2YJ8A 4CDCB 1CQDA 1GMYA 1YK7A 3K24A 5CHTA 2PREA 9PAPA 1QXPA 1KXRA 4N4ZA 2XU1A 1CTEA 1ZIVA 1ME4A 3H6SA 2P86A 1YK8A 4I07A 3PDFA 2E01A 2G8JA 2FRAA 1NL6A 4BS5A 4K7CA 3V6EA 1FH0A 1YT7A 2BDZA 7PCKA 2YJCA 3WXEA 2DCCA 2AU1A 2G7YA 2NQIA 3H7DA 3F75A 3IHPA 4QRXA 2PBHA 2HH5A 3BWKA 4W4UA 2DC6A 3P5XA 4QH6A 5CVMA 1ITOA 2NQDB 3P5VA 4AXLA 2FRQA 4YVAA 3LXSA 3IUTA 3D6SA 4G54A 3PW3A 2OP3A 3CH3X 2R9OA 2B1NA 4OELA 1PIPA 1NB3A 2FO5A 2OZ2A 2Y5BA 2HD5A 1AYVA 1ATKA 2FTDA 3MORA 1CS8A 8PCHA 1PE6A 1AIMA 5K16A 4BQVA 3HD3A 3IV2A 4XR7A 5CVOB 4YYRA 1DF0A 2P7UA 4BSQA 1U9WA 3K8UA 5J94A 3MHSA 1GECE 1VSNA 2DZYA 4P6EA 2O6XA 1U9QX 2R9CA 4P6GA 1Y4HA 2P0RA 2R9NA 2NQAA 3E1ZB 3USVA 2FT2A 1AU3A 1CPJA 3OF8A 4YYUA 4X6JA 1PPPA 4YYQA 1F2AA 1XKGA 3S3QA 1QDQA 1CV8A 4HWYA 2ARYA 3M99A 3BCNA 3N4CA 4YV8A 1JQPA 2JQGR 3H8BA 1BP4A 4CDDB 5FPWA 1U9XA 1O0EA 2G6DA 1PPDA 2E02A 3KX1A 1YVBA 1NQCA 3IMAA 3IEJA 1K3BB 4N8WA 2GHUA 1U5IA 2AYNA 2FYEA 2YJBA 3N3GA 3K9MA 3U8EA
chains in the Genus database with same CATH superfamily
1MEMA 5CHVA 1MDWA 4YYWA 1HUCB 3QJ3A 3PHXA 2PADA 2VHSA 3OQCA 2PNSA 3PNRA 5EF4A 3ZUAA 4YYVA 4N79A 3TNXA 2FQ9A 4BOUA 3P5WA 2BTWB 2WBFX 2DC9A 2IBIA 3OVZA 2CIOA 1PXVA 3DF0A 4KLBA 2J7QC 1MHWA 1IWDA 3QT4A 2DJGB 2G8EA 1CB5A 4MZSA 4ZTBA 1BGOA 3HHAA 1PCIA 4MSXA 3F5VA 4PP1A 2E03A 3HHIA 4DMYA 2AVWA 1AECA 5KO3A 3KFQA 3V6CA 3KWZA 3O65A 4RF0A 2GFOA 2R9MA 4A5UA 3MTVA 3OISA 1PPOA 3HWNA 4WA6A 4QBBA 1PVJA 4FIPA 2HWKA 2DC7A 2F1GA 3KWBX 3W30A 2HXZA 2JQFR 3BPMA 3RVWA 4QRVA 3CH2X 4FJCA 3IFUA 3RVXA 5EGWA 2ACTA 1BQIA 4W5BA 3BC3A 3PHUA 3ZNHA 3O1GA 4X6IA 2R6NA 1ME3A 3WXGA 1EWOA 1THEA 4IP3A 1QMYA 3IOQA 1CSBB 1CJLA 2DZZA 3BB7A 1QOLA 2YJ2A 1NLJA 1U9VA 4RY2A 1KHPA 3BY4A 2NQGA 3P5UA 3I06A 1EF7A 3CBJA 1X9YA 3MP2A 2JTCA 1S4VA 1Q6KA 2AIMA 4R3DA 2Y6EA 2XU4A 1KHQA 3ERVA 2DC8A 4I05A 5CVNB 2XU3A 1NPZA 1TU6A 1STFE 5A24A 1SP4B 2C0YA 1TLOA 1Y08A 1EWMA 3AI8A 2Z84A 3BBAA 3PT2A 4FK5A 2JRIA 4D8IA 3MHHA 2BDLA 3MTNA 3TMPA 2OULA 3C0RA 1PPNA 4CDEB 1MIRA 4HXDB 2ATOA 4CZWA 1F29A 4P16A 3GCBA 1KFXL 4PADA 2BTWA 1POPA 4PI3A 1ZCMA 3C9EA 3KW9A 4GUAA 1TL9A 3BPFA 2IPPB 4PP2E 1EWLA 3H8CA 2DCDA 3MJ5A 4YYSA 1KFUL 5JA7A 4BPVA 1PADA 4X6HA 4DMXA 1NB5A 1BY8A 5JH3A 4WURA 2FUDA 2R9FA 1EWPA 2AUZA 2H7JA 3BOWA 4OEMA 3QSDA 3WXFA 3CBKA 4RF1A 4RKXA 3PHWA 1AU0A 3N3KA 4ZUXU 4BS6A 3RVVA 2AGAA 3OVXA 1SNKA 1AU4A 3I3TA 2VHFA 1CVZA 4OVZB 4Q8GA 4I04A 2AYOA 2HHNA 2DCBA 3B79A 4D8EA 2XU5A 3O0UA 1A6RA 1M6DA 1MS6A 4AXMA 2B1MA 2AUXA 1VJVA 3PRPA 4BOZA 1MEGA 4MZOA 4IUMA 1PBHA 1GCBA 3KSEA 1YALA 2AS8A 3OF9A 2DJFB 2CB5A 2E00A 1DEUA 1GLOA 4MI7A 1AU2A 1F2BA 2DCAA 4OVZA 1AYWA 4W5CA 5PADA 3LFYA 2YJ9A 4CDFB 3NHEA 5F02A 4D8BA 3S3RA 3H89A 4Q8HA 4QRGA 4REZA 1F2CA 1ICFA 3W31A 1AYUA 4XUIA 3B21A 6PADA 3PBHA 3KKUA 2F7DA 2YJ8A 4CDCB 1CQDA 1GMYA 1YK7A 3K24A 5CHTA 2PREA 9PAPA 1QXPA 1KXRA 4N4ZA 2XU1A 1CTEA 1ZIVA 1ME4A 3H6SA 2P86A 1YK8A 4I07A 3PDFA 2E01A 4BOSA 2G8JA 2FRAA 5JZEA 1NL6A 4BS5A 4K7CA 1DKIA 1FH0A 3V6EA 1YT7A 2BDZA 7PCKA 2YJCA 3WXEA 2DCCA 2AU1A 2G7YA 2NQIA 3H7DA 3F75A 3IHPA 4QRXA 2FE8A 4BOPA 4RNAA 2PBHA 2HH5A 2UZJA 4MM3B 3BWKA 3P5XA 2DC6A 4W4UA 4QH6A 5CVMA 1ITOA 2NQDB 3P5VA 4AXLA 2FRQA 4YVAA 3LXSA 3IUTA 3D6SA 4G54A 3PW3A 2OP3A 3CH3X 2R9OA 2B1NA 4OELA 1PIPA 1NB3A 2FO5A 2OZ2A 2Y5BA 2HD5A 3TRKA 1AYVA 1ATKA 2FTDA 5E6JA 4M0WA 3MORA 1CS8A 8PCHA 1PE6A 1AIMA 5K16A 4BQVA 3HD3A 3IV2A 3PSEA 4XR7A 5CVOB 4YYRA 1YZBA 1DF0A 2P7UA 4BSQA 1U9WA 3K8UA 4OW0A 3MHSA 5J94A 1GECE 4BOQA 1VSNA 2DZYA 4P6EA 2O6XA 4XZXA 1U9QX 2R9CA 4P6GA 1Y4HA 2P0RA 2R9NA 2NQAA 3E1ZB 3USVA 2FT2A 1AU3A 1CPJA 3OF8A 4YYUA 4X6JA 3E9SA 1PPPA 4YYQA 2BU3A 1F2AA 1XKGA 3S3QA 1QDQA 1CV8A 4HWYA 5EZSA 2ARYA 3M99A 3BCNA 3N4CA 4YV8A 3RNVA 1JQPA 2JQGR 3H8BA 1BP4A 1UKFA 4CDDB 5FPWA 1U9XA 1O0EA 5EZQA 2G6DA 1PPDA 2E02A 2DOSA 3KX1A 1YVBA 1NQCA 3IMAA 3IEJA 1K3BB 3PRMA 4N8WA 2J7QA 2GHUA 1U5IA 2AYNA 2FYEA 2YJBA 3N3GA 3K9MA 4PT5A 3U8EA
chains in the Genus database with same CATH topology
1MEMA 5CHVA 1MDWA 4YYWA 1HUCB 3QJ3A 2PADA 2VHSA 2PNSA 3PNRA 5EF4A 3ZUAA 4YYVA 4N79A 3TNXA 2FQ9A 3P5WA 2WBFX 2DC9A 2IBIA 3OVZA 2CIOA 1PXVA 3DF0A 4NV8A 4KLBA 1MHWA 1IWDA 2DJGB 3QT4A 2G8EA 1CB5A 4MZSA 1BGOA 3HHAA 1PCIA 4MSXA 3F5VA 4PP1A 2E03A 3HHIA 4DMYA 2AVWA 1AECA 3KFQA 3V6CA 3KWZA 2GFOA 2R9MA 3OISA 1PPOA 3HWNA 4WA6A 4QBBA 4FIPA 2DC7A 2F1GA 3KWBX 2HXZA 2JQFR 3BPMA 3RVWA 4QRVA 3CH2X 4FJCA 3RVXA 4BGFA 5EGWA 2ACTA 1BQIA 4W5BA 2VFCA 3BC3A 3O1GA 4X6IA 2R6NA 1ME3A 3WXGA 1EWOA 4NV7A 1THEA 1QMYA 3IOQA 1CSBB 1CJLA 2DZZA 1QOLA 2YJ2A 1NLJA 1U9VA 4RY2A 1GX3A 1KHPA 2NQGA 3D9WA 3P5UA 3I06A 2BSZA 1EF7A 3CBJA 1X9YA 1S4VA 1Q6KA 2AIMA 2Y6EA 2XU4A 1KHQA 3ERVA 2DC8A 4I05A 5CVNB 2XU3A 1NPZA 1TU6A 1STFE 5A24A 1SP4B 2C0YA 1TLOA 1Y08A 1EWMA 3AI8A 4FK5A 3MHHA 2BDLA 3MTNA 2OULA 1PPNA 4CDEB 1MIRA 2ATOA 4CZWA 1F29A 3GCBA 1KFXL 4PADA 1POPA 4PI3A 1ZCMA 3C9EA 3KW9A 1TL9A 3BPFA 4PP2E 2IPPB 1EWLA 3H8CA 2DCDA 4YYSA 1KFUL 5JA7A 4BPVA 1PADA 4X6HA 4DMXA 1NB5A 1BY8A 5JH3A 2FUDA 2R9FA 1EWPA 2AUZA 2H7JA 3BOWA 4OEMA 3QSDA 3WXFA 2VFBA 3CBKA 1AU0A 3N3KA 4ZUXU 4BS6A 3RVVA 3OVXA 1SNKA 1AU4A 3I3TA 2VHFA 1CVZA 4Q8GA 4I04A 2AYOA 2HHNA 2DCBA 3B79A 2XU5A 1W6FA 1E2TA 3O0UA 1A6RA 1M6DA 1MS6A 4AXMA 2B1MA 2AUXA 1VJVA 1MEGA 4MZOA 1PBHA 1GCBA 3KSEA 1YALA 2AS8A 3OF9A 2DJFB 2CB5A 2E00A 1DEUA 1GLOA 1W4TA 1AU2A 1F2BA 2DCAA 4W5CA 1AYWA 5PADA 3LFYA 2YJ9A 4CDFB 3NHEA 5F02A 4Q8HA 3S3RA 3H89A 4QRGA 1F2CA 1ICFA 1AYUA 4XUIA 6PADA 3PBHA 3KKUA 2F7DA 2YJ8A 4CDCB 1CQDA 1GMYA 1YK7A 3K24A 5CHTA 2PREA 9PAPA 1QXPA 1KXRA 4N4ZA 2XU1A 1CTEA 1ZIVA 1ME4A 3H6SA 2P86A 1YK8A 4I07A 3PDFA 4B55A 2E01A 2G8JA 2FRAA 1NL6A 4BS5A 4K7CA 3LTWA 3V6EA 1FH0A 1YT7A 2BDZA 7PCKA 2YJCA 3WXEA 2DCCA 2AU1A 2G7YA 2NQIA 3H7DA 3F75A 3IHPA 4QRXA 2PBHA 2HH5A 3BWKA 4W4UA 2DC6A 3P5XA 4QH6A 5CVMA 1ITOA 2NQDB 3P5VA 4AXLA 2FRQA 4YVAA 3LXSA 3IUTA 3D6SA 4G54A 3PW3A 2OP3A 3CH3X 2R9OA 2B1NA 4OELA 1PIPA 1NB3A 2FO5A 2OZ2A 2Y5BA 2HD5A 1AYVA 1ATKA 2FTDA 3MORA 1CS8A 8PCHA 1PE6A 1AIMA 5K16A 4BQVA 3HD3A 3IV2A 4XR7A 5CVOB 4YYRA 1DF0A 2P7UA 4BSQA 1U9WA 3K8UA 5J94A 3MHSA 1GECE 1VSNA 2DZYA 4P6EA 2O6XA 1W5RA 1U9QX 2R9CA 4P6GA 1Y4HA 2P0RA 2R9NA 2NQAA 3E1ZB 3USVA 2FT2A 1AU3A 1CPJA 3OF8A 4YYUA 4X6JA 1PPPA 4YYQA 1F2AA 1XKGA 3S3QA 1QDQA 1CV8A 4HWYA 2ARYA 4GUZA 3M99A 3BCNA 3N4CA 4YV8A 1JQPA 2JQGR 3H8BA 1BP4A 4CDDB 5FPWA 1U9XA 1O0EA 2G6DA 1PPDA 2E02A 4C5PA 3KX1A 1YVBA 1NQCA 3IMAA 3IEJA 1K3BB 4N8WA 2GHUA 1U5IA 2AYNA 2FYEA 2YJBA 3N3GA 3K9MA 3U8EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MEM A;  5CHV A;  1MDW A;  4YYW A;  1HUC B;  3QJ3 A;  2PAD A;  2VHS A;  2PNS A;  3PNR A;  5EF4 A;  3ZUA A;  4YYV A;  4N79 A;  3TNX A;  2FQ9 A;  3P5W A;  2WBF X;  2DC9 A;  2IBI A;  3OVZ A;  2CIO A;  1PXV A;  3DF0 A;  4KLB A;  1MHW A;  1IWD A;  2DJG B;  3QT4 A;  2G8E A;  1CB5 A;  4MZS A;  1BGO A;  3HHA A;  1PCI A;  4MSX A;  3F5V A;  4PP1 A;  2E03 A;  3HHI A;  4DMY A;  2AVW A;  1AEC A;  3KFQ A;  3V6C A;  3KWZ A;  2GFO A;  2R9M A;  3OIS A;  1PPO A;  3HWN A;  4WA6 A;  4QBB A;  4FIP A;  2DC7 A;  2F1G A;  3KWB X;  2HXZ A;  2JQF R;  3BPM A;  3RVW A;  4QRV A;  3CH2 X;  4FJC A;  3RVX A;  5EGW A;  2ACT A;  1BQI A;  4W5B A;  3BC3 A;  3O1G A;  4X6I A;  2R6N A;  1ME3 A;  3WXG A;  1EWO A;  1THE A;  1QMY A;  3IOQ A;  1CSB B;  1CJL A;  2DZZ A;  1QOL A;  2YJ2 A;  1NLJ A;  1U9V A;  4RY2 A;  1KHP A;  2NQG A;  3P5U A;  3I06 A;  1EF7 A;  3CBJ A;  1X9Y A;  1S4V A;  1Q6K A;  2AIM A;  2Y6E A;  2XU4 A;  1KHQ A;  3ERV A;  2DC8 A;  4I05 A;  5CVN B;  2XU3 A;  1NPZ A;  1TU6 A;  1STF E;  5A24 A;  1SP4 B;  2C0Y A;  1TLO A;  1Y08 A;  1EWM A;  3AI8 A;  4FK5 A;  3MHH A;  2BDL A;  3MTN A;  2OUL A;  1PPN A;  4CDE B;  1MIR A;  2ATO A;  4CZW A;  1F29 A;  3GCB A;  1KFX L;  4PAD A;  1POP A;  4PI3 A;  1ZCM A;  3C9E A;  3KW9 A;  1TL9 A;  3BPF A;  4PP2 E;  2IPP B;  1EWL A;  3H8C A;  2DCD A;  4YYS A;  1KFU L;  5JA7 A;  4BPV A;  1PAD A;  4X6H A;  4DMX A;  1NB5 A;  1BY8 A;  5JH3 A;  2FUD A;  2R9F A;  1EWP A;  2AUZ A;  2H7J A;  3BOW A;  4OEM A;  3QSD A;  3WXF A;  3CBK A;  1AU0 A;  3N3K A;  4ZUX U;  4BS6 A;  3RVV A;  3OVX A;  1SNK A;  1AU4 A;  3I3T A;  2VHF A;  1CVZ A;  4Q8G A;  4I04 A;  2AYO A;  2HHN A;  2DCB A;  3B79 A;  2XU5 A;  3O0U A;  1A6R A;  1M6D A;  1MS6 A;  4AXM A;  2B1M A;  2AUX A;  1VJV A;  1MEG A;  4MZO A;  1PBH A;  1GCB A;  3KSE A;  1YAL A;  2AS8 A;  3OF9 A;  2DJF B;  2CB5 A;  2E00 A;  1DEU A;  1GLO A;  1AU2 A;  1F2B A;  2DCA A;  4W5C A;  1AYW A;  5PAD A;  3LFY A;  2YJ9 A;  4CDF B;  3NHE A;  5F02 A;  4Q8H A;  3S3R A;  3H89 A;  4QRG A;  1F2C A;  1ICF A;  1AYU A;  4XUI A;  6PAD A;  3PBH A;  3KKU A;  2F7D A;  2YJ8 A;  4CDC B;  1CQD A;  1GMY A;  1YK7 A;  3K24 A;  5CHT A;  2PRE A;  9PAP A;  1QXP A;  1KXR A;  4N4Z A;  2XU1 A;  1CTE A;  1ZIV A;  1ME4 A;  3H6S A;  2P86 A;  1YK8 A;  4I07 A;  3PDF A;  2E01 A;  2G8J A;  2FRA A;  1NL6 A;  4BS5 A;  4K7C A;  3V6E A;  1FH0 A;  1YT7 A;  2BDZ A;  7PCK A;  2YJC A;  3WXE A;  2DCC A;  2AU1 A;  2G7Y A;  2NQI A;  3H7D A;  3F75 A;  3IHP A;  4QRX A;  2PBH A;  2HH5 A;  3BWK A;  4W4U A;  2DC6 A;  3P5X A;  4QH6 A;  5CVM A;  1ITO A;  2NQD B;  3P5V A;  4AXL A;  2FRQ A;  4YVA A;  3LXS A;  3IUT A;  3D6S A;  4G54 A;  3PW3 A;  2OP3 A;  3CH3 X;  2R9O A;  2B1N A;  4OEL A;  1PIP A;  1NB3 A;  2FO5 A;  2OZ2 A;  2Y5B A;  2HD5 A;  1AYV A;  1ATK A;  2FTD A;  3MOR A;  1CS8 A;  8PCH A;  1PE6 A;  1AIM A;  5K16 A;  4BQV A;  3HD3 A;  3IV2 A;  4XR7 A;  5CVO B;  4YYR A;  1DF0 A;  2P7U A;  4BSQ A;  1U9W A;  3K8U A;  5J94 A;  3MHS A;  1GEC E;  1VSN A;  2DZY A;  4P6E A;  2O6X A;  1U9Q X;  2R9C A;  4P6G A;  1Y4H A;  2P0R A;  2R9N A;  2NQA A;  3E1Z B;  3USV A;  2FT2 A;  1AU3 A;  1CPJ A;  3OF8 A;  4YYU A;  4X6J A;  1PPP A;  4YYQ A;  1F2A A;  1XKG A;  3S3Q A;  1QDQ A;  1CV8 A;  4HWY A;  2ARY A;  3M99 A;  3BCN A;  3N4C A;  4YV8 A;  1JQP A;  2JQG R;  3H8B A;  1BP4 A;  4CDD B;  5FPW A;  1U9X A;  1O0E A;  2G6D A;  1PPD A;  2E02 A;  3KX1 A;  1YVB A;  1NQC A;  3IMA A;  3IEJ A;  1K3B B;  4N8W A;  2GHU A;  1U5I A;  2AYN A;  2FYE A;  2YJB A;  3N3G A;  3K9M A;  3U8E A; 
#chains in the Genus database with same CATH topology
 1MEM A;  5CHV A;  1MDW A;  4YYW A;  1HUC B;  3QJ3 A;  3PHX A;  2PAD A;  2VHS A;  3OQC A;  2PNS A;  3PNR A;  5EF4 A;  3ZUA A;  4YYV A;  4N79 A;  3TNX A;  2FQ9 A;  4BOU A;  3P5W A;  2BTW B;  2WBF X;  2DC9 A;  2IBI A;  3OVZ A;  2CIO A;  1PXV A;  3DF0 A;  4KLB A;  2J7Q C;  1MHW A;  1IWD A;  3QT4 A;  2DJG B;  2G8E A;  1CB5 A;  4MZS A;  4ZTB A;  1BGO A;  3HHA A;  1PCI A;  4MSX A;  3F5V A;  4PP1 A;  2E03 A;  3HHI A;  4DMY A;  2AVW A;  1AEC A;  5KO3 A;  3KFQ A;  3V6C A;  3KWZ A;  3O65 A;  4RF0 A;  2GFO A;  2R9M A;  4A5U A;  3MTV A;  3OIS A;  1PPO A;  3HWN A;  4WA6 A;  4QBB A;  1PVJ A;  4FIP A;  2HWK A;  2DC7 A;  2F1G A;  3KWB X;  3W30 A;  2HXZ A;  2JQF R;  3BPM A;  3RVW A;  4QRV A;  3CH2 X;  4FJC A;  3IFU A;  3RVX A;  5EGW A;  2ACT A;  1BQI A;  4W5B A;  3BC3 A;  3PHU A;  3ZNH A;  3O1G A;  4X6I A;  2R6N A;  1ME3 A;  3WXG A;  1EWO A;  1THE A;  4IP3 A;  1QMY A;  3IOQ A;  1CSB B;  1CJL A;  2DZZ A;  3BB7 A;  1QOL A;  2YJ2 A;  1NLJ A;  1U9V A;  4RY2 A;  1KHP A;  3BY4 A;  2NQG A;  3P5U A;  3I06 A;  1EF7 A;  3CBJ A;  1X9Y A;  3MP2 A;  2JTC A;  1S4V A;  1Q6K A;  2AIM A;  4R3D A;  2Y6E A;  2XU4 A;  1KHQ A;  3ERV A;  2DC8 A;  4I05 A;  5CVN B;  2XU3 A;  1NPZ A;  1TU6 A;  1STF E;  5A24 A;  1SP4 B;  2C0Y A;  1TLO A;  1Y08 A;  1EWM A;  3AI8 A;  2Z84 A;  3BBA A;  3PT2 A;  4FK5 A;  2JRI A;  4D8I A;  3MHH A;  2BDL A;  3MTN A;  3TMP A;  2OUL A;  3C0R A;  1PPN A;  4CDE B;  1MIR A;  4HXD B;  2ATO A;  4CZW A;  1F29 A;  4P16 A;  3GCB A;  1KFX L;  4PAD A;  2BTW A;  1POP A;  4PI3 A;  1ZCM A;  3C9E A;  3KW9 A;  4GUA A;  1TL9 A;  3BPF A;  2IPP B;  4PP2 E;  1EWL A;  3H8C A;  2DCD A;  3MJ5 A;  4YYS A;  1KFU L;  5JA7 A;  4BPV A;  1PAD A;  4X6H A;  4DMX A;  1NB5 A;  1BY8 A;  5JH3 A;  4WUR A;  2FUD A;  2R9F A;  1EWP A;  2AUZ A;  2H7J A;  3BOW A;  4OEM A;  3QSD A;  3WXF A;  3CBK A;  4RF1 A;  4RKX A;  3PHW A;  1AU0 A;  3N3K A;  4ZUX U;  4BS6 A;  3RVV A;  2AGA A;  3OVX A;  1SNK A;  1AU4 A;  3I3T A;  2VHF A;  1CVZ A;  4OVZ B;  4Q8G A;  4I04 A;  2AYO A;  2HHN A;  2DCB A;  3B79 A;  4D8E A;  2XU5 A;  3O0U A;  1A6R A;  1M6D A;  1MS6 A;  4AXM A;  2B1M A;  2AUX A;  1VJV A;  3PRP A;  4BOZ A;  1MEG A;  4MZO A;  4IUM A;  1PBH A;  1GCB A;  3KSE A;  1YAL A;  2AS8 A;  3OF9 A;  2DJF B;  2CB5 A;  2E00 A;  1DEU A;  1GLO A;  4MI7 A;  1AU2 A;  1F2B A;  2DCA A;  4OVZ A;  1AYW A;  4W5C A;  5PAD A;  3LFY A;  2YJ9 A;  4CDF B;  3NHE A;  5F02 A;  4D8B A;  3S3R A;  3H89 A;  4Q8H A;  4QRG A;  4REZ A;  1F2C A;  1ICF A;  3W31 A;  1AYU A;  4XUI A;  3B21 A;  6PAD A;  3PBH A;  3KKU A;  2F7D A;  2YJ8 A;  4CDC B;  1CQD A;  1GMY A;  1YK7 A;  3K24 A;  5CHT A;  2PRE A;  9PAP A;  1QXP A;  1KXR A;  4N4Z A;  2XU1 A;  1CTE A;  1ZIV A;  1ME4 A;  3H6S A;  2P86 A;  1YK8 A;  4I07 A;  3PDF A;  2E01 A;  4BOS A;  2G8J A;  2FRA A;  5JZE A;  1NL6 A;  4BS5 A;  4K7C A;  1DKI A;  1FH0 A;  3V6E A;  1YT7 A;  2BDZ A;  7PCK A;  2YJC A;  3WXE A;  2DCC A;  2AU1 A;  2G7Y A;  2NQI A;  3H7D A;  3F75 A;  3IHP A;  4QRX A;  2FE8 A;  4BOP A;  4RNA A;  2PBH A;  2HH5 A;  2UZJ A;  4MM3 B;  3BWK A;  3P5X A;  2DC6 A;  4W4U A;  4QH6 A;  5CVM A;  1ITO A;  2NQD B;  3P5V A;  4AXL A;  2FRQ A;  4YVA A;  3LXS A;  3IUT A;  3D6S A;  4G54 A;  3PW3 A;  2OP3 A;  3CH3 X;  2R9O A;  2B1N A;  4OEL A;  1PIP A;  1NB3 A;  2FO5 A;  2OZ2 A;  2Y5B A;  2HD5 A;  3TRK A;  1AYV A;  1ATK A;  2FTD A;  5E6J A;  4M0W A;  3MOR A;  1CS8 A;  8PCH A;  1PE6 A;  1AIM A;  5K16 A;  4BQV A;  3HD3 A;  3IV2 A;  3PSE A;  4XR7 A;  5CVO B;  4YYR A;  1YZB A;  1DF0 A;  2P7U A;  4BSQ A;  1U9W A;  3K8U A;  4OW0 A;  3MHS A;  5J94 A;  1GEC E;  4BOQ A;  1VSN A;  2DZY A;  4P6E A;  2O6X A;  4XZX A;  1U9Q X;  2R9C A;  4P6G A;  1Y4H A;  2P0R A;  2R9N A;  2NQA A;  3E1Z B;  3USV A;  2FT2 A;  1AU3 A;  1CPJ A;  3OF8 A;  4YYU A;  4X6J A;  3E9S A;  1PPP A;  4YYQ A;  2BU3 A;  1F2A A;  1XKG A;  3S3Q A;  1QDQ A;  1CV8 A;  4HWY A;  5EZS A;  2ARY A;  3M99 A;  3BCN A;  3N4C A;  4YV8 A;  3RNV A;  1JQP A;  2JQG R;  3H8B A;  1BP4 A;  1UKF A;  4CDD B;  5FPW A;  1U9X A;  1O0E A;  5EZQ A;  2G6D A;  1PPD A;  2E02 A;  2DOS A;  3KX1 A;  1YVB A;  1NQC A;  3IMA A;  3IEJ A;  1K3B B;  3PRM A;  4N8W A;  2J7Q A;  2GHU A;  1U5I A;  2AYN A;  2FYE A;  2YJB A;  3N3G A;  3K9M A;  4PT5 A;  3U8E A; 
#chains in the Genus database with same CATH homology
 1MEM A;  5CHV A;  1MDW A;  4YYW A;  1HUC B;  3QJ3 A;  2PAD A;  2VHS A;  2PNS A;  3PNR A;  5EF4 A;  3ZUA A;  4YYV A;  4N79 A;  3TNX A;  2FQ9 A;  3P5W A;  2WBF X;  2DC9 A;  2IBI A;  3OVZ A;  2CIO A;  1PXV A;  3DF0 A;  4NV8 A;  4KLB A;  1MHW A;  1IWD A;  2DJG B;  3QT4 A;  2G8E A;  1CB5 A;  4MZS A;  1BGO A;  3HHA A;  1PCI A;  4MSX A;  3F5V A;  4PP1 A;  2E03 A;  3HHI A;  4DMY A;  2AVW A;  1AEC A;  3KFQ A;  3V6C A;  3KWZ A;  2GFO A;  2R9M A;  3OIS A;  1PPO A;  3HWN A;  4WA6 A;  4QBB A;  4FIP A;  2DC7 A;  2F1G A;  3KWB X;  2HXZ A;  2JQF R;  3BPM A;  3RVW A;  4QRV A;  3CH2 X;  4FJC A;  3RVX A;  4BGF A;  5EGW A;  2ACT A;  1BQI A;  4W5B A;  2VFC A;  3BC3 A;  3O1G A;  4X6I A;  2R6N A;  1ME3 A;  3WXG A;  1EWO A;  4NV7 A;  1THE A;  1QMY A;  3IOQ A;  1CSB B;  1CJL A;  2DZZ A;  1QOL A;  2YJ2 A;  1NLJ A;  1U9V A;  4RY2 A;  1GX3 A;  1KHP A;  2NQG A;  3D9W A;  3P5U A;  3I06 A;  2BSZ A;  1EF7 A;  3CBJ A;  1X9Y A;  1S4V A;  1Q6K A;  2AIM A;  2Y6E A;  2XU4 A;  1KHQ A;  3ERV A;  2DC8 A;  4I05 A;  5CVN B;  2XU3 A;  1NPZ A;  1TU6 A;  1STF E;  5A24 A;  1SP4 B;  2C0Y A;  1TLO A;  1Y08 A;  1EWM A;  3AI8 A;  4FK5 A;  3MHH A;  2BDL A;  3MTN A;  2OUL A;  1PPN A;  4CDE B;  1MIR A;  2ATO A;  4CZW A;  1F29 A;  3GCB A;  1KFX L;  4PAD A;  1POP A;  4PI3 A;  1ZCM A;  3C9E A;  3KW9 A;  1TL9 A;  3BPF A;  4PP2 E;  2IPP B;  1EWL A;  3H8C A;  2DCD A;  4YYS A;  1KFU L;  5JA7 A;  4BPV A;  1PAD A;  4X6H A;  4DMX A;  1NB5 A;  1BY8 A;  5JH3 A;  2FUD A;  2R9F A;  1EWP A;  2AUZ A;  2H7J A;  3BOW A;  4OEM A;  3QSD A;  3WXF A;  2VFB A;  3CBK A;  1AU0 A;  3N3K A;  4ZUX U;  4BS6 A;  3RVV A;  3OVX A;  1SNK A;  1AU4 A;  3I3T A;  2VHF A;  1CVZ A;  4Q8G A;  4I04 A;  2AYO A;  2HHN A;  2DCB A;  3B79 A;  2XU5 A;  1W6F A;  1E2T A;  3O0U A;  1A6R A;  1M6D A;  1MS6 A;  4AXM A;  2B1M A;  2AUX A;  1VJV A;  1MEG A;  4MZO A;  1PBH A;  1GCB A;  3KSE A;  1YAL A;  2AS8 A;  3OF9 A;  2DJF B;  2CB5 A;  2E00 A;  1DEU A;  1GLO A;  1W4T A;  1AU2 A;  1F2B A;  2DCA A;  4W5C A;  1AYW A;  5PAD A;  3LFY A;  2YJ9 A;  4CDF B;  3NHE A;  5F02 A;  4Q8H A;  3S3R A;  3H89 A;  4QRG A;  1F2C A;  1ICF A;  1AYU A;  4XUI A;  6PAD A;  3PBH A;  3KKU A;  2F7D A;  2YJ8 A;  4CDC B;  1CQD A;  1GMY A;  1YK7 A;  3K24 A;  5CHT A;  2PRE A;  9PAP A;  1QXP A;  1KXR A;  4N4Z A;  2XU1 A;  1CTE A;  1ZIV A;  1ME4 A;  3H6S A;  2P86 A;  1YK8 A;  4I07 A;  3PDF A;  4B55 A;  2E01 A;  2G8J A;  2FRA A;  1NL6 A;  4BS5 A;  4K7C A;  3LTW A;  3V6E A;  1FH0 A;  1YT7 A;  2BDZ A;  7PCK A;  2YJC A;  3WXE A;  2DCC A;  2AU1 A;  2G7Y A;  2NQI A;  3H7D A;  3F75 A;  3IHP A;  4QRX A;  2PBH A;  2HH5 A;  3BWK A;  4W4U A;  2DC6 A;  3P5X A;  4QH6 A;  5CVM A;  1ITO A;  2NQD B;  3P5V A;  4AXL A;  2FRQ A;  4YVA A;  3LXS A;  3IUT A;  3D6S A;  4G54 A;  3PW3 A;  2OP3 A;  3CH3 X;  2R9O A;  2B1N A;  4OEL A;  1PIP A;  1NB3 A;  2FO5 A;  2OZ2 A;  2Y5B A;  2HD5 A;  1AYV A;  1ATK A;  2FTD A;  3MOR A;  1CS8 A;  8PCH A;  1PE6 A;  1AIM A;  5K16 A;  4BQV A;  3HD3 A;  3IV2 A;  4XR7 A;  5CVO B;  4YYR A;  1DF0 A;  2P7U A;  4BSQ A;  1U9W A;  3K8U A;  5J94 A;  3MHS A;  1GEC E;  1VSN A;  2DZY A;  4P6E A;  2O6X A;  1W5R A;  1U9Q X;  2R9C A;  4P6G A;  1Y4H A;  2P0R A;  2R9N A;  2NQA A;  3E1Z B;  3USV A;  2FT2 A;  1AU3 A;  1CPJ A;  3OF8 A;  4YYU A;  4X6J A;  1PPP A;  4YYQ A;  1F2A A;  1XKG A;  3S3Q A;  1QDQ A;  1CV8 A;  4HWY A;  2ARY A;  4GUZ A;  3M99 A;  3BCN A;  3N4C A;  4YV8 A;  1JQP A;  2JQG R;  3H8B A;  1BP4 A;  4CDD B;  5FPW A;  1U9X A;  1O0E A;  2G6D A;  1PPD A;  2E02 A;  4C5P A;  3KX1 A;  1YVB A;  1NQC A;  3IMA A;  3IEJ A;  1K3B B;  4N8W A;  2GHU A;  1U5I A;  2AYN A;  2FYE A;  2YJB A;  3N3G A;  3K9M A;  3U8E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...