2BTWA

Crystal structure of alr0975
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
210
structure length
210
Chain Sequence
LSPNLIGFNSNEGEKLLLTSRSREDFFPLSMQFVTQVNQAYCGVASIIMVLNSLGINAPETAQYSPYRVFTQDNFFSNEKTKAVIAPEVVARQGMTLDELGRLIASYGVKVKVNHASDTNIEDFRKQVAENLKQDGNFVIVNYLRKEIGQERGGHISPLAAYNEQTDRFLIMDVSRYKYPPVWVKTTDLWKAMNTVDSVSQKTRGFVFVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Papain-Like Enzyme at Work: Native and Acyl- Enzyme Intermediate Structures in Phytochelatin Synthesis.
pubmed doi rcsb
source organism Anabaena sp.
molecule tags Transferase
molecule keywords ALR0975 PROTEIN
total genus 65
structure length 210
sequence length 210
ec nomenclature ec 2.3.2.15: Glutathione gamma-glutamylcysteinyltransferase.
pdb deposition date 2005-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05023 Phytochelatin Phytochelatin synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.30 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 2btwA00
2BTWA 2BTWB 2BU3A
chains in the Genus database with same CATH superfamily
4FK5A 4DMXA 2PBHA 4CDDB 4BOQA 2DCBA 1HUCB 4RF1A 1TL9A 1AU2A 2R9NA 7PCKA 2R9FA 2FUDA 3I06A 4YYUA 1A6RA 8PCHA 1ME4A 1MHWA 2BU3A 2ACTA 4BOZA 4PI3A 1TLOA 1Q6KA 2YJ8A 2DZYA 4X6JA 4YYQA 2Y6EA 2FE8A 4I05A 5J94A 3MHSA 3K8UA 1Y4HA 1CV8A 1CJLA 2DC9A 5K16A 2UZJA 3H89A 4YV8A 3RVVA 3CH3X 4YYVA 3USVA 4MZOA 3BPFA 3KWBX 4BS6A 5EZSA 1NLJA 5E6JA 4P6GA 1U5IA 4D8EA 4HXDB 4DMYA 1CB5A 2G7YA 1ZCMA 1KHQA 4PP2E 4P16A 4WA6A 5JA7A 2NQDB 4ZTBA 3RNVA 1QMYA 2AYOA 2E03A 3TNXA 3O65A 2XU5A 2AUZA 3IOQA 2ATOA 2AS8A 2DCAA 2E00A 2JTCA 4YVAA 3GCBA 4YYWA 2FRQA 1PPDA 1CS8A 2OZ2A 2NQAA 4BOSA 1STFE 2DZZA 2JRIA 3LFYA 1YVBA 4W5BA 4N4ZA 1PXVA 1THEA 3CBKA 3IFUA 4HWYA 4A5UA 3OVZA 3PHWA 4R3DA 3HHAA 4BOPA 4D8IA 4RF0A 1U9XA 1MIRA 2BDZA 3KFQA 2NQIA 2WBFX 5CVOB 1AECA 1XKGA 3PW3A 4CDFB 2PREA 1EWMA 4FIPA 4Q8GA 3H8BA 5EGWA 9PAPA 2FTDA 3H6SA 1F2AA 3S3QA 3PSEA 2YJ2A 1F2CA 3HHIA 1NPZA 2G8JA 3ZUAA 2P0RA 3N3GA 1KXRA 3ERVA 3K24A 5CHVA 1DEUA 1SNKA 5FPWA 4OEMA 4BS5A 2XU1A 4MSXA 4BPVA 1QXPA 4QBBA 1GLOA 2Y5BA 3IV2A 5CHTA 2IBIA 1VJVA 4PT5A 5CVMA 2BTWB 4Q8HA 2ARYA 2DC7A 4RKXA 2YJCA 3BPMA 4OW0A 4QRXA 2VHSA 1S4VA 4N79A 2FQ9A 2G8EA 1O0EA 2J7QA 2JQFR 4MM3B 4W5CA 3MTVA 1POPA 2YJBA 3QSDA 2NQGA 1ZIVA 1F2BA 2FRAA 3I3TA 3CH2X 3OVXA 1MEGA 1EWLA 2C0YA 1NB5A 2DC8A 1CVZA 2DJGB 3PHXA 1ME3A 2E02A 3BWKA 1YALA 4AXLA 1PADA 1EF7A 3K9MA 4X6HA 3PNRA 3OF9A 1MS6A 1M6DA 2PNSA 2XU4A 3P5UA 1AU4A 2AU1A 2JQGR 2BTWA 4W4UA 1AYWA 3C0RA 1ITOA 3V6CA 1KFXL 5F02A 1ICFA 1BQIA 2PADA 3QT4A 1QOLA 3WXFA 4RNAA 1NL6A 3PRMA 4YYRA 4P6EA 4I07A 4MZSA 3TMPA 3RVWA 4XZXA 1U9WA 3BY4A 3BBAA 4CZWA 1AYUA 1PE6A 2DCCA 3E9SA 1BGOA 1BP4A 4QRVA 5EZQA 1DKIA 2GHUA 2HHNA 3BB7A 3M99A 2Z84A 1PCIA 2YJ9A 3HWNA 3KKUA 3N4CA 3KWZA 1AYVA 3ZNHA 3OISA 3O0UA 4N8WA 4D8BA 4K7CA 1K3BB 3P5VA 4BSQA 3OQCA 4REZA 4FJCA 3TRKA 1MEMA 3W31A 3P5WA 3MORA 1AU0A 2HD5A 3QJ3A 2FT2A 2XU3A 3V6EA 3P5XA 3PHUA 4PADA 4AXMA 5KO3A 2HXZA 3BC3A 1SP4B 1DF0A 4XUIA 2R9OA 4PP1A 2F7DA 2OULA 3KW9A 3B79A 3HD3A 1KHPA 2B1MA 1YZBA 3IEJA 4BQVA 4IP3A 3RVXA 2R9CA 4MI7A 3N3KA 4X6IA 1Y08A 1GECE 4I04A 1IWDA 1UKFA 3BCNA 1VSNA 3IUTA 2P86A 2J7QC 1PPOA 2CIOA 2R9MA 2GFOA 1YK7A 4ZUXU 1CSBB 1CQDA 3F75A 2E01A 1PIPA 1PVJA 2O6XA 3B21A 3PBHA 5JH3A 3OF8A 2CB5A 1YT7A 1PPPA 1F29A 1PBHA 3S3RA 1CPJA 2DCDA 3WXGA 2AGAA 3MHHA 2OP3A 4CDCB 4QRGA 4WURA 1KFUL 1YK8A 1GMYA 4QH6A 3BOWA 1NQCA 5PADA 3W30A 1U9QX 2R6NA 2B1NA 3D6SA 4CDEB 2FO5A 2AIMA 1JQPA 1X9YA 3DF0A 4OVZB 2HWKA 3LXSA 1NB3A 3U8EA 4IUMA 4OELA 4GUAA 5EF4A 1BY8A 1EWOA 2AVWA 3O1GA 2FYEA 4BOUA 4G54A 1ATKA 1QDQA 3KSEA 2HH5A 2AYNA 1AU3A 4M0WA 3PT2A 3F5VA 1U9VA 2IPPB 1PPNA 4XR7A 2DC6A 6PADA 3PRPA 5JZEA 1MDWA 3IMAA 3MJ5A 1CTEA 2P7UA 4KLBA 1FH0A 3KX1A 4RY2A 3H7DA 5A24A 1TU6A 3H8CA 2DJFB 2G6DA 2BDLA 2H7JA 5CVNB 4OVZA 3C9EA 3MTNA 1GCBA 3E1ZB 2VHFA 3CBJA 2DOSA 3IHPA 3WXEA 3NHEA 2AUXA 2F1GA 4YYSA 1AIMA 3PDFA 1EWPA 3MP2A 3AI8A
chains in the Genus database with same CATH topology
4HXDB 2BTWA 4BOSA 4BOQA 1YZBA 4XZXA 3C0RA 4P16A 3W30A 4RF1A 4D8BA 3OQCA 1PVJA 3B21A 3BY4A 2JRIA 3PHXA 4IP3A 4OVZA 3BBAA 4REZA 3TRKA 3W31A 4MI7A 3IFUA 4ZTBA 2UZJA 4A5UA 2BU3A 3E9SA 3RNVA 3PHWA 2J7QA 4M0WA 4OVZB 4R3DA 2DOSA 2HWKA 3PT2A 4D8EA 5EZQA 3O65A 4MM3B 4RF0A 4BOPA 1DKIA 4BOZA 4D8IA 1UKFA 3MTVA 3PSEA 4IUMA 4RNAA 3BB7A 3PHUA 4PT5A 2Z84A 3PRMA 5E6JA 2AGAA 5EZSA 2J7QC 4GUAA 5KO3A 2FE8A 2BTWB 2JTCA 3PRPA 5JZEA 3ZNHA 4WURA 3MJ5A 3MP2A 4RKXA 3TMPA 4OW0A 4BOUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BTW A;  2BTW B;  2BU3 A; 
#chains in the Genus database with same CATH topology
 4FK5 A;  4DMX A;  2PBH A;  4CDD B;  4BOQ A;  2DCB A;  1HUC B;  4RF1 A;  1TL9 A;  1AU2 A;  2R9N A;  7PCK A;  2R9F A;  2FUD A;  3I06 A;  4YYU A;  1A6R A;  8PCH A;  1ME4 A;  1MHW A;  2BU3 A;  2ACT A;  4BOZ A;  4PI3 A;  1TLO A;  1Q6K A;  2YJ8 A;  2DZY A;  4X6J A;  4YYQ A;  2Y6E A;  2FE8 A;  4I05 A;  5J94 A;  3MHS A;  3K8U A;  1Y4H A;  1CV8 A;  1CJL A;  2DC9 A;  5K16 A;  2UZJ A;  3H89 A;  4YV8 A;  3RVV A;  3CH3 X;  4YYV A;  3USV A;  4MZO A;  3BPF A;  3KWB X;  4BS6 A;  5EZS A;  1NLJ A;  5E6J A;  4P6G A;  1U5I A;  4D8E A;  4HXD B;  4DMY A;  1CB5 A;  2G7Y A;  1ZCM A;  1KHQ A;  4PP2 E;  4P16 A;  4WA6 A;  5JA7 A;  2NQD B;  4ZTB A;  3RNV A;  1QMY A;  2AYO A;  2E03 A;  3TNX A;  3O65 A;  2XU5 A;  2AUZ A;  3IOQ A;  2ATO A;  2AS8 A;  2DCA A;  2E00 A;  2JTC A;  4YVA A;  3GCB A;  4YYW A;  2FRQ A;  1PPD A;  1CS8 A;  2OZ2 A;  2NQA A;  4BOS A;  1STF E;  2DZZ A;  2JRI A;  3LFY A;  1YVB A;  4W5B A;  4N4Z A;  1PXV A;  1THE A;  3CBK A;  3IFU A;  4HWY A;  4A5U A;  3OVZ A;  3PHW A;  4R3D A;  3HHA A;  4BOP A;  4D8I A;  4RF0 A;  1U9X A;  1MIR A;  2BDZ A;  3KFQ A;  2NQI A;  2WBF X;  5CVO B;  1AEC A;  1XKG A;  3PW3 A;  4CDF B;  2PRE A;  1EWM A;  4FIP A;  4Q8G A;  3H8B A;  5EGW A;  9PAP A;  2FTD A;  3H6S A;  1F2A A;  3S3Q A;  3PSE A;  2YJ2 A;  1F2C A;  3HHI A;  1NPZ A;  2G8J A;  3ZUA A;  2P0R A;  3N3G A;  1KXR A;  3ERV A;  3K24 A;  5CHV A;  1DEU A;  1SNK A;  5FPW A;  4OEM A;  4BS5 A;  2XU1 A;  4MSX A;  4BPV A;  1QXP A;  4QBB A;  1GLO A;  2Y5B A;  3IV2 A;  5CHT A;  2IBI A;  1VJV A;  4PT5 A;  5CVM A;  2BTW B;  4Q8H A;  2ARY A;  2DC7 A;  4RKX A;  2YJC A;  3BPM A;  4OW0 A;  4QRX A;  2VHS A;  1S4V A;  4N79 A;  2FQ9 A;  2G8E A;  1O0E A;  2J7Q A;  2JQF R;  4MM3 B;  4W5C A;  3MTV A;  1POP A;  2YJB A;  3QSD A;  2NQG A;  1ZIV A;  1F2B A;  2FRA A;  3I3T A;  3CH2 X;  3OVX A;  1MEG A;  1EWL A;  2C0Y A;  1NB5 A;  2DC8 A;  1CVZ A;  2DJG B;  3PHX A;  1ME3 A;  2E02 A;  3BWK A;  1YAL A;  4AXL A;  1PAD A;  1EF7 A;  3K9M A;  4X6H A;  3PNR A;  3OF9 A;  1MS6 A;  1M6D A;  2PNS A;  2XU4 A;  3P5U A;  1AU4 A;  2AU1 A;  2JQG R;  2BTW A;  4W4U A;  1AYW A;  3C0R A;  1ITO A;  3V6C A;  1KFX L;  5F02 A;  1ICF A;  1BQI A;  2PAD A;  3QT4 A;  1QOL A;  3WXF A;  4RNA A;  1NL6 A;  3PRM A;  4YYR A;  4P6E A;  4I07 A;  4MZS A;  3TMP A;  3RVW A;  4XZX A;  1U9W A;  3BY4 A;  3BBA A;  4CZW A;  1AYU A;  1PE6 A;  2DCC A;  3E9S A;  1BGO A;  1BP4 A;  4QRV A;  5EZQ A;  1DKI A;  2GHU A;  2HHN A;  3BB7 A;  3M99 A;  2Z84 A;  1PCI A;  2YJ9 A;  3HWN A;  3KKU A;  3N4C A;  3KWZ A;  1AYV A;  3ZNH A;  3OIS A;  3O0U A;  4N8W A;  4D8B A;  4K7C A;  1K3B B;  3P5V A;  4BSQ A;  3OQC A;  4REZ A;  4FJC A;  3TRK A;  1MEM A;  3W31 A;  3P5W A;  3MOR A;  1AU0 A;  2HD5 A;  3QJ3 A;  2FT2 A;  2XU3 A;  3V6E A;  3P5X A;  3PHU A;  4PAD A;  4AXM A;  5KO3 A;  2HXZ A;  3BC3 A;  1SP4 B;  1DF0 A;  4XUI A;  2R9O A;  4PP1 A;  2F7D A;  2OUL A;  3KW9 A;  3B79 A;  3HD3 A;  1KHP A;  2B1M A;  1YZB A;  3IEJ A;  4BQV A;  4IP3 A;  3RVX A;  2R9C A;  4MI7 A;  3N3K A;  4X6I A;  1Y08 A;  1GEC E;  4I04 A;  1IWD A;  1UKF A;  3BCN A;  1VSN A;  3IUT A;  2P86 A;  2J7Q C;  1PPO A;  2CIO A;  2R9M A;  2GFO A;  1YK7 A;  4ZUX U;  1CSB B;  1CQD A;  3F75 A;  2E01 A;  1PIP A;  1PVJ A;  2O6X A;  3B21 A;  3PBH A;  5JH3 A;  3OF8 A;  2CB5 A;  1YT7 A;  1PPP A;  1F29 A;  1PBH A;  3S3R A;  1CPJ A;  2DCD A;  3WXG A;  2AGA A;  3MHH A;  2OP3 A;  4CDC B;  4QRG A;  4WUR A;  1KFU L;  1YK8 A;  1GMY A;  4QH6 A;  3BOW A;  1NQC A;  5PAD A;  3W30 A;  1U9Q X;  2R6N A;  2B1N A;  3D6S A;  4CDE B;  2FO5 A;  2AIM A;  1JQP A;  1X9Y A;  3DF0 A;  4OVZ B;  2HWK A;  3LXS A;  1NB3 A;  3U8E A;  4IUM A;  4OEL A;  4GUA A;  5EF4 A;  1BY8 A;  1EWO A;  2AVW A;  3O1G A;  2FYE A;  4BOU A;  4G54 A;  1ATK A;  1QDQ A;  3KSE A;  2HH5 A;  2AYN A;  1AU3 A;  4M0W A;  3PT2 A;  3F5V A;  1U9V A;  2IPP B;  1PPN A;  4XR7 A;  2DC6 A;  6PAD A;  3PRP A;  5JZE A;  1MDW A;  3IMA A;  3MJ5 A;  1CTE A;  2P7U A;  4KLB A;  1FH0 A;  3KX1 A;  4RY2 A;  3H7D A;  5A24 A;  1TU6 A;  3H8C A;  2DJF B;  2G6D A;  2BDL A;  2H7J A;  5CVN B;  4OVZ A;  3C9E A;  3MTN A;  1GCB A;  3E1Z B;  2VHF A;  3CBJ A;  2DOS A;  3IHP A;  3WXE A;  3NHE A;  2AUX A;  2F1G A;  4YYS A;  1AIM A;  3PDF A;  1EWP A;  3MP2 A;  3AI8 A; 
#chains in the Genus database with same CATH homology
 4HXD B;  2BTW A;  4BOS A;  4BOQ A;  1YZB A;  4XZX A;  3C0R A;  4P16 A;  3W30 A;  4RF1 A;  4D8B A;  3OQC A;  1PVJ A;  3B21 A;  3BY4 A;  2JRI A;  3PHX A;  4IP3 A;  4OVZ A;  3BBA A;  4REZ A;  3TRK A;  3W31 A;  4MI7 A;  3IFU A;  4ZTB A;  2UZJ A;  4A5U A;  2BU3 A;  3E9S A;  3RNV A;  3PHW A;  2J7Q A;  4M0W A;  4OVZ B;  4R3D A;  2DOS A;  2HWK A;  3PT2 A;  4D8E A;  5EZQ A;  3O65 A;  4MM3 B;  4RF0 A;  4BOP A;  1DKI A;  4BOZ A;  4D8I A;  1UKF A;  3MTV A;  3PSE A;  4IUM A;  4RNA A;  3BB7 A;  3PHU A;  4PT5 A;  2Z84 A;  3PRM A;  5E6J A;  2AGA A;  5EZS A;  2J7Q C;  4GUA A;  5KO3 A;  2FE8 A;  2BTW B;  2JTC A;  3PRP A;  5JZE A;  3ZNH A;  4WUR A;  3MJ5 A;  3MP2 A;  4RKX A;  3TMP A;  4OW0 A;  4BOU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...