2BTWA

Crystal structure of alr0975
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
210
structure length
210
Chain Sequence
LSPNLIGFNSNEGEKLLLTSRSREDFFPLSMQFVTQVNQAYCGVASIIMVLNSLGINAPETAQYSPYRVFTQDNFFSNEKTKAVIAPEVVARQGMTLDELGRLIASYGVKVKVNHASDTNIEDFRKQVAENLKQDGNFVIVNYLRKEIGQERGGHISPLAAYNEQTDRFLIMDVSRYKYPPVWVKTTDLWKAMNTVDSVSQKTRGFVFVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Papain-Like Enzyme at Work: Native and Acyl- Enzyme Intermediate Structures in Phytochelatin Synthesis.
pubmed doi rcsb
source organism Anabaena sp.
molecule tags Transferase
molecule keywords ALR0975 PROTEIN
total genus 65
structure length 210
sequence length 210
ec nomenclature ec 2.3.2.15: Glutathione gamma-glutamylcysteinyltransferase.
pdb deposition date 2005-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05023 Phytochelatin Phytochelatin synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.30 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 2btwA00
2BTWA 2BU3A 2BTWB
chains in the Genus database with same CATH superfamily
3IV2A 4R3DA 2AYOA 2P0RA 4X6HA 1BY8A 3MTNA 1KXRA 2UZJA 2R9NA 1CB5A 2YJCA 4WURA 3E1ZB 1F29A 4Q8HA 1FH0A 2P86A 3BBAA 4M0WA 4YYSA 3S3QA 4HWYA 3MTVA 4IUMA 2J7QC 5EGWA 4XR7A 2DJFB 4BOPA 3NHEA 2P7UA 1YK8A 1AIMA 1U9VA 1YALA 3BB7A 4QRVA 2G8EA 1ZIVA 2AUZA 2AYNA 3P5XA 3F75A 2FO5A 2WBFX 4AXMA 1TL9A 2AS8A 3K24A 1CSBB 6PADA 3B21A 3RVVA 2VHFA 1NL6A 2R9CA 3CH3X 1PCIA 4PP2E 3LXSA 2DCDA 9PAPA 1NQCA 3RNVA 2IBIA 4P6EA 2BU3A 4DMYA 3IHPA 4QRGA 4PI3A 2FYEA 3OVZA 4YYWA 1MDWA 3O0UA 3PRMA 4FJCA 1AECA 1CJLA 4CDCB 4I05A 2AUXA 3IUTA 5CHVA 1PADA 4YVAA 3I06A 3IFUA 5EZSA 1Q6KA 1EWPA 3GCBA 1YZBA 2XU5A 4RY2A 1ICFA 3WXFA 1CPJA 1KFUL 2E03A 3PHWA 3CBKA 3ERVA 2CB5A 2DZYA 4A5UA 3CBJA 3TMPA 3BOWA 3H6SA 1BQIA 1MEGA 3K8UA 1QDQA 2DCBA 1DKIA 2JTCA 2BDZA 2Y5BA 3IOQA 5FPWA 4ZUXU 2AVWA 1PIPA 3PW3A 3BC3A 3PRPA 2YJBA 1AU2A 3OF8A 2Y6EA 4N79A 1EF7A 4YYVA 3KSEA 4YYUA 4BOSA 3MJ5A 3BY4A 1A6RA 2FRQA 1ATKA 3IMAA 1CV8A 1HUCB 1YVBA 1AYUA 2XU4A 1MIRA 2DCCA 7PCKA 1QOLA 3KFQA 4BOUA 3E9SA 5F02A 1YT7A 2PBHA 1F2CA 2E02A 2O6XA 3ZUAA 1NB5A 2GFOA 3DF0A 1U9WA 3D6SA 1PPDA 4AXLA 2OULA 4QH6A 3OVXA 2E01A 3PBHA 4P6GA 1U5IA 3C0RA 1AU0A 2E00A 2G8JA 1SP4B 4CZWA 1JQPA 3WXGA 1MHWA 4RF1A 4X6IA 5JZEA 1THEA 1KFXL 2HD5A 4MZSA 3TNXA 4BQVA 3O1GA 3RVWA 2BTWA 3USVA 2ACTA 2C0YA 2DC9A 1PXVA 2NQAA 4PP1A 1UKFA 2ATOA 2YJ9A 2ARYA 2OZ2A 2DOSA 2FUDA 3PDFA 2IPPB 3S3RA 1GCBA 4D8BA 1EWLA 1U9XA 3N3KA 1ITOA 4BOQA 4FK5A 3I3TA 1STFE 4OVZB 2JRIA 5EZQA 3F5VA 1MEMA 1CQDA 1YK7A 1M6DA 4XUIA 3PHUA 3BPFA 3U8EA 1AYVA 2NQGA 3QT4A 2H7JA 1CS8A 3MHHA 1PPPA 3K9MA 1QXPA 3W31A 1U9QX 5CVMA 2HXZA 2G6DA 3O65A 1NPZA 4WA6A 2YJ2A 2OP3A 2XU1A 3N4CA 1AYWA 2JQFR 4CDEB 3KWBX 3HHAA 1PPNA 4RNAA 2JQGR 4G54A 1VJVA 3PSEA 4OEMA 3KX1A 2VHSA 1AU3A 3KKUA 1F2AA 3MP2A 5KO3A 1X9YA 2B1MA 3N3GA 1PBHA 3QSDA 4OVZA 1DEUA 4CDFB 4YYQA 4RKXA 3P5UA 4MM3B 2B1NA 2HHNA 8PCHA 1TLOA 3CH2X 2G7YA 1ME3A 1AU4A 3HD3A 4HXDB 3BPMA 5A24A 1EWOA 4FIPA 3M99A 3H8BA 1GLOA 4Q8GA 1KHQA 5CHTA 3OISA 3KWZA 4D8IA 2FRAA 4YYRA 1DF0A 2PREA 2PNSA 5PADA 4KLBA 2PADA 3W30A 4MI7A 2YJ8A 3MHSA 4IP3A 1Y4HA 4K7CA 1CTEA 1KHPA 1F2BA 1MS6A 4BPVA 3PT2A 1ZCMA 4W5CA 3MORA 1GMYA 1SNKA 3V6EA 2FT2A 5CVOB 1PPOA 3HHIA 2DJGB 3BWKA 4REZA 1NB3A 5E6JA 2FE8A 4X6JA 3H7DA 1K3BB 2NQDB 2F1GA 3B79A 3P5VA 2J7QA 1O0EA 2HWKA 3PHXA 2BDLA 3ZNHA 1XKGA 1POPA 4PADA 1CVZA 3PNRA 5K16A 3H89A 1IWDA 2CIOA 5JA7A 2R9OA 2DC6A 1S4VA 1PVJA 2R9MA 4XZXA 4OELA 2Z84A 2XU3A 3IEJA 4I04A 4RF0A 1BP4A 4BSQA 4P16A 3RVXA 2AGAA 2R6NA 4QRXA 3TRKA 3P5WA 2FTDA 4MSXA 4QBBA 2FQ9A 2F7DA 1NLJA 5CVNB 4ZTBA 4YV8A 4MZOA 4BOZA 4BS5A 2R9FA 4OW0A 4DMXA 2DC7A 2DCAA 1BGOA 1ME4A 3BCNA 3KW9A 3H8CA 3LFYA 1PE6A 2NQIA 1VSNA 3OQCA 3AI8A 4W4UA 3V6CA 3WXEA 4GUAA 5JH3A 2BTWB 2DZZA 5EF4A 3HWNA 1QMYA 4BS6A 2AIMA 2AU1A 1TU6A 1GECE 2HH5A 4I07A 5J94A 3C9EA 4N8WA 1Y08A 3QJ3A 4PT5A 2GHUA 4N4ZA 4D8EA 2DC8A 4W5BA 4CDDB 3OF9A 1EWMA
chains in the Genus database with same CATH topology
1DKIA 2AGAA 4BOSA 4OW0A 2JTCA 4OVZA 4R3DA 4RNAA 3PRMA 3TRKA 3C0RA 3PSEA 4D8IA 4REZA 4D8BA 4RKXA 4RF1A 4D8EA 3B21A 3IFUA 5EZSA 3W31A 5JZEA 4MM3B 2UZJA 2FE8A 5E6JA 3MP2A 1YZBA 4WURA 3PRPA 5KO3A 3BBAA 4BOQA 1PVJA 4M0WA 3W30A 4HXDB 4MI7A 4BOUA 3MTVA 2BTWA 3E9SA 2J7QC 3O65A 4IUMA 4IP3A 4PT5A 3OQCA 4XZXA 2J7QA 2HWKA 3PHWA 3MJ5A 3BY4A 2Z84A 2JRIA 3PHXA 4OVZB 4ZTBA 5EZQA 3RNVA 1UKFA 2BU3A 3ZNHA 4BOPA 4A5UA 4RF0A 4GUAA 3TMPA 3PT2A 3BB7A 2BTWB 4P16A 2DOSA 4BOZA 3PHUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BTW A;  2BU3 A;  2BTW B; 
#chains in the Genus database with same CATH topology
 3IV2 A;  4R3D A;  2AYO A;  2P0R A;  4X6H A;  1BY8 A;  3MTN A;  1KXR A;  2UZJ A;  2R9N A;  1CB5 A;  2YJC A;  4WUR A;  3E1Z B;  1F29 A;  4Q8H A;  1FH0 A;  2P86 A;  3BBA A;  4M0W A;  4YYS A;  3S3Q A;  4HWY A;  3MTV A;  4IUM A;  2J7Q C;  5EGW A;  4XR7 A;  2DJF B;  4BOP A;  3NHE A;  2P7U A;  1YK8 A;  1AIM A;  1U9V A;  1YAL A;  3BB7 A;  4QRV A;  2G8E A;  1ZIV A;  2AUZ A;  2AYN A;  3P5X A;  3F75 A;  2FO5 A;  2WBF X;  4AXM A;  1TL9 A;  2AS8 A;  3K24 A;  1CSB B;  6PAD A;  3B21 A;  3RVV A;  2VHF A;  1NL6 A;  2R9C A;  3CH3 X;  1PCI A;  4PP2 E;  3LXS A;  2DCD A;  9PAP A;  1NQC A;  3RNV A;  2IBI A;  4P6E A;  2BU3 A;  4DMY A;  3IHP A;  4QRG A;  4PI3 A;  2FYE A;  3OVZ A;  4YYW A;  1MDW A;  3O0U A;  3PRM A;  4FJC A;  1AEC A;  1CJL A;  4CDC B;  4I05 A;  2AUX A;  3IUT A;  5CHV A;  1PAD A;  4YVA A;  3I06 A;  3IFU A;  5EZS A;  1Q6K A;  1EWP A;  3GCB A;  1YZB A;  2XU5 A;  4RY2 A;  1ICF A;  3WXF A;  1CPJ A;  1KFU L;  2E03 A;  3PHW A;  3CBK A;  3ERV A;  2CB5 A;  2DZY A;  4A5U A;  3CBJ A;  3TMP A;  3BOW A;  3H6S A;  1BQI A;  1MEG A;  3K8U A;  1QDQ A;  2DCB A;  1DKI A;  2JTC A;  2BDZ A;  2Y5B A;  3IOQ A;  5FPW A;  4ZUX U;  2AVW A;  1PIP A;  3PW3 A;  3BC3 A;  3PRP A;  2YJB A;  1AU2 A;  3OF8 A;  2Y6E A;  4N79 A;  1EF7 A;  4YYV A;  3KSE A;  4YYU A;  4BOS A;  3MJ5 A;  3BY4 A;  1A6R A;  2FRQ A;  1ATK A;  3IMA A;  1CV8 A;  1HUC B;  1YVB A;  1AYU A;  2XU4 A;  1MIR A;  2DCC A;  7PCK A;  1QOL A;  3KFQ A;  4BOU A;  3E9S A;  5F02 A;  1YT7 A;  2PBH A;  1F2C A;  2E02 A;  2O6X A;  3ZUA A;  1NB5 A;  2GFO A;  3DF0 A;  1U9W A;  3D6S A;  1PPD A;  4AXL A;  2OUL A;  4QH6 A;  3OVX A;  2E01 A;  3PBH A;  4P6G A;  1U5I A;  3C0R A;  1AU0 A;  2E00 A;  2G8J A;  1SP4 B;  4CZW A;  1JQP A;  3WXG A;  1MHW A;  4RF1 A;  4X6I A;  5JZE A;  1THE A;  1KFX L;  2HD5 A;  4MZS A;  3TNX A;  4BQV A;  3O1G A;  3RVW A;  2BTW A;  3USV A;  2ACT A;  2C0Y A;  2DC9 A;  1PXV A;  2NQA A;  4PP1 A;  1UKF A;  2ATO A;  2YJ9 A;  2ARY A;  2OZ2 A;  2DOS A;  2FUD A;  3PDF A;  2IPP B;  3S3R A;  1GCB A;  4D8B A;  1EWL A;  1U9X A;  3N3K A;  1ITO A;  4BOQ A;  4FK5 A;  3I3T A;  1STF E;  4OVZ B;  2JRI A;  5EZQ A;  3F5V A;  1MEM A;  1CQD A;  1YK7 A;  1M6D A;  4XUI A;  3PHU A;  3BPF A;  3U8E A;  1AYV A;  2NQG A;  3QT4 A;  2H7J A;  1CS8 A;  3MHH A;  1PPP A;  3K9M A;  1QXP A;  3W31 A;  1U9Q X;  5CVM A;  2HXZ A;  2G6D A;  3O65 A;  1NPZ A;  4WA6 A;  2YJ2 A;  2OP3 A;  2XU1 A;  3N4C A;  1AYW A;  2JQF R;  4CDE B;  3KWB X;  3HHA A;  1PPN A;  4RNA A;  2JQG R;  4G54 A;  1VJV A;  3PSE A;  4OEM A;  3KX1 A;  2VHS A;  1AU3 A;  3KKU A;  1F2A A;  3MP2 A;  5KO3 A;  1X9Y A;  2B1M A;  3N3G A;  1PBH A;  3QSD A;  4OVZ A;  1DEU A;  4CDF B;  4YYQ A;  4RKX A;  3P5U A;  4MM3 B;  2B1N A;  2HHN A;  8PCH A;  1TLO A;  3CH2 X;  2G7Y A;  1ME3 A;  1AU4 A;  3HD3 A;  4HXD B;  3BPM A;  5A24 A;  1EWO A;  4FIP A;  3M99 A;  3H8B A;  1GLO A;  4Q8G A;  1KHQ A;  5CHT A;  3OIS A;  3KWZ A;  4D8I A;  2FRA A;  4YYR A;  1DF0 A;  2PRE A;  2PNS A;  5PAD A;  4KLB A;  2PAD A;  3W30 A;  4MI7 A;  2YJ8 A;  3MHS A;  4IP3 A;  1Y4H A;  4K7C A;  1CTE A;  1KHP A;  1F2B A;  1MS6 A;  4BPV A;  3PT2 A;  1ZCM A;  4W5C A;  3MOR A;  1GMY A;  1SNK A;  3V6E A;  2FT2 A;  5CVO B;  1PPO A;  3HHI A;  2DJG B;  3BWK A;  4REZ A;  1NB3 A;  5E6J A;  2FE8 A;  4X6J A;  3H7D A;  1K3B B;  2NQD B;  2F1G A;  3B79 A;  3P5V A;  2J7Q A;  1O0E A;  2HWK A;  3PHX A;  2BDL A;  3ZNH A;  1XKG A;  1POP A;  4PAD A;  1CVZ A;  3PNR A;  5K16 A;  3H89 A;  1IWD A;  2CIO A;  5JA7 A;  2R9O A;  2DC6 A;  1S4V A;  1PVJ A;  2R9M A;  4XZX A;  4OEL A;  2Z84 A;  2XU3 A;  3IEJ A;  4I04 A;  4RF0 A;  1BP4 A;  4BSQ A;  4P16 A;  3RVX A;  2AGA A;  2R6N A;  4QRX A;  3TRK A;  3P5W A;  2FTD A;  4MSX A;  4QBB A;  2FQ9 A;  2F7D A;  1NLJ A;  5CVN B;  4ZTB A;  4YV8 A;  4MZO A;  4BOZ A;  4BS5 A;  2R9F A;  4OW0 A;  4DMX A;  2DC7 A;  2DCA A;  1BGO A;  1ME4 A;  3BCN A;  3KW9 A;  3H8C A;  3LFY A;  1PE6 A;  2NQI A;  1VSN A;  3OQC A;  3AI8 A;  4W4U A;  3V6C A;  3WXE A;  4GUA A;  5JH3 A;  2BTW B;  2DZZ A;  5EF4 A;  3HWN A;  1QMY A;  4BS6 A;  2AIM A;  2AU1 A;  1TU6 A;  1GEC E;  2HH5 A;  4I07 A;  5J94 A;  3C9E A;  4N8W A;  1Y08 A;  3QJ3 A;  4PT5 A;  2GHU A;  4N4Z A;  4D8E A;  2DC8 A;  4W5B A;  4CDD B;  3OF9 A;  1EWM A; 
#chains in the Genus database with same CATH homology
 1DKI A;  2AGA A;  4BOS A;  4OW0 A;  2JTC A;  4OVZ A;  4R3D A;  4RNA A;  3PRM A;  3TRK A;  3C0R A;  3PSE A;  4D8I A;  4REZ A;  4D8B A;  4RKX A;  4RF1 A;  4D8E A;  3B21 A;  3IFU A;  5EZS A;  3W31 A;  5JZE A;  4MM3 B;  2UZJ A;  2FE8 A;  5E6J A;  3MP2 A;  1YZB A;  4WUR A;  3PRP A;  5KO3 A;  3BBA A;  4BOQ A;  1PVJ A;  4M0W A;  3W30 A;  4HXD B;  4MI7 A;  4BOU A;  3MTV A;  2BTW A;  3E9S A;  2J7Q C;  3O65 A;  4IUM A;  4IP3 A;  4PT5 A;  3OQC A;  4XZX A;  2J7Q A;  2HWK A;  3PHW A;  3MJ5 A;  3BY4 A;  2Z84 A;  2JRI A;  3PHX A;  4OVZ B;  4ZTB A;  5EZQ A;  3RNV A;  1UKF A;  2BU3 A;  3ZNH A;  4BOP A;  4A5U A;  4RF0 A;  4GUA A;  3TMP A;  3PT2 A;  3BB7 A;  2BTW B;  4P16 A;  2DOS A;  4BOZ A;  3PHU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...