2BTWA

Crystal structure of alr0975
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
210
structure length
210
Chain Sequence
LSPNLIGFNSNEGEKLLLTSRSREDFFPLSMQFVTQVNQAYCGVASIIMVLNSLGINAPETAQYSPYRVFTQDNFFSNEKTKAVIAPEVVARQGMTLDELGRLIASYGVKVKVNHASDTNIEDFRKQVAENLKQDGNFVIVNYLRKEIGQERGGHISPLAAYNEQTDRFLIMDVSRYKYPPVWVKTTDLWKAMNTVDSVSQKTRGFVFVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALR0975 PROTEIN
publication title A Papain-Like Enzyme at Work: Native and Acyl- Enzyme Intermediate Structures in Phytochelatin Synthesis.
pubmed doi rcsb
source organism Anabaena sp.
molecule tags Transferase
total genus 65
structure length 210
sequence length 210
ec nomenclature ec 2.3.2.15: Glutathione gamma-glutamylcysteinyltransferase.
pdb deposition date 2005-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05023 Phytochelatin Phytochelatin synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.30 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 2btwA00
2BU3A 2BTWA 2BTWB
chains in the Genus database with same CATH superfamily
2F1GA 4P6GA 4BOZA 2JTCA 1AU3A 3E9SA 4CDFB 5EGWA 4RNAA 1BQIA 4RKXA 1PXVA 4YVAA 2HHNA 2YJ8A 3H8CA 3TNXA 1MS6A 4PT5A 3LFYA 2J7QC 3MTVA 3H89A 3D6SA 2Z84A 2G8JA 1YT7A 4CDCB 4AXMA 2XU3A 4YYQA 1PPNA 3O65A 3WXGA 3O0UA 2R9OA 1PPPA 4P6EA 1ME3A 2NQAA 3W31A 2DCCA 4AXLA 3BC3A 4YYSA 1X9YA 3USVA 3RVXA 2DJFB 1CVZA 4CZWA 2DJGB 2YJBA 4FJCA 1ICFA 3QSDA 2AYOA 1A6RA 1NL6A 2XU5A 2FO5A 1KHPA 3P5WA 4A5UA 1KXRA 4YYUA 1AU2A 1F2AA 3MHSA 3MTNA 1U9VA 1AYVA 3PHXA 3V6EA 1BGOA 3V6CA 2E00A 4CDEB 5A24A 5CHTA 3ERVA 4QRGA 2NQDB 2AU1A 3KX1A 4HWYA 4YYVA 2YJ9A 2IBIA 1ATKA 1BP4A 1SNKA 4YV8A 2CIOA 2DC6A 1THEA 3IHPA 1NPZA 2DZZA 3IUTA 4Q8GA 4DMYA 4N79A 1F29A 3KWBX 4GUAA 4OVZB 1CQDA 4D8BA 4D8EA 3PRMA 1MHWA 2B1NA 2OULA 2AS8A 1NB5A 2B1MA 2DC9A 1GMYA 3MHHA 1KHQA 1AU0A 3MORA 3KWZA 3C0RA 1DF0A 3IMAA 3P5XA 1U9XA 2C0YA 5FPWA 2JRIA 2YJ2A 5J94A 2IPPB 2NQGA 4N4ZA 2R6NA 3TMPA 1M6DA 3OF9A 2JQGR 9PAPA 2DC8A 2FRQA 3WXFA 4IP3A 2HXZA 5EZQA 2DC7A 4MSXA 4PI3A 4BPVA 4RF0A 3H8BA 1S4VA 3BCNA 1GECE 4QH6A 1DEUA 2OP3A 2HWKA 3S3QA 1NLJA 1PBHA 2JQFR 1DKIA 4MM3B 1GLOA 1EWMA 4X6HA 5CHVA 3KKUA 3CBKA 3NHEA 5F02A 4BOSA 1POPA 3HD3A 1HUCB 2DZYA 2BDLA 3TRKA 2AUXA 2PNSA 1TLOA 3CH3X 2XU4A 3PBHA 4YYWA 3PHWA 4MZSA 4BS5A 3N3KA 4P16A 1ME4A 2BU3A 2VHFA 3OVXA 2R9CA 1AU4A 1PADA 3CBJA 1U9QX 1YK7A 2O6XA 4Q8HA 1ITOA 2PADA 2R9MA 4CDDB 3I3TA 4QRVA 2R9NA 3BY4A 5CVOB 2P0RA 4D8IA 1U5IA 2DCBA 3PW3A 4ZTBA 4BOUA 1AIMA 4OELA 3ZUAA 3AI8A 3K24A 3PDFA 3OISA 2OZ2A 1CS8A 3B79A 4W5CA 2G6DA 3RVWA 3HHAA 4OVZA 1EF7A 1O0EA 3OQCA 4PADA 2GFOA 1EWOA 3QT4A 3KFQA 3OVZA 1SP4B 4N8WA 2HH5A 1Q6KA 2DCAA 1QXPA 1IWDA 1MIRA 1CJLA 4R3DA 4K7CA 3IFUA 2P86A 2FUDA 1MDWA 3BBAA 1GCBA 1ZIVA 1STFE 4QRXA 4BOPA 2YJCA 2E01A 5JA7A 1FH0A 1QOLA 1YK8A 3E1ZB 2DCDA 3HHIA 3I06A 4MI7A 2CB5A 3KSEA 1TU6A 8PCHA 2VHSA 2ATOA 2AIMA 2AYNA 3BPMA 1PE6A 4BSQA 5EZSA 3H6SA 1CB5A 2FYEA 1MEGA 3BOWA 1KFUL 3PRPA 4BS6A 4XUIA 1Y08A 4XZXA 4WURA 2PREA 3C9EA 4X6JA 4HXDB 5K16A 1CTEA 3LXSA 2J7QA 3F75A 2R9FA 2H7JA 3PT2A 3W30A 3RVVA 1QMYA 4IUMA 1YZBA 4XR7A 3P5UA 4OEMA 1YVBA 4QBBA 3HWNA 2ACTA 1BY8A 1AYWA 4I04A 3BWKA 2WBFX 2FQ9A 5CVNB 3S3RA 4BQVA 1PVJA 2E02A 6PADA 1PCIA 3GCBA 4M0WA 3M99A 4PP2E 4W5BA 4RF1A 5JH3A 3N4CA 2NQIA 1U9WA 3MJ5A 4PP1A 1ZCMA 1PIPA 1CV8A 3O1GA 2E03A 4FIPA 4ZUXU 5JZEA 2FE8A 2UZJA 3DF0A 2BTWA 2ARYA 2XU1A 5PADA 2BTWB 3K8UA 3RNVA 1NQCA 4OW0A 2FTDA 1JQPA 3IEJA 1CPJA 1PPDA 1EWLA 1VSNA 4REZA 2P7UA 4I05A 1Y4HA 5E6JA 1QDQA 3U8EA 5KO3A 4BOQA 2G8EA 3PSEA 2FT2A 1F2CA 2AGAA 3F5VA 4RY2A 3P5VA 3BB7A 3IV2A 3B21A 1MEMA 2AUZA 1NB3A 3PNRA 3MP2A 4WA6A 1AECA 1AYUA 3H7DA 3IOQA 2G7YA 4G54A 1EWPA 2F7DA 3ZNHA 3OF8A 1CSBB 3WXEA 4MZOA 4YYRA 4KLBA 5CVMA 2BDZA 1KFXL 4X6IA 2Y5BA 4DMXA 1YALA 1PPOA 4FK5A 3K9MA 1F2BA 3N3GA 1XKGA 3CH2X 3QJ3A 1K3BB 5EF4A 2PBHA 1UKFA 2Y6EA 2GHUA 3PHUA 4I07A 7PCKA 3BPFA 3KW9A 4W4UA 1VJVA 2AVWA 1TL9A 2HD5A 2DOSA 2FRAA
chains in the Genus database with same CATH topology
4BOUA 4BOZA 2JTCA 1PVJA 4M0WA 3E9SA 3C0RA 4RNAA 4RF1A 4RKXA 3MJ5A 4OVZA 2JRIA 5JZEA 2FE8A 3OQCA 4PT5A 3TMPA 2UZJA 2J7QC 3MTVA 2BTWA 2BTWB 2Z84A 3RNVA 4IP3A 4OW0A 5EZQA 3O65A 4R3DA 4RF0A 4REZA 3IFUA 5E6JA 2HWKA 3W31A 3BBAA 5KO3A 4BOQA 1DKIA 3PSEA 4MM3B 4BOPA 2AGAA 3BB7A 4BOSA 3B21A 3TRKA 4A5UA 3MP2A 4MI7A 3PHXA 3PHWA 4P16A 5EZSA 3ZNHA 2BU3A 3PRPA 4XZXA 4WURA 4HXDB 3BY4A 1UKFA 4D8IA 3PHUA 2J7QA 3W30A 3PT2A 4GUAA 4OVZB 4IUMA 1YZBA 4D8BA 4D8EA 4ZTBA 3PRMA 2DOSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BU3 A;  2BTW A;  2BTW B; 
#chains in the Genus database with same CATH topology
 2F1G A;  4P6G A;  4BOZ A;  2JTC A;  1AU3 A;  3E9S A;  4CDF B;  5EGW A;  4RNA A;  1BQI A;  4RKX A;  1PXV A;  4YVA A;  2HHN A;  2YJ8 A;  3H8C A;  3TNX A;  1MS6 A;  4PT5 A;  3LFY A;  2J7Q C;  3MTV A;  3H89 A;  3D6S A;  2Z84 A;  2G8J A;  1YT7 A;  4CDC B;  4AXM A;  2XU3 A;  4YYQ A;  1PPN A;  3O65 A;  3WXG A;  3O0U A;  2R9O A;  1PPP A;  4P6E A;  1ME3 A;  2NQA A;  3W31 A;  2DCC A;  4AXL A;  3BC3 A;  4YYS A;  1X9Y A;  3USV A;  3RVX A;  2DJF B;  1CVZ A;  4CZW A;  2DJG B;  2YJB A;  4FJC A;  1ICF A;  3QSD A;  2AYO A;  1A6R A;  1NL6 A;  2XU5 A;  2FO5 A;  1KHP A;  3P5W A;  4A5U A;  1KXR A;  4YYU A;  1AU2 A;  1F2A A;  3MHS A;  3MTN A;  1U9V A;  1AYV A;  3PHX A;  3V6E A;  1BGO A;  3V6C A;  2E00 A;  4CDE B;  5A24 A;  5CHT A;  3ERV A;  4QRG A;  2NQD B;  2AU1 A;  3KX1 A;  4HWY A;  4YYV A;  2YJ9 A;  2IBI A;  1ATK A;  1BP4 A;  1SNK A;  4YV8 A;  2CIO A;  2DC6 A;  1THE A;  3IHP A;  1NPZ A;  2DZZ A;  3IUT A;  4Q8G A;  4DMY A;  4N79 A;  1F29 A;  3KWB X;  4GUA A;  4OVZ B;  1CQD A;  4D8B A;  4D8E A;  3PRM A;  1MHW A;  2B1N A;  2OUL A;  2AS8 A;  1NB5 A;  2B1M A;  2DC9 A;  1GMY A;  3MHH A;  1KHQ A;  1AU0 A;  3MOR A;  3KWZ A;  3C0R A;  1DF0 A;  3IMA A;  3P5X A;  1U9X A;  2C0Y A;  5FPW A;  2JRI A;  2YJ2 A;  5J94 A;  2IPP B;  2NQG A;  4N4Z A;  2R6N A;  3TMP A;  1M6D A;  3OF9 A;  2JQG R;  9PAP A;  2DC8 A;  2FRQ A;  3WXF A;  4IP3 A;  2HXZ A;  5EZQ A;  2DC7 A;  4MSX A;  4PI3 A;  4BPV A;  4RF0 A;  3H8B A;  1S4V A;  3BCN A;  1GEC E;  4QH6 A;  1DEU A;  2OP3 A;  2HWK A;  3S3Q A;  1NLJ A;  1PBH A;  2JQF R;  1DKI A;  4MM3 B;  1GLO A;  1EWM A;  4X6H A;  5CHV A;  3KKU A;  3CBK A;  3NHE A;  5F02 A;  4BOS A;  1POP A;  3HD3 A;  1HUC B;  2DZY A;  2BDL A;  3TRK A;  2AUX A;  2PNS A;  1TLO A;  3CH3 X;  2XU4 A;  3PBH A;  4YYW A;  3PHW A;  4MZS A;  4BS5 A;  3N3K A;  4P16 A;  1ME4 A;  2BU3 A;  2VHF A;  3OVX A;  2R9C A;  1AU4 A;  1PAD A;  3CBJ A;  1U9Q X;  1YK7 A;  2O6X A;  4Q8H A;  1ITO A;  2PAD A;  2R9M A;  4CDD B;  3I3T A;  4QRV A;  2R9N A;  3BY4 A;  5CVO B;  2P0R A;  4D8I A;  1U5I A;  2DCB A;  3PW3 A;  4ZTB A;  4BOU A;  1AIM A;  4OEL A;  3ZUA A;  3AI8 A;  3K24 A;  3PDF A;  3OIS A;  2OZ2 A;  1CS8 A;  3B79 A;  4W5C A;  2G6D A;  3RVW A;  3HHA A;  4OVZ A;  1EF7 A;  1O0E A;  3OQC A;  4PAD A;  2GFO A;  1EWO A;  3QT4 A;  3KFQ A;  3OVZ A;  1SP4 B;  4N8W A;  2HH5 A;  1Q6K A;  2DCA A;  1QXP A;  1IWD A;  1MIR A;  1CJL A;  4R3D A;  4K7C A;  3IFU A;  2P86 A;  2FUD A;  1MDW A;  3BBA A;  1GCB A;  1ZIV A;  1STF E;  4QRX A;  4BOP A;  2YJC A;  2E01 A;  5JA7 A;  1FH0 A;  1QOL A;  1YK8 A;  3E1Z B;  2DCD A;  3HHI A;  3I06 A;  4MI7 A;  2CB5 A;  3KSE A;  1TU6 A;  8PCH A;  2VHS A;  2ATO A;  2AIM A;  2AYN A;  3BPM A;  1PE6 A;  4BSQ A;  5EZS A;  3H6S A;  1CB5 A;  2FYE A;  1MEG A;  3BOW A;  1KFU L;  3PRP A;  4BS6 A;  4XUI A;  1Y08 A;  4XZX A;  4WUR A;  2PRE A;  3C9E A;  4X6J A;  4HXD B;  5K16 A;  1CTE A;  3LXS A;  2J7Q A;  3F75 A;  2R9F A;  2H7J A;  3PT2 A;  3W30 A;  3RVV A;  1QMY A;  4IUM A;  1YZB A;  4XR7 A;  3P5U A;  4OEM A;  1YVB A;  4QBB A;  3HWN A;  2ACT A;  1BY8 A;  1AYW A;  4I04 A;  3BWK A;  2WBF X;  2FQ9 A;  5CVN B;  3S3R A;  4BQV A;  1PVJ A;  2E02 A;  6PAD A;  1PCI A;  3GCB A;  4M0W A;  3M99 A;  4PP2 E;  4W5B A;  4RF1 A;  5JH3 A;  3N4C A;  2NQI A;  1U9W A;  3MJ5 A;  4PP1 A;  1ZCM A;  1PIP A;  1CV8 A;  3O1G A;  2E03 A;  4FIP A;  4ZUX U;  5JZE A;  2FE8 A;  2UZJ A;  3DF0 A;  2BTW A;  2ARY A;  2XU1 A;  5PAD A;  2BTW B;  3K8U A;  3RNV A;  1NQC A;  4OW0 A;  2FTD A;  1JQP A;  3IEJ A;  1CPJ A;  1PPD A;  1EWL A;  1VSN A;  4REZ A;  2P7U A;  4I05 A;  1Y4H A;  5E6J A;  1QDQ A;  3U8E A;  5KO3 A;  4BOQ A;  2G8E A;  3PSE A;  2FT2 A;  1F2C A;  2AGA A;  3F5V A;  4RY2 A;  3P5V A;  3BB7 A;  3IV2 A;  3B21 A;  1MEM A;  2AUZ A;  1NB3 A;  3PNR A;  3MP2 A;  4WA6 A;  1AEC A;  1AYU A;  3H7D A;  3IOQ A;  2G7Y A;  4G54 A;  1EWP A;  2F7D A;  3ZNH A;  3OF8 A;  1CSB B;  3WXE A;  4MZO A;  4YYR A;  4KLB A;  5CVM A;  2BDZ A;  1KFX L;  4X6I A;  2Y5B A;  4DMX A;  1YAL A;  1PPO A;  4FK5 A;  3K9M A;  1F2B A;  3N3G A;  1XKG A;  3CH2 X;  3QJ3 A;  1K3B B;  5EF4 A;  2PBH A;  1UKF A;  2Y6E A;  2GHU A;  3PHU A;  4I07 A;  7PCK A;  3BPF A;  3KW9 A;  4W4U A;  1VJV A;  2AVW A;  1TL9 A;  2HD5 A;  2DOS A;  2FRA A; 
#chains in the Genus database with same CATH homology
 4BOU A;  4BOZ A;  2JTC A;  1PVJ A;  4M0W A;  3E9S A;  3C0R A;  4RNA A;  4RF1 A;  4RKX A;  3MJ5 A;  4OVZ A;  2JRI A;  5JZE A;  2FE8 A;  3OQC A;  4PT5 A;  3TMP A;  2UZJ A;  2J7Q C;  3MTV A;  2BTW A;  2BTW B;  2Z84 A;  3RNV A;  4IP3 A;  4OW0 A;  5EZQ A;  3O65 A;  4R3D A;  4RF0 A;  4REZ A;  3IFU A;  5E6J A;  2HWK A;  3W31 A;  3BBA A;  5KO3 A;  4BOQ A;  1DKI A;  3PSE A;  4MM3 B;  4BOP A;  2AGA A;  3BB7 A;  4BOS A;  3B21 A;  3TRK A;  4A5U A;  3MP2 A;  4MI7 A;  3PHX A;  3PHW A;  4P16 A;  5EZS A;  3ZNH A;  2BU3 A;  3PRP A;  4XZX A;  4WUR A;  4HXD B;  3BY4 A;  1UKF A;  4D8I A;  3PHU A;  2J7Q A;  3W30 A;  3PT2 A;  4GUA A;  4OVZ B;  4IUM A;  1YZB A;  4D8B A;  4D8E A;  4ZTB A;  3PRM A;  2DOS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...