3MORA

Crystal structure of cathepsin b from trypanosoma brucei
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
260
structure length
260
Chain Sequence
SILPKRRFTEEEARAPLPSSFDSAEAWPNCPTIPQIADQSACGSCWAVAAASAMSDRFCTMGGVQDVHISAGDLLACCSDCGDGCNGGDPDRAWAYFSSTGLVSDYCQPYPFPHCSHHSKSKNGYPPCSQFNFDTPKCNYTCDDPTIPVVNYRSWTSYALQGEDDYMRELFFRGPFEVAFDVYEDFIAYNSGVYHHVSGQYLGGHAVRLVGWGTSNGVPYWKIANSWNTEWGMDGYFLIRRGSSECGIEDGGSAGIPLAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Cathepsin B-like cysteine protease
publication title In vivo protein crystallization opens new routes in structural biology.
pubmed doi rcsb
source organism Trypanosoma brucei
total genus 72
structure length 260
sequence length 260
chains with identical sequence B
ec nomenclature ec 3.4.22.-:
pdb deposition date 2010-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3morA00
4QRGA 1X9YA 2B1NA 8PCHA 2NQGA 3WXGA 1NQCA 1KHPA 3CBJA 1KFUL 2R6NA 3GCBA 2XU5A 1DF0A 3MHHA 2FYEA 3H8BA 5CVOB 1ATKA 2AUXA 1TL9A 4PI3A 4RY2A 3DF0A 4W5CA 7PCKA 5CHTA 3K24A 3OVZA 3F5VA 3OISA 3PBHA 4KLBA 2HH5A 2FRAA 3P5UA 3RVXA 4N4ZA 1FH0A 5CHVA 1EWMA 3HWNA 3IV2A 1ICFA 4FK5A 2FQ9A 2PREA 3I06A 4HWYA 2GHUA 2VHSA 4FIPA 4I05A 4DMXA 1S4VA 2E01A 3OF9A 1NB5A 1CTEA 3BC3A 5JH3A 3P5XA 1U9QX 2AIMA 2IPPB 1PPDA 3ERVA 1STFE 2G8JA 3O1GA 1YK8A 3P5VA 3U8EA 3RVVA 3AI8A 1GLOA 3M99A 2CIOA 4OEMA 1GCBA 1CB5A 2JQGR 2DCAA 2Y6EA 3IEJA 1DEUA 2JQFR 3H6SA 1A6RA 4W4UA 4YYRA 1MIRA 2FUDA 1PIPA 1PPNA 4MSXA 2E02A 2NQAA 2ACTA 4CDEB 1PXVA 3E1ZB 2P86A 3BPMA 4YVAA 1IWDA 2P7UA 5CVNB 1CS8A 1MHWA 2ATOA 3NHEA 2YJ2A 2VHFA 2Y5BA 1F29A 3CBKA 2IBIA 3IMAA 3K9MA 4AXMA 1MEMA 2YJ8A 3KX1A 4MZOA 3LXSA 3PDFA 1U9WA 4PP1A 2R9NA 4X6IA 1EWPA 4YYUA 4CZWA 2DZYA 1ZIVA 2DC8A 1AU2A 2DZZA 4N79A 2HXZA 4BS6A 1U5IA 4DMYA 1QXPA 4PP2E 4X6HA 1F2CA 2R9CA 4I07A 1CVZA 2YJCA 2R9MA 3C9EA 4QBBA 3IOQA 3CH3X 3USVA 1EF7A 4AXLA 2OULA 4YV8A 1KHQA 4CDCB 1PE6A 5A24A 1Y4HA 3H89A 3F75A 2DC6A 5K16A 3V6CA 3HHAA 1NPZA 4BS5A 1K3BB 5EF4A 1YT7A 6PADA 2FTDA 1AU0A 3N4CA 3P5WA 4Q8GA 2GFOA 1U9VA 3BCNA 1AU4A 2G7YA 3BPFA 4BQVA 2DCBA 4QRXA 1PPPA 1XKGA 1YK7A 3QSDA 4BSQA 1MS6A 3WXEA 3KWBX 2F7DA 4P6EA 1ME4A 3S3QA 2AUZA 2PBHA 4XR7A 3H7DA 3QJ3A 1KXRA 4YYQA 5F02A 1VSNA 1CQDA 1YVBA 5JA7A 4ZUXU 1TU6A 3WXFA 1AYUA 5J94A 1U9XA 2DCCA 1Q6KA 3ZUAA 1ME3A 2G8EA 4X6JA 2DC7A 1VJVA 1AYVA 4K7CA 4I04A 1POPA 3N3GA 3MHSA 3LFYA 4G54A 2R9OA 2BDZA 3PNRA 2P0RA 1JQPA 1O0EA 4P6GA 1YALA 2FT2A 1GECE 1GMYA 1BQIA 1CJLA 3QT4A 2NQIA 4MZSA 1MDWA 1PCIA 2PNSA 3I3TA 2AU1A 2CB5A 2FRQA 4QH6A 1Y08A 2AS8A 2XU4A 1M6DA 1F2AA 3N3KA 2AVWA 4OELA 3KFQA 4CDDB 3IUTA 1NLJA 2XU1A 4Q8HA 2DJGB 1ZCMA 1QOLA 5EGWA 1BP4A 2E00A 3PW3A 3CH2X 3D6SA 1CSBB 4BPVA 9PAPA 1PBHA 2PADA 2OZ2A 4FJCA 4QRVA 1QDQA 1NL6A 2F1GA 2FO5A 1SNKA 3K8UA 1HUCB 1TLOA 3MTNA 3OF8A 1THEA 1BGOA 3TNXA 1AYWA 2NQDB 1SP4B 1CPJA 3V6EA 3B79A 1BY8A 1EWOA 2E03A 4PADA 2B1MA 2O6XA 4YYSA 2C0YA 1AIMA 1F2BA 1AECA 1MEGA 3IHPA 1PPOA 5FPWA 1NB3A 4XUIA 2DC9A 4YYVA 3S3RA 2HHNA 3H8CA 3BWKA 4N8WA 4WA6A 1PADA 3BOWA 3RVWA 3KKUA 4YYWA 1KFXL 2ARYA 2AYNA 2BDLA 2XU3A 2H7JA 2AYOA 1CV8A 2WBFX 3OVXA 2YJBA 3O0UA 3KWZA 1QMYA 2OP3A 3KSEA 1AU3A 3MORA 4CDFB 2DCDA 2G6DA 2R9FA 3KW9A 3HD3A 5PADA 2YJ9A 3HHIA 1EWLA 2DJFB 1ITOA 5CVMA 4W5BA 2HD5A
chains in the Genus database with same CATH superfamily
4D8EA 4BOSA 4QRGA 1X9YA 2B1NA 8PCHA 2NQGA 3WXGA 1NQCA 1KHPA 3CBJA 1KFUL 2R6NA 3TRKA 3GCBA 2XU5A 1DF0A 3MHHA 2FYEA 3H8BA 5CVOB 1ATKA 2AUXA 1TL9A 4PI3A 4RY2A 3DF0A 4W5CA 7PCKA 5CHTA 3K24A 3OVZA 3F5VA 3BB7A 4HXDB 3OISA 3PRMA 3PBHA 4KLBA 2HH5A 2FRAA 3P5UA 4RF0A 3RVXA 4N4ZA 4XZXA 1FH0A 5CHVA 1EWMA 3HWNA 3IV2A 1ICFA 4FK5A 4R3DA 2FQ9A 3I06A 2PREA 4HWYA 2Z84A 2GHUA 2VHSA 4FIPA 4I05A 4DMXA 2BTWA 1S4VA 2E01A 3OF9A 1NB5A 1CTEA 4RF1A 3BC3A 5JH3A 3P5XA 1U9QX 2AIMA 2IPPB 1PPDA 3ERVA 1STFE 2G8JA 4REZA 3O1GA 3TMPA 1YK8A 3P5VA 3U8EA 3RVVA 3AI8A 1GLOA 3M99A 2CIOA 4OEMA 1GCBA 1CB5A 2JQGR 4OVZB 2DCAA 2Y6EA 3IEJA 1DEUA 4D8IA 2JQFR 3H6SA 1A6RA 4W4UA 4YYRA 2FE8A 1MIRA 2J7QA 2FUDA 1PIPA 5E6JA 2JRIA 1PPNA 4MSXA 3MTVA 2E02A 2NQAA 2ACTA 2JTCA 4CDEB 1PXVA 3E1ZB 2P86A 3BPMA 4YVAA 1IWDA 2P7UA 5CVNB 1CS8A 1MHWA 2ATOA 3NHEA 3IFUA 4P16A 4ZTBA 2YJ2A 2VHFA 2Y5BA 1F29A 4RNAA 3CBKA 2IBIA 2BTWB 3IMAA 3K9MA 4AXMA 1MEMA 5EZSA 4BOQA 2YJ8A 3KX1A 4MZOA 3LXSA 3PDFA 1U9WA 4PP1A 2R9NA 4X6IA 1EWPA 4YYUA 4CZWA 2DZYA 3PHWA 1ZIVA 2DC8A 1AU2A 2DZZA 4N79A 2HXZA 4BS6A 1U5IA 4DMYA 1QXPA 4PP2E 4X6HA 1F2CA 2R9CA 4I07A 1CVZA 1DKIA 2YJCA 2R9MA 3C9EA 3MJ5A 4QBBA 3IOQA 3CH3X 3USVA 1EF7A 4RKXA 4AXLA 2OULA 4YV8A 1KHQA 4BOZA 4CDCB 1PE6A 5A24A 1Y4HA 3H89A 3F75A 2DC6A 5K16A 3V6CA 3HHAA 1NPZA 4BS5A 1K3BB 3PHUA 5EF4A 1YT7A 6PADA 3ZNHA 2FTDA 1AU0A 3N4CA 3P5WA 4Q8GA 3OQCA 2GFOA 1U9VA 3BCNA 4WURA 1AU4A 2G7YA 3BPFA 3O65A 4BQVA 4IP3A 2DCBA 4QRXA 1PPPA 1XKGA 1UKFA 3W31A 1YK7A 3QSDA 4BSQA 1MS6A 2AGAA 3WXEA 3KWBX 2F7DA 4P6EA 1ME4A 3S3QA 2AUZA 1YZBA 2PBHA 4XR7A 3H7DA 3QJ3A 4GUAA 1KXRA 4MI7A 4YYQA 5F02A 1VSNA 1CQDA 1YVBA 5JA7A 4OW0A 4ZUXU 1TU6A 3WXFA 1AYUA 5J94A 1U9XA 3BY4A 3PT2A 5KO3A 2DCCA 1Q6KA 3ZUAA 1ME3A 2G8EA 4X6JA 2DC7A 1VJVA 1AYVA 4K7CA 5JZEA 4I04A 1POPA 5EZQA 3MP2A 3N3GA 1PVJA 3MHSA 4PT5A 3LFYA 4G54A 2R9OA 2BDZA 3PNRA 2P0RA 1JQPA 1O0EA 4P6GA 1YALA 2FT2A 1GECE 4MM3B 1GMYA 1BQIA 1CJLA 3QT4A 2NQIA 4MZSA 1MDWA 1PCIA 2PNSA 3I3TA 2AU1A 2HWKA 3W30A 2CB5A 2FRQA 4QH6A 1Y08A 2AS8A 4IUMA 2XU4A 1M6DA 1F2AA 3N3KA 2AVWA 4OELA 3KFQA 4CDDB 3IUTA 1NLJA 2XU1A 4Q8HA 4A5UA 2DJGB 1ZCMA 1QOLA 5EGWA 1BP4A 2E00A 3PW3A 2UZJA 3CH2X 3D6SA 1CSBB 4BPVA 9PAPA 1PBHA 2PADA 2OZ2A 4FJCA 4QRVA 1QDQA 1NL6A 2F1GA 2BU3A 2FO5A 1SNKA 3RNVA 3K8UA 1HUCB 1TLOA 3MTNA 3OF8A 1THEA 1BGOA 3TNXA 1AYWA 2NQDB 1SP4B 3BBAA 1CPJA 3V6EA 3B79A 1BY8A 1EWOA 2E03A 4PADA 2B1MA 2O6XA 4YYSA 2C0YA 1AIMA 1F2BA 1AECA 3C0RA 1MEGA 3IHPA 4BOUA 4M0WA 1PPOA 3PHXA 5FPWA 1NB3A 3E9SA 4XUIA 2DC9A 4YYVA 3S3RA 2HHNA 3H8CA 3BWKA 4N8WA 4WA6A 1PADA 2J7QC 3BOWA 3RVWA 3KKUA 4YYWA 1KFXL 2ARYA 2AYNA 2BDLA 2XU3A 2H7JA 2AYOA 1CV8A 2WBFX 3OVXA 2YJBA 3O0UA 3KWZA 1QMYA 2OP3A 3KSEA 1AU3A 3MORA 4CDFB 2DCDA 2G6DA 2R9FA 3KW9A 3HD3A 4BOPA 5PADA 3B21A 2YJ9A 3HHIA 1EWLA 2DJFB 1ITOA 4OVZA 2DOSA 4D8BA 3PSEA 5CVMA 4W5BA 3PRPA 2HD5A
chains in the Genus database with same CATH topology
4QRGA 1X9YA 2B1NA 8PCHA 1W5RA 2NQGA 3WXGA 1NQCA 1KHPA 3CBJA 1KFUL 2R6NA 3GCBA 2XU5A 1DF0A 3MHHA 2FYEA 3H8BA 5CVOB 1ATKA 2AUXA 1TL9A 4PI3A 4RY2A 3DF0A 4W5CA 7PCKA 5CHTA 1W4TA 3K24A 3OVZA 3F5VA 3OISA 3PBHA 4GUZA 4KLBA 2HH5A 2FRAA 3P5UA 3RVXA 4N4ZA 1FH0A 5CHVA 1EWMA 3HWNA 3IV2A 1ICFA 4FK5A 2FQ9A 2PREA 3I06A 4HWYA 2GHUA 2VHSA 4FIPA 4I05A 4DMXA 1S4VA 2E01A 3OF9A 1NB5A 1CTEA 3BC3A 5JH3A 3P5XA 1U9QX 2AIMA 2IPPB 1PPDA 3ERVA 1STFE 2G8JA 3O1GA 1YK8A 3P5VA 3U8EA 1GX3A 3RVVA 3AI8A 1GLOA 3M99A 4B55A 2CIOA 4OEMA 1GCBA 1CB5A 2JQGR 2DCAA 2Y6EA 3IEJA 1DEUA 2JQFR 3H6SA 1A6RA 4W4UA 4YYRA 1MIRA 2FUDA 1PIPA 1PPNA 4MSXA 2E02A 2NQAA 2ACTA 4CDEB 1PXVA 3E1ZB 2P86A 3BPMA 4YVAA 1IWDA 2P7UA 5CVNB 1CS8A 1MHWA 2ATOA 3NHEA 2YJ2A 2VHFA 2Y5BA 3D9WA 1F29A 3CBKA 2IBIA 3IMAA 3K9MA 4AXMA 1MEMA 2YJ8A 3KX1A 4MZOA 3LXSA 3PDFA 1U9WA 4PP1A 2R9NA 4X6IA 1EWPA 4YYUA 4CZWA 2DZYA 1ZIVA 2DC8A 1AU2A 2DZZA 4N79A 2HXZA 4BS6A 1U5IA 4DMYA 1QXPA 2VFCA 4PP2E 4X6HA 1F2CA 2R9CA 4I07A 1CVZA 2YJCA 2R9MA 3C9EA 4QBBA 3IOQA 3CH3X 3USVA 1EF7A 4AXLA 2OULA 4YV8A 1KHQA 4CDCB 1PE6A 5A24A 1Y4HA 3H89A 3F75A 2DC6A 5K16A 3V6CA 3HHAA 1NPZA 2BSZA 4BS5A 1K3BB 5EF4A 1YT7A 6PADA 2FTDA 1AU0A 3N4CA 3P5WA 4Q8GA 2GFOA 1U9VA 3BCNA 1E2TA 1AU4A 2G7YA 3BPFA 4BQVA 2DCBA 4QRXA 1PPPA 1XKGA 1YK7A 3QSDA 4BSQA 1MS6A 3WXEA 3KWBX 2F7DA 4P6EA 1ME4A 3S3QA 2AUZA 2PBHA 4XR7A 3H7DA 3QJ3A 1KXRA 4YYQA 5F02A 1VSNA 1CQDA 1YVBA 5JA7A 4ZUXU 1TU6A 3WXFA 1AYUA 5J94A 1U9XA 2DCCA 1Q6KA 3ZUAA 1ME3A 2G8EA 4X6JA 2DC7A 1VJVA 1AYVA 4K7CA 4I04A 1POPA 3N3GA 3MHSA 3LFYA 4G54A 2R9OA 2BDZA 3PNRA 2P0RA 1JQPA 1O0EA 4P6GA 1YALA 2FT2A 1GECE 1GMYA 1BQIA 1CJLA 3QT4A 2NQIA 4MZSA 4C5PA 1MDWA 1PCIA 2PNSA 3I3TA 2AU1A 2CB5A 2FRQA 4QH6A 1Y08A 2AS8A 2XU4A 1M6DA 1F2AA 3LTWA 3N3KA 2AVWA 4OELA 3KFQA 4CDDB 2VFBA 3IUTA 1NLJA 2XU1A 4Q8HA 2DJGB 1ZCMA 1QOLA 5EGWA 1BP4A 2E00A 3PW3A 3CH2X 3D6SA 1CSBB 4BPVA 9PAPA 1PBHA 2PADA 2OZ2A 4FJCA 4QRVA 1QDQA 1NL6A 2F1GA 2FO5A 1SNKA 3K8UA 1HUCB 1TLOA 3MTNA 3OF8A 4BGFA 1THEA 1BGOA 3TNXA 1AYWA 2NQDB 1SP4B 1CPJA 3V6EA 3B79A 1BY8A 1EWOA 2E03A 4PADA 2B1MA 2O6XA 4YYSA 2C0YA 1AIMA 1F2BA 1AECA 1MEGA 3IHPA 1PPOA 5FPWA 1NB3A 4NV7A 4XUIA 2DC9A 4YYVA 3S3RA 2HHNA 3H8CA 3BWKA 4N8WA 4WA6A 1W6FA 1PADA 3BOWA 3RVWA 3KKUA 4YYWA 1KFXL 2ARYA 2AYNA 2BDLA 2XU3A 2H7JA 2AYOA 1CV8A 2WBFX 3OVXA 2YJBA 3O0UA 3KWZA 1QMYA 2OP3A 3KSEA 1AU3A 3MORA 4CDFB 2DCDA 2G6DA 2R9FA 3KW9A 3HD3A 4NV8A 5PADA 2YJ9A 3HHIA 1EWLA 2DJFB 1ITOA 5CVMA 4W5BA 2HD5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QRG A;  1X9Y A;  2B1N A;  8PCH A;  2NQG A;  3WXG A;  1NQC A;  1KHP A;  3CBJ A;  1KFU L;  2R6N A;  3GCB A;  2XU5 A;  1DF0 A;  3MHH A;  2FYE A;  3H8B A;  5CVO B;  1ATK A;  2AUX A;  1TL9 A;  4PI3 A;  4RY2 A;  3DF0 A;  4W5C A;  7PCK A;  5CHT A;  3K24 A;  3OVZ A;  3F5V A;  3OIS A;  3PBH A;  4KLB A;  2HH5 A;  2FRA A;  3P5U A;  3RVX A;  4N4Z A;  1FH0 A;  5CHV A;  1EWM A;  3HWN A;  3IV2 A;  1ICF A;  4FK5 A;  2FQ9 A;  2PRE A;  3I06 A;  4HWY A;  2GHU A;  2VHS A;  4FIP A;  4I05 A;  4DMX A;  1S4V A;  2E01 A;  3OF9 A;  1NB5 A;  1CTE A;  3BC3 A;  5JH3 A;  3P5X A;  1U9Q X;  2AIM A;  2IPP B;  1PPD A;  3ERV A;  1STF E;  2G8J A;  3O1G A;  1YK8 A;  3P5V A;  3U8E A;  3RVV A;  3AI8 A;  1GLO A;  3M99 A;  2CIO A;  4OEM A;  1GCB A;  1CB5 A;  2JQG R;  2DCA A;  2Y6E A;  3IEJ A;  1DEU A;  2JQF R;  3H6S A;  1A6R A;  4W4U A;  4YYR A;  1MIR A;  2FUD A;  1PIP A;  1PPN A;  4MSX A;  2E02 A;  2NQA A;  2ACT A;  4CDE B;  1PXV A;  3E1Z B;  2P86 A;  3BPM A;  4YVA A;  1IWD A;  2P7U A;  5CVN B;  1CS8 A;  1MHW A;  2ATO A;  3NHE A;  2YJ2 A;  2VHF A;  2Y5B A;  1F29 A;  3CBK A;  2IBI A;  3IMA A;  3K9M A;  4AXM A;  1MEM A;  2YJ8 A;  3KX1 A;  4MZO A;  3LXS A;  3PDF A;  1U9W A;  4PP1 A;  2R9N A;  4X6I A;  1EWP A;  4YYU A;  4CZW A;  2DZY A;  1ZIV A;  2DC8 A;  1AU2 A;  2DZZ A;  4N79 A;  2HXZ A;  4BS6 A;  1U5I A;  4DMY A;  1QXP A;  4PP2 E;  4X6H A;  1F2C A;  2R9C A;  4I07 A;  1CVZ A;  2YJC A;  2R9M A;  3C9E A;  4QBB A;  3IOQ A;  3CH3 X;  3USV A;  1EF7 A;  4AXL A;  2OUL A;  4YV8 A;  1KHQ A;  4CDC B;  1PE6 A;  5A24 A;  1Y4H A;  3H89 A;  3F75 A;  2DC6 A;  5K16 A;  3V6C A;  3HHA A;  1NPZ A;  4BS5 A;  1K3B B;  5EF4 A;  1YT7 A;  6PAD A;  2FTD A;  1AU0 A;  3N4C A;  3P5W A;  4Q8G A;  2GFO A;  1U9V A;  3BCN A;  1AU4 A;  2G7Y A;  3BPF A;  4BQV A;  2DCB A;  4QRX A;  1PPP A;  1XKG A;  1YK7 A;  3QSD A;  4BSQ A;  1MS6 A;  3WXE A;  3KWB X;  2F7D A;  4P6E A;  1ME4 A;  3S3Q A;  2AUZ A;  2PBH A;  4XR7 A;  3H7D A;  3QJ3 A;  1KXR A;  4YYQ A;  5F02 A;  1VSN A;  1CQD A;  1YVB A;  5JA7 A;  4ZUX U;  1TU6 A;  3WXF A;  1AYU A;  5J94 A;  1U9X A;  2DCC A;  1Q6K A;  3ZUA A;  1ME3 A;  2G8E A;  4X6J A;  2DC7 A;  1VJV A;  1AYV A;  4K7C A;  4I04 A;  1POP A;  3N3G A;  3MHS A;  3LFY A;  4G54 A;  2R9O A;  2BDZ A;  3PNR A;  2P0R A;  1JQP A;  1O0E A;  4P6G A;  1YAL A;  2FT2 A;  1GEC E;  1GMY A;  1BQI A;  1CJL A;  3QT4 A;  2NQI A;  4MZS A;  1MDW A;  1PCI A;  2PNS A;  3I3T A;  2AU1 A;  2CB5 A;  2FRQ A;  4QH6 A;  1Y08 A;  2AS8 A;  2XU4 A;  1M6D A;  1F2A A;  3N3K A;  2AVW A;  4OEL A;  3KFQ A;  4CDD B;  3IUT A;  1NLJ A;  2XU1 A;  4Q8H A;  2DJG B;  1ZCM A;  1QOL A;  5EGW A;  1BP4 A;  2E00 A;  3PW3 A;  3CH2 X;  3D6S A;  1CSB B;  4BPV A;  9PAP A;  1PBH A;  2PAD A;  2OZ2 A;  4FJC A;  4QRV A;  1QDQ A;  1NL6 A;  2F1G A;  2FO5 A;  1SNK A;  3K8U A;  1HUC B;  1TLO A;  3MTN A;  3OF8 A;  1THE A;  1BGO A;  3TNX A;  1AYW A;  2NQD B;  1SP4 B;  1CPJ A;  3V6E A;  3B79 A;  1BY8 A;  1EWO A;  2E03 A;  4PAD A;  2B1M A;  2O6X A;  4YYS A;  2C0Y A;  1AIM A;  1F2B A;  1AEC A;  1MEG A;  3IHP A;  1PPO A;  5FPW A;  1NB3 A;  4XUI A;  2DC9 A;  4YYV A;  3S3R A;  2HHN A;  3H8C A;  3BWK A;  4N8W A;  4WA6 A;  1PAD A;  3BOW A;  3RVW A;  3KKU A;  4YYW A;  1KFX L;  2ARY A;  2AYN A;  2BDL A;  2XU3 A;  2H7J A;  2AYO A;  1CV8 A;  2WBF X;  3OVX A;  2YJB A;  3O0U A;  3KWZ A;  1QMY A;  2OP3 A;  3KSE A;  1AU3 A;  3MOR A;  4CDF B;  2DCD A;  2G6D A;  2R9F A;  3KW9 A;  3HD3 A;  5PAD A;  2YJ9 A;  3HHI A;  1EWL A;  2DJF B;  1ITO A;  5CVM A;  4W5B A;  2HD5 A; 
#chains in the Genus database with same CATH topology
 4D8E A;  4BOS A;  4QRG A;  1X9Y A;  2B1N A;  8PCH A;  2NQG A;  3WXG A;  1NQC A;  1KHP A;  3CBJ A;  1KFU L;  2R6N A;  3TRK A;  3GCB A;  2XU5 A;  1DF0 A;  3MHH A;  2FYE A;  3H8B A;  5CVO B;  1ATK A;  2AUX A;  1TL9 A;  4PI3 A;  4RY2 A;  3DF0 A;  4W5C A;  7PCK A;  5CHT A;  3K24 A;  3OVZ A;  3F5V A;  3BB7 A;  4HXD B;  3OIS A;  3PRM A;  3PBH A;  4KLB A;  2HH5 A;  2FRA A;  3P5U A;  4RF0 A;  3RVX A;  4N4Z A;  4XZX A;  1FH0 A;  5CHV A;  1EWM A;  3HWN A;  3IV2 A;  1ICF A;  4FK5 A;  4R3D A;  2FQ9 A;  3I06 A;  2PRE A;  4HWY A;  2Z84 A;  2GHU A;  2VHS A;  4FIP A;  4I05 A;  4DMX A;  2BTW A;  1S4V A;  2E01 A;  3OF9 A;  1NB5 A;  1CTE A;  4RF1 A;  3BC3 A;  5JH3 A;  3P5X A;  1U9Q X;  2AIM A;  2IPP B;  1PPD A;  3ERV A;  1STF E;  2G8J A;  4REZ A;  3O1G A;  3TMP A;  1YK8 A;  3P5V A;  3U8E A;  3RVV A;  3AI8 A;  1GLO A;  3M99 A;  2CIO A;  4OEM A;  1GCB A;  1CB5 A;  2JQG R;  4OVZ B;  2DCA A;  2Y6E A;  3IEJ A;  1DEU A;  4D8I A;  2JQF R;  3H6S A;  1A6R A;  4W4U A;  4YYR A;  2FE8 A;  1MIR A;  2J7Q A;  2FUD A;  1PIP A;  5E6J A;  2JRI A;  1PPN A;  4MSX A;  3MTV A;  2E02 A;  2NQA A;  2ACT A;  2JTC A;  4CDE B;  1PXV A;  3E1Z B;  2P86 A;  3BPM A;  4YVA A;  1IWD A;  2P7U A;  5CVN B;  1CS8 A;  1MHW A;  2ATO A;  3NHE A;  3IFU A;  4P16 A;  4ZTB A;  2YJ2 A;  2VHF A;  2Y5B A;  1F29 A;  4RNA A;  3CBK A;  2IBI A;  2BTW B;  3IMA A;  3K9M A;  4AXM A;  1MEM A;  5EZS A;  4BOQ A;  2YJ8 A;  3KX1 A;  4MZO A;  3LXS A;  3PDF A;  1U9W A;  4PP1 A;  2R9N A;  4X6I A;  1EWP A;  4YYU A;  4CZW A;  2DZY A;  3PHW A;  1ZIV A;  2DC8 A;  1AU2 A;  2DZZ A;  4N79 A;  2HXZ A;  4BS6 A;  1U5I A;  4DMY A;  1QXP A;  4PP2 E;  4X6H A;  1F2C A;  2R9C A;  4I07 A;  1CVZ A;  1DKI A;  2YJC A;  2R9M A;  3C9E A;  3MJ5 A;  4QBB A;  3IOQ A;  3CH3 X;  3USV A;  1EF7 A;  4RKX A;  4AXL A;  2OUL A;  4YV8 A;  1KHQ A;  4BOZ A;  4CDC B;  1PE6 A;  5A24 A;  1Y4H A;  3H89 A;  3F75 A;  2DC6 A;  5K16 A;  3V6C A;  3HHA A;  1NPZ A;  4BS5 A;  1K3B B;  3PHU A;  5EF4 A;  1YT7 A;  6PAD A;  3ZNH A;  2FTD A;  1AU0 A;  3N4C A;  3P5W A;  4Q8G A;  3OQC A;  2GFO A;  1U9V A;  3BCN A;  4WUR A;  1AU4 A;  2G7Y A;  3BPF A;  3O65 A;  4BQV A;  4IP3 A;  2DCB A;  4QRX A;  1PPP A;  1XKG A;  1UKF A;  3W31 A;  1YK7 A;  3QSD A;  4BSQ A;  1MS6 A;  2AGA A;  3WXE A;  3KWB X;  2F7D A;  4P6E A;  1ME4 A;  3S3Q A;  2AUZ A;  1YZB A;  2PBH A;  4XR7 A;  3H7D A;  3QJ3 A;  4GUA A;  1KXR A;  4MI7 A;  4YYQ A;  5F02 A;  1VSN A;  1CQD A;  1YVB A;  5JA7 A;  4OW0 A;  4ZUX U;  1TU6 A;  3WXF A;  1AYU A;  5J94 A;  1U9X A;  3BY4 A;  3PT2 A;  5KO3 A;  2DCC A;  1Q6K A;  3ZUA A;  1ME3 A;  2G8E A;  4X6J A;  2DC7 A;  1VJV A;  1AYV A;  4K7C A;  5JZE A;  4I04 A;  1POP A;  5EZQ A;  3MP2 A;  3N3G A;  1PVJ A;  3MHS A;  4PT5 A;  3LFY A;  4G54 A;  2R9O A;  2BDZ A;  3PNR A;  2P0R A;  1JQP A;  1O0E A;  4P6G A;  1YAL A;  2FT2 A;  1GEC E;  4MM3 B;  1GMY A;  1BQI A;  1CJL A;  3QT4 A;  2NQI A;  4MZS A;  1MDW A;  1PCI A;  2PNS A;  3I3T A;  2AU1 A;  2HWK A;  3W30 A;  2CB5 A;  2FRQ A;  4QH6 A;  1Y08 A;  2AS8 A;  4IUM A;  2XU4 A;  1M6D A;  1F2A A;  3N3K A;  2AVW A;  4OEL A;  3KFQ A;  4CDD B;  3IUT A;  1NLJ A;  2XU1 A;  4Q8H A;  4A5U A;  2DJG B;  1ZCM A;  1QOL A;  5EGW A;  1BP4 A;  2E00 A;  3PW3 A;  2UZJ A;  3CH2 X;  3D6S A;  1CSB B;  4BPV A;  9PAP A;  1PBH A;  2PAD A;  2OZ2 A;  4FJC A;  4QRV A;  1QDQ A;  1NL6 A;  2F1G A;  2BU3 A;  2FO5 A;  1SNK A;  3RNV A;  3K8U A;  1HUC B;  1TLO A;  3MTN A;  3OF8 A;  1THE A;  1BGO A;  3TNX A;  1AYW A;  2NQD B;  1SP4 B;  3BBA A;  1CPJ A;  3V6E A;  3B79 A;  1BY8 A;  1EWO A;  2E03 A;  4PAD A;  2B1M A;  2O6X A;  4YYS A;  2C0Y A;  1AIM A;  1F2B A;  1AEC A;  3C0R A;  1MEG A;  3IHP A;  4BOU A;  4M0W A;  1PPO A;  3PHX A;  5FPW A;  1NB3 A;  3E9S A;  4XUI A;  2DC9 A;  4YYV A;  3S3R A;  2HHN A;  3H8C A;  3BWK A;  4N8W A;  4WA6 A;  1PAD A;  2J7Q C;  3BOW A;  3RVW A;  3KKU A;  4YYW A;  1KFX L;  2ARY A;  2AYN A;  2BDL A;  2XU3 A;  2H7J A;  2AYO A;  1CV8 A;  2WBF X;  3OVX A;  2YJB A;  3O0U A;  3KWZ A;  1QMY A;  2OP3 A;  3KSE A;  1AU3 A;  3MOR A;  4CDF B;  2DCD A;  2G6D A;  2R9F A;  3KW9 A;  3HD3 A;  4BOP A;  5PAD A;  3B21 A;  2YJ9 A;  3HHI A;  1EWL A;  2DJF B;  1ITO A;  4OVZ A;  2DOS A;  4D8B A;  3PSE A;  5CVM A;  4W5B A;  3PRP A;  2HD5 A; 
#chains in the Genus database with same CATH homology
 4QRG A;  1X9Y A;  2B1N A;  8PCH A;  1W5R A;  2NQG A;  3WXG A;  1NQC A;  1KHP A;  3CBJ A;  1KFU L;  2R6N A;  3GCB A;  2XU5 A;  1DF0 A;  3MHH A;  2FYE A;  3H8B A;  5CVO B;  1ATK A;  2AUX A;  1TL9 A;  4PI3 A;  4RY2 A;  3DF0 A;  4W5C A;  7PCK A;  5CHT A;  1W4T A;  3K24 A;  3OVZ A;  3F5V A;  3OIS A;  3PBH A;  4GUZ A;  4KLB A;  2HH5 A;  2FRA A;  3P5U A;  3RVX A;  4N4Z A;  1FH0 A;  5CHV A;  1EWM A;  3HWN A;  3IV2 A;  1ICF A;  4FK5 A;  2FQ9 A;  2PRE A;  3I06 A;  4HWY A;  2GHU A;  2VHS A;  4FIP A;  4I05 A;  4DMX A;  1S4V A;  2E01 A;  3OF9 A;  1NB5 A;  1CTE A;  3BC3 A;  5JH3 A;  3P5X A;  1U9Q X;  2AIM A;  2IPP B;  1PPD A;  3ERV A;  1STF E;  2G8J A;  3O1G A;  1YK8 A;  3P5V A;  3U8E A;  1GX3 A;  3RVV A;  3AI8 A;  1GLO A;  3M99 A;  4B55 A;  2CIO A;  4OEM A;  1GCB A;  1CB5 A;  2JQG R;  2DCA A;  2Y6E A;  3IEJ A;  1DEU A;  2JQF R;  3H6S A;  1A6R A;  4W4U A;  4YYR A;  1MIR A;  2FUD A;  1PIP A;  1PPN A;  4MSX A;  2E02 A;  2NQA A;  2ACT A;  4CDE B;  1PXV A;  3E1Z B;  2P86 A;  3BPM A;  4YVA A;  1IWD A;  2P7U A;  5CVN B;  1CS8 A;  1MHW A;  2ATO A;  3NHE A;  2YJ2 A;  2VHF A;  2Y5B A;  3D9W A;  1F29 A;  3CBK A;  2IBI A;  3IMA A;  3K9M A;  4AXM A;  1MEM A;  2YJ8 A;  3KX1 A;  4MZO A;  3LXS A;  3PDF A;  1U9W A;  4PP1 A;  2R9N A;  4X6I A;  1EWP A;  4YYU A;  4CZW A;  2DZY A;  1ZIV A;  2DC8 A;  1AU2 A;  2DZZ A;  4N79 A;  2HXZ A;  4BS6 A;  1U5I A;  4DMY A;  1QXP A;  2VFC A;  4PP2 E;  4X6H A;  1F2C A;  2R9C A;  4I07 A;  1CVZ A;  2YJC A;  2R9M A;  3C9E A;  4QBB A;  3IOQ A;  3CH3 X;  3USV A;  1EF7 A;  4AXL A;  2OUL A;  4YV8 A;  1KHQ A;  4CDC B;  1PE6 A;  5A24 A;  1Y4H A;  3H89 A;  3F75 A;  2DC6 A;  5K16 A;  3V6C A;  3HHA A;  1NPZ A;  2BSZ A;  4BS5 A;  1K3B B;  5EF4 A;  1YT7 A;  6PAD A;  2FTD A;  1AU0 A;  3N4C A;  3P5W A;  4Q8G A;  2GFO A;  1U9V A;  3BCN A;  1E2T A;  1AU4 A;  2G7Y A;  3BPF A;  4BQV A;  2DCB A;  4QRX A;  1PPP A;  1XKG A;  1YK7 A;  3QSD A;  4BSQ A;  1MS6 A;  3WXE A;  3KWB X;  2F7D A;  4P6E A;  1ME4 A;  3S3Q A;  2AUZ A;  2PBH A;  4XR7 A;  3H7D A;  3QJ3 A;  1KXR A;  4YYQ A;  5F02 A;  1VSN A;  1CQD A;  1YVB A;  5JA7 A;  4ZUX U;  1TU6 A;  3WXF A;  1AYU A;  5J94 A;  1U9X A;  2DCC A;  1Q6K A;  3ZUA A;  1ME3 A;  2G8E A;  4X6J A;  2DC7 A;  1VJV A;  1AYV A;  4K7C A;  4I04 A;  1POP A;  3N3G A;  3MHS A;  3LFY A;  4G54 A;  2R9O A;  2BDZ A;  3PNR A;  2P0R A;  1JQP A;  1O0E A;  4P6G A;  1YAL A;  2FT2 A;  1GEC E;  1GMY A;  1BQI A;  1CJL A;  3QT4 A;  2NQI A;  4MZS A;  4C5P A;  1MDW A;  1PCI A;  2PNS A;  3I3T A;  2AU1 A;  2CB5 A;  2FRQ A;  4QH6 A;  1Y08 A;  2AS8 A;  2XU4 A;  1M6D A;  1F2A A;  3LTW A;  3N3K A;  2AVW A;  4OEL A;  3KFQ A;  4CDD B;  2VFB A;  3IUT A;  1NLJ A;  2XU1 A;  4Q8H A;  2DJG B;  1ZCM A;  1QOL A;  5EGW A;  1BP4 A;  2E00 A;  3PW3 A;  3CH2 X;  3D6S A;  1CSB B;  4BPV A;  9PAP A;  1PBH A;  2PAD A;  2OZ2 A;  4FJC A;  4QRV A;  1QDQ A;  1NL6 A;  2F1G A;  2FO5 A;  1SNK A;  3K8U A;  1HUC B;  1TLO A;  3MTN A;  3OF8 A;  4BGF A;  1THE A;  1BGO A;  3TNX A;  1AYW A;  2NQD B;  1SP4 B;  1CPJ A;  3V6E A;  3B79 A;  1BY8 A;  1EWO A;  2E03 A;  4PAD A;  2B1M A;  2O6X A;  4YYS A;  2C0Y A;  1AIM A;  1F2B A;  1AEC A;  1MEG A;  3IHP A;  1PPO A;  5FPW A;  1NB3 A;  4NV7 A;  4XUI A;  2DC9 A;  4YYV A;  3S3R A;  2HHN A;  3H8C A;  3BWK A;  4N8W A;  4WA6 A;  1W6F A;  1PAD A;  3BOW A;  3RVW A;  3KKU A;  4YYW A;  1KFX L;  2ARY A;  2AYN A;  2BDL A;  2XU3 A;  2H7J A;  2AYO A;  1CV8 A;  2WBF X;  3OVX A;  2YJB A;  3O0U A;  3KWZ A;  1QMY A;  2OP3 A;  3KSE A;  1AU3 A;  3MOR A;  4CDF B;  2DCD A;  2G6D A;  2R9F A;  3KW9 A;  3HD3 A;  4NV8 A;  5PAD A;  2YJ9 A;  3HHI A;  1EWL A;  2DJF B;  1ITO A;  5CVM A;  4W5B A;  2HD5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...