2FRQA

Human cathepsin s with inhibitor cra-26871
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
218
structure length
218
Chain Sequence
b'ILPDSVDWREKGCVTEVKYQGSCGACWAFSAVGALEAQLKLKTGKLVSLSAQNLVDCSTEKYGNKGCNGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYDSKYRAATCSKYTELPYGREDVLKEAVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSWGHNFGEEGYIRMARNKGNHCGIASFPSYPEI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cathepsin S
publication title Human Cathepsin S with Inhibitor CRA-26871
rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 52
structure length 218
sequence length 218
chains with identical sequence B
ec nomenclature ec 3.4.22.27: Cathepsin S.
pdb deposition date 2006-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2frqA00
4X6IA 2HD5A 1AU4A 3WXFA 1THEA 4N79A 4YYSA 2AUZA 1NB3A 1QXPA 5CHTA 2AIMA 4DMYA 4FJCA 4PADA 3BPMA 4BPVA 1PPOA 1YALA 4Q8HA 4CDCB 2FO5A 4P6EA 4PP1A 3V6CA 2FT2A 2CIOA 3GCBA 2FRQA 3KFQA 5K16A 3WXGA 1ME4A 1MS6A 2G8EA 2E03A 4XUIA 1QMYA 5CVMA 3B79A 4CDEB 1F2CA 4OELA 2CB5A 1PIPA 5JH3A 2IPPB 2NQAA 1O0EA 3N3GA 1TU6A 1DEUA 1YVBA 1CQDA 4Q8GA 1MEMA 3S3QA 1QDQA 1YK8A 2R9NA 2WBFX 4CDDB 2DCCA 4AXMA 1YK7A 2VHFA 2NQGA 3C9EA 2Y6EA 1M6DA 2DJFB 2AU1A 5FPWA 1GECE 1NQCA 1VSNA 2ACTA 4QBBA 2JQFR 2FYEA 4RY2A 4I05A 3D6SA 1JQPA 1KFUL 2GHUA 1TLOA 3BCNA 1PPNA 2HXZA 3IUTA 4BS6A 1BP4A 2FUDA 3RVWA 3MTNA 4CZWA 1EWPA 4PP2E 2NQDB 4FIPA 2Y5BA 1AYVA 2G7YA 5JA7A 1EWMA 1NB5A 3RVVA 1MDWA 4W5BA 4YYRA 3KKUA 3OVXA 2DCAA 2PBHA 4CDFB 2YJBA 2YJ2A 5PADA 4XR7A 3K24A 1AU2A 1PBHA 1IWDA 2O6XA 1CTEA 3OVZA 3PDFA 3K9MA 1BY8A 3KWZA 3F75A 5A24A 2ARYA 3HHAA 3O1GA 3BC3A 2DC7A 2XU1A 3OF8A 2R9CA 3DF0A 3QJ3A 2JQGR 3H6SA 1CSBB 3WXEA 3H8CA 1GCBA 2GFOA 1GMYA 1PADA 3P5VA 1PPPA 3H8BA 3QT4A 3LFYA 1NL6A 1ITOA 3N4CA 3V6EA 1STFE 4W4UA 1F2AA 9PAPA 4YYVA 1VJVA 2G8JA 1GLOA 2OULA 1FH0A 4ZUXU 1KXRA 1AECA 2P0RA 1ATKA 2G6DA 3ERVA 1MEGA 3KWBX 4BSQA 1AYWA 2R9FA 3KX1A 4N8WA 1BQIA 4BQVA 2DC8A 2XU4A 3N3KA 1ICFA 2VHSA 2PNSA 1ZIVA 4YYUA 2BDZA 2OP3A 1Y08A 2HHNA 3P5WA 3HD3A 3USVA 1NPZA 1X9YA 1U5IA 3KSEA 3OISA 2ATOA 2AUXA 4HWYA 3CBJA 5F02A 2E01A 3H7DA 1U9QX 1PCIA 4PI3A 1U9WA 2XU5A 1BGOA 2B1NA 4YYWA 2FRAA 1Y4HA 1CJLA 4MSXA 2PADA 2DCDA 2YJ9A 1U9XA 1F2BA 4YVAA 2FQ9A 4AXLA 1AIMA 1F29A 1CB5A 2PREA 1K3BB 1EWLA 5J94A 1SNKA 3M99A 2H7JA 4QH6A 1YT7A 1CPJA 2AYNA 1AU0A 1EF7A 3O0UA 3CH3X 2NQIA 2F1GA 3IV2A 1ME3A 3AI8A 3IOQA 1Q6KA 1A6RA 2YJ8A 2R9OA 3H89A 3IHPA 3MHHA 2YJCA 5CVOB 3PW3A 1AYUA 3F5VA 3NHEA 2XU3A 3KW9A 1HUCB 3IMAA 2C0YA 1KHQA 1TL9A 4X6HA 4KLBA 3PNRA 4I07A 3PBHA 1NLJA 1SP4B 3CH2X 3RVXA 4K7CA 1CVZA 1KHPA 2B1MA 2DZYA 4DMXA 3LXSA 4MZOA 2HH5A 3P5XA 3I06A 4X6JA 3U8EA 1KFXL 5EF4A 7PCKA 1U9VA 2DC9A 4QRXA 3OF9A 4FK5A 4G54A 2OZ2A 1CS8A 4YYQA 2P7UA 5CVNB 1PXVA 3ZUAA 4QRGA 3S3RA 1S4VA 2F7DA 3IEJA 1QOLA 4BS5A 3QSDA 4P6GA 1MHWA 2BDLA 1PE6A 4OEMA 1AU3A 8PCHA 3TNXA 4QRVA 1CV8A 2AYOA 6PADA 2E00A 1POPA 2AVWA 3P5UA 1MIRA 2R9MA 4W5CA 2DJGB 4N4ZA 2DCBA 1PPDA 3MORA 3BPFA 3I3TA 3HHIA 2DZZA 3HWNA 2AS8A 2R6NA 4I04A 4YV8A 3E1ZB 1EWOA 2P86A 4MZSA 2E02A 3BOWA 1ZCMA 2DC6A 5CHVA 5EGWA 3BWKA 2FTDA 3K8UA 3CBKA 3MHSA 4WA6A 2IBIA 1DF0A 1XKGA
chains in the Genus database with same CATH superfamily
4X6IA 2HD5A 1AU4A 3WXFA 2AGAA 1THEA 4N79A 4YYSA 2AUZA 4BOZA 3PSEA 1NB3A 1QXPA 5CHTA 2AIMA 4DMYA 4FJCA 4PADA 3BPMA 3PHWA 4BPVA 1PPOA 1YALA 4WURA 4Q8HA 4CDCB 1PVJA 2FO5A 4P6EA 5KO3A 4PP1A 3PRMA 3V6CA 2FT2A 3W31A 2CIOA 3BB7A 3GCBA 2FRQA 3KFQA 5K16A 3WXGA 1ME4A 1MS6A 2G8EA 2E03A 4XUIA 1QMYA 5CVMA 3B79A 4CDEB 2JRIA 1F2CA 4OELA 2CB5A 1PIPA 5JH3A 2IPPB 2NQAA 1O0EA 3PHXA 3N3GA 1TU6A 1DEUA 2FE8A 4IUMA 1YVBA 4ZTBA 1CQDA 3E9SA 4Q8GA 1MEMA 4RF1A 3S3QA 1QDQA 1YK8A 2R9NA 2WBFX 4CDDB 3TMPA 2DCCA 4AXMA 1YK7A 3W30A 2VHFA 2NQGA 3C9EA 2Y6EA 1M6DA 2BTWB 2DJFB 2AU1A 5FPWA 1GECE 1NQCA 1VSNA 2ACTA 4QBBA 3ZNHA 2JQFR 2FYEA 4RY2A 4OW0A 4I05A 4HXDB 3D6SA 1JQPA 1KFUL 2GHUA 1TLOA 3BCNA 1PPNA 2HXZA 3IUTA 4OVZA 4BS6A 1BP4A 2FUDA 3RVWA 3MTNA 4CZWA 1EWPA 4PP2E 2NQDB 4FIPA 2Z84A 2Y5BA 1AYVA 2G7YA 5JA7A 1EWMA 1NB5A 3RVVA 2JTCA 1MDWA 5E6JA 4W5BA 3O65A 4YYRA 3BBAA 3KKUA 3OVXA 2DCAA 2PBHA 2UZJA 4D8EA 4CDFB 1UKFA 2YJBA 2YJ2A 5PADA 4XR7A 3K24A 1AU2A 4GUAA 1PBHA 2BTWA 1IWDA 4MI7A 2O6XA 1CTEA 3OVZA 4XZXA 3PDFA 3K9MA 1BY8A 2HWKA 3C0RA 3KWZA 3F75A 3MTVA 5A24A 2ARYA 3HHAA 3O1GA 3BC3A 2DC7A 2XU1A 3OF8A 2BU3A 2R9CA 3DF0A 3QJ3A 2JQGR 3H6SA 1CSBB 3WXEA 3H8CA 1DKIA 1GCBA 2GFOA 1GMYA 1PADA 2J7QC 3P5VA 1PPPA 4RKXA 4OVZB 3H8BA 4IP3A 3QT4A 3LFYA 1NL6A 1ITOA 3N4CA 3V6EA 4MM3B 1STFE 4W4UA 1F2AA 9PAPA 4YYVA 1VJVA 2G8JA 1GLOA 2OULA 1FH0A 4ZUXU 1KXRA 1AECA 2P0RA 1ATKA 2G6DA 3ERVA 1MEGA 3KWBX 4BSQA 1AYWA 2R9FA 3KX1A 4N8WA 1BQIA 4BQVA 2DC8A 2XU4A 3N3KA 1ICFA 2VHSA 2PNSA 1ZIVA 4YYUA 2BDZA 2OP3A 1Y08A 2HHNA 3P5WA 3HD3A 3USVA 1NPZA 3PHUA 1X9YA 1U5IA 3KSEA 3OISA 2ATOA 2AUXA 4HWYA 3CBJA 5F02A 2E01A 3H7DA 1U9QX 1PCIA 2DOSA 3OQCA 4PI3A 1U9WA 2XU5A 1BGOA 2B1NA 4BOQA 4PT5A 4D8IA 4YYWA 2FRAA 1Y4HA 1CJLA 4MSXA 2PADA 2DCDA 4D8BA 3RNVA 2YJ9A 1U9XA 1F2BA 4YVAA 4RNAA 2FQ9A 4AXLA 1AIMA 1F29A 1CB5A 3PRPA 2PREA 1K3BB 3IFUA 1EWLA 5J94A 1SNKA 3M99A 2H7JA 4P16A 4QH6A 1YT7A 3B21A 1CPJA 2AYNA 1AU0A 1EF7A 3O0UA 3CH3X 2NQIA 2F1GA 3IV2A 1ME3A 3AI8A 3IOQA 1Q6KA 1A6RA 2YJ8A 2R9OA 4RF0A 3H89A 3IHPA 3MHHA 3MP2A 2YJCA 5CVOB 3MJ5A 3BY4A 3PW3A 1AYUA 3F5VA 3NHEA 2XU3A 3KW9A 1HUCB 4BOPA 3IMAA 2C0YA 4A5UA 1KHQA 1TL9A 4X6HA 4KLBA 3PNRA 4I07A 3PBHA 1NLJA 1SP4B 3CH2X 3RVXA 4K7CA 1CVZA 1KHPA 2B1MA 2DZYA 4M0WA 5EZQA 4DMXA 3LXSA 4MZOA 2HH5A 1YZBA 3P5XA 3I06A 4X6JA 3U8EA 1KFXL 2J7QA 5EF4A 5EZSA 7PCKA 1U9VA 3TRKA 2DC9A 4QRXA 3OF9A 4FK5A 4G54A 2OZ2A 4R3DA 1CS8A 4YYQA 2P7UA 5CVNB 1PXVA 3ZUAA 4QRGA 3S3RA 1S4VA 4REZA 2F7DA 3IEJA 1QOLA 4BS5A 3QSDA 4P6GA 1MHWA 2BDLA 1PE6A 4OEMA 1AU3A 8PCHA 3TNXA 4QRVA 1CV8A 3PT2A 2AYOA 6PADA 2E00A 1POPA 2AVWA 3P5UA 1MIRA 2R9MA 4W5CA 2DJGB 4BOUA 4N4ZA 2DCBA 1PPDA 3MORA 5JZEA 3BPFA 3I3TA 3HHIA 2DZZA 3HWNA 2AS8A 2R6NA 4I04A 4YV8A 3E1ZB 4BOSA 1EWOA 2P86A 4MZSA 2E02A 3BOWA 1ZCMA 2DC6A 5CHVA 5EGWA 3BWKA 2FTDA 3K8UA 3CBKA 3MHSA 4WA6A 2IBIA 1DF0A 1XKGA
chains in the Genus database with same CATH topology
4X6IA 2HD5A 1AU4A 3WXFA 1THEA 4N79A 4YYSA 2AUZA 1NB3A 1QXPA 5CHTA 2AIMA 4DMYA 4FJCA 4PADA 3BPMA 4BPVA 1PPOA 1YALA 4Q8HA 4CDCB 2FO5A 4P6EA 4PP1A 3V6CA 2FT2A 2CIOA 3GCBA 2FRQA 3KFQA 1W4TA 5K16A 3WXGA 1ME4A 1MS6A 2G8EA 2E03A 4XUIA 1QMYA 5CVMA 3B79A 4CDEB 1F2CA 4OELA 2CB5A 1PIPA 5JH3A 2IPPB 2NQAA 1O0EA 3N3GA 1TU6A 1DEUA 1YVBA 1CQDA 4Q8GA 1MEMA 3S3QA 1QDQA 1YK8A 2R9NA 2WBFX 2VFBA 4CDDB 2DCCA 4AXMA 1YK7A 2VHFA 2NQGA 3D9WA 3C9EA 2Y6EA 1M6DA 2DJFB 2AU1A 5FPWA 1GECE 1NQCA 1VSNA 2ACTA 4QBBA 2JQFR 1W5RA 2FYEA 4RY2A 4I05A 3D6SA 1JQPA 1KFUL 4B55A 2GHUA 1TLOA 3BCNA 1PPNA 1GX3A 2HXZA 3IUTA 4BS6A 1BP4A 2FUDA 3RVWA 3MTNA 4CZWA 1EWPA 4PP2E 2NQDB 4FIPA 2Y5BA 1AYVA 2G7YA 5JA7A 1EWMA 3LTWA 1NB5A 3RVVA 1MDWA 4W5BA 4YYRA 3KKUA 3OVXA 2DCAA 2PBHA 4CDFB 2YJBA 2YJ2A 5PADA 4XR7A 3K24A 1AU2A 1PBHA 1IWDA 2O6XA 1CTEA 3OVZA 3PDFA 3K9MA 1BY8A 3KWZA 3F75A 5A24A 2ARYA 3HHAA 3O1GA 3BC3A 1E2TA 2DC7A 2XU1A 3OF8A 2R9CA 3DF0A 3QJ3A 2JQGR 3H6SA 4NV8A 1CSBB 3WXEA 3H8CA 1GCBA 2GFOA 1GMYA 1PADA 3P5VA 2VFCA 1PPPA 3H8BA 3QT4A 3LFYA 1NL6A 1ITOA 3N4CA 3V6EA 1STFE 4GUZA 4W4UA 1F2AA 9PAPA 4YYVA 1VJVA 2G8JA 1GLOA 2OULA 1FH0A 4ZUXU 1KXRA 1AECA 2P0RA 1ATKA 2G6DA 3ERVA 1MEGA 3KWBX 4BSQA 1AYWA 2R9FA 3KX1A 4N8WA 1BQIA 4BQVA 2DC8A 2XU4A 3N3KA 1ICFA 2VHSA 2PNSA 1ZIVA 4YYUA 2BDZA 2OP3A 1Y08A 2HHNA 3P5WA 3HD3A 3USVA 1NPZA 1X9YA 1U5IA 3KSEA 3OISA 2ATOA 2AUXA 4HWYA 3CBJA 5F02A 2E01A 3H7DA 1U9QX 1PCIA 4PI3A 1U9WA 2XU5A 1BGOA 2B1NA 4YYWA 2FRAA 1Y4HA 1CJLA 4MSXA 2PADA 2DCDA 2YJ9A 1U9XA 1F2BA 4YVAA 2FQ9A 4AXLA 1AIMA 1F29A 1CB5A 1W6FA 2PREA 1K3BB 1EWLA 5J94A 1SNKA 3M99A 2H7JA 4QH6A 1YT7A 1CPJA 2AYNA 1AU0A 1EF7A 3O0UA 3CH3X 2NQIA 2F1GA 3IV2A 1ME3A 3AI8A 3IOQA 1Q6KA 1A6RA 2YJ8A 2R9OA 3H89A 3IHPA 3MHHA 2YJCA 5CVOB 3PW3A 1AYUA 3F5VA 3NHEA 2XU3A 3KW9A 1HUCB 3IMAA 2C0YA 1KHQA 1TL9A 4X6HA 4KLBA 3PNRA 4I07A 3PBHA 1NLJA 1SP4B 3CH2X 3RVXA 4K7CA 1CVZA 1KHPA 2B1MA 2DZYA 4DMXA 3LXSA 4MZOA 2HH5A 3P5XA 3I06A 4X6JA 3U8EA 1KFXL 5EF4A 7PCKA 1U9VA 2DC9A 4QRXA 4NV7A 3OF9A 4FK5A 4G54A 2OZ2A 1CS8A 4YYQA 2P7UA 5CVNB 1PXVA 3ZUAA 4QRGA 3S3RA 1S4VA 2F7DA 3IEJA 1QOLA 4BS5A 3QSDA 4P6GA 1MHWA 4C5PA 2BDLA 1PE6A 4OEMA 1AU3A 8PCHA 3TNXA 4QRVA 1CV8A 2AYOA 6PADA 2E00A 1POPA 2AVWA 3P5UA 1MIRA 2R9MA 4W5CA 2DJGB 4N4ZA 2DCBA 1PPDA 3MORA 3BPFA 3I3TA 3HHIA 2DZZA 3HWNA 2AS8A 2R6NA 4I04A 4YV8A 3E1ZB 4BGFA 1EWOA 2P86A 4MZSA 2E02A 3BOWA 1ZCMA 2DC6A 5CHVA 5EGWA 3BWKA 2FTDA 3K8UA 3CBKA 3MHSA 4WA6A 2IBIA 1DF0A 1XKGA 2BSZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X6I A;  2HD5 A;  1AU4 A;  3WXF A;  1THE A;  4N79 A;  4YYS A;  2AUZ A;  1NB3 A;  1QXP A;  5CHT A;  2AIM A;  4DMY A;  4FJC A;  4PAD A;  3BPM A;  4BPV A;  1PPO A;  1YAL A;  4Q8H A;  4CDC B;  2FO5 A;  4P6E A;  4PP1 A;  3V6C A;  2FT2 A;  2CIO A;  3GCB A;  2FRQ A;  3KFQ A;  5K16 A;  3WXG A;  1ME4 A;  1MS6 A;  2G8E A;  2E03 A;  4XUI A;  1QMY A;  5CVM A;  3B79 A;  4CDE B;  1F2C A;  4OEL A;  2CB5 A;  1PIP A;  5JH3 A;  2IPP B;  2NQA A;  1O0E A;  3N3G A;  1TU6 A;  1DEU A;  1YVB A;  1CQD A;  4Q8G A;  1MEM A;  3S3Q A;  1QDQ A;  1YK8 A;  2R9N A;  2WBF X;  4CDD B;  2DCC A;  4AXM A;  1YK7 A;  2VHF A;  2NQG A;  3C9E A;  2Y6E A;  1M6D A;  2DJF B;  2AU1 A;  5FPW A;  1GEC E;  1NQC A;  1VSN A;  2ACT A;  4QBB A;  2JQF R;  2FYE A;  4RY2 A;  4I05 A;  3D6S A;  1JQP A;  1KFU L;  2GHU A;  1TLO A;  3BCN A;  1PPN A;  2HXZ A;  3IUT A;  4BS6 A;  1BP4 A;  2FUD A;  3RVW A;  3MTN A;  4CZW A;  1EWP A;  4PP2 E;  2NQD B;  4FIP A;  2Y5B A;  1AYV A;  2G7Y A;  5JA7 A;  1EWM A;  1NB5 A;  3RVV A;  1MDW A;  4W5B A;  4YYR A;  3KKU A;  3OVX A;  2DCA A;  2PBH A;  4CDF B;  2YJB A;  2YJ2 A;  5PAD A;  4XR7 A;  3K24 A;  1AU2 A;  1PBH A;  1IWD A;  2O6X A;  1CTE A;  3OVZ A;  3PDF A;  3K9M A;  1BY8 A;  3KWZ A;  3F75 A;  5A24 A;  2ARY A;  3HHA A;  3O1G A;  3BC3 A;  2DC7 A;  2XU1 A;  3OF8 A;  2R9C A;  3DF0 A;  3QJ3 A;  2JQG R;  3H6S A;  1CSB B;  3WXE A;  3H8C A;  1GCB A;  2GFO A;  1GMY A;  1PAD A;  3P5V A;  1PPP A;  3H8B A;  3QT4 A;  3LFY A;  1NL6 A;  1ITO A;  3N4C A;  3V6E A;  1STF E;  4W4U A;  1F2A A;  9PAP A;  4YYV A;  1VJV A;  2G8J A;  1GLO A;  2OUL A;  1FH0 A;  4ZUX U;  1KXR A;  1AEC A;  2P0R A;  1ATK A;  2G6D A;  3ERV A;  1MEG A;  3KWB X;  4BSQ A;  1AYW A;  2R9F A;  3KX1 A;  4N8W A;  1BQI A;  4BQV A;  2DC8 A;  2XU4 A;  3N3K A;  1ICF A;  2VHS A;  2PNS A;  1ZIV A;  4YYU A;  2BDZ A;  2OP3 A;  1Y08 A;  2HHN A;  3P5W A;  3HD3 A;  3USV A;  1NPZ A;  1X9Y A;  1U5I A;  3KSE A;  3OIS A;  2ATO A;  2AUX A;  4HWY A;  3CBJ A;  5F02 A;  2E01 A;  3H7D A;  1U9Q X;  1PCI A;  4PI3 A;  1U9W A;  2XU5 A;  1BGO A;  2B1N A;  4YYW A;  2FRA A;  1Y4H A;  1CJL A;  4MSX A;  2PAD A;  2DCD A;  2YJ9 A;  1U9X A;  1F2B A;  4YVA A;  2FQ9 A;  4AXL A;  1AIM A;  1F29 A;  1CB5 A;  2PRE A;  1K3B B;  1EWL A;  5J94 A;  1SNK A;  3M99 A;  2H7J A;  4QH6 A;  1YT7 A;  1CPJ A;  2AYN A;  1AU0 A;  1EF7 A;  3O0U A;  3CH3 X;  2NQI A;  2F1G A;  3IV2 A;  1ME3 A;  3AI8 A;  3IOQ A;  1Q6K A;  1A6R A;  2YJ8 A;  2R9O A;  3H89 A;  3IHP A;  3MHH A;  2YJC A;  5CVO B;  3PW3 A;  1AYU A;  3F5V A;  3NHE A;  2XU3 A;  3KW9 A;  1HUC B;  3IMA A;  2C0Y A;  1KHQ A;  1TL9 A;  4X6H A;  4KLB A;  3PNR A;  4I07 A;  3PBH A;  1NLJ A;  1SP4 B;  3CH2 X;  3RVX A;  4K7C A;  1CVZ A;  1KHP A;  2B1M A;  2DZY A;  4DMX A;  3LXS A;  4MZO A;  2HH5 A;  3P5X A;  3I06 A;  4X6J A;  3U8E A;  1KFX L;  5EF4 A;  7PCK A;  1U9V A;  2DC9 A;  4QRX A;  3OF9 A;  4FK5 A;  4G54 A;  2OZ2 A;  1CS8 A;  4YYQ A;  2P7U A;  5CVN B;  1PXV A;  3ZUA A;  4QRG A;  3S3R A;  1S4V A;  2F7D A;  3IEJ A;  1QOL A;  4BS5 A;  3QSD A;  4P6G A;  1MHW A;  2BDL A;  1PE6 A;  4OEM A;  1AU3 A;  8PCH A;  3TNX A;  4QRV A;  1CV8 A;  2AYO A;  6PAD A;  2E00 A;  1POP A;  2AVW A;  3P5U A;  1MIR A;  2R9M A;  4W5C A;  2DJG B;  4N4Z A;  2DCB A;  1PPD A;  3MOR A;  3BPF A;  3I3T A;  3HHI A;  2DZZ A;  3HWN A;  2AS8 A;  2R6N A;  4I04 A;  4YV8 A;  3E1Z B;  1EWO A;  2P86 A;  4MZS A;  2E02 A;  3BOW A;  1ZCM A;  2DC6 A;  5CHV A;  5EGW A;  3BWK A;  2FTD A;  3K8U A;  3CBK A;  3MHS A;  4WA6 A;  2IBI A;  1DF0 A;  1XKG A; 
#chains in the Genus database with same CATH topology
 4X6I A;  2HD5 A;  1AU4 A;  3WXF A;  2AGA A;  1THE A;  4N79 A;  4YYS A;  2AUZ A;  4BOZ A;  3PSE A;  1NB3 A;  1QXP A;  5CHT A;  2AIM A;  4DMY A;  4FJC A;  4PAD A;  3BPM A;  3PHW A;  4BPV A;  1PPO A;  1YAL A;  4WUR A;  4Q8H A;  4CDC B;  1PVJ A;  2FO5 A;  4P6E A;  5KO3 A;  4PP1 A;  3PRM A;  3V6C A;  2FT2 A;  3W31 A;  2CIO A;  3BB7 A;  3GCB A;  2FRQ A;  3KFQ A;  5K16 A;  3WXG A;  1ME4 A;  1MS6 A;  2G8E A;  2E03 A;  4XUI A;  1QMY A;  5CVM A;  3B79 A;  4CDE B;  2JRI A;  1F2C A;  4OEL A;  2CB5 A;  1PIP A;  5JH3 A;  2IPP B;  2NQA A;  1O0E A;  3PHX A;  3N3G A;  1TU6 A;  1DEU A;  2FE8 A;  4IUM A;  1YVB A;  4ZTB A;  1CQD A;  3E9S A;  4Q8G A;  1MEM A;  4RF1 A;  3S3Q A;  1QDQ A;  1YK8 A;  2R9N A;  2WBF X;  4CDD B;  3TMP A;  2DCC A;  4AXM A;  1YK7 A;  3W30 A;  2VHF A;  2NQG A;  3C9E A;  2Y6E A;  1M6D A;  2BTW B;  2DJF B;  2AU1 A;  5FPW A;  1GEC E;  1NQC A;  1VSN A;  2ACT A;  4QBB A;  3ZNH A;  2JQF R;  2FYE A;  4RY2 A;  4OW0 A;  4I05 A;  4HXD B;  3D6S A;  1JQP A;  1KFU L;  2GHU A;  1TLO A;  3BCN A;  1PPN A;  2HXZ A;  3IUT A;  4OVZ A;  4BS6 A;  1BP4 A;  2FUD A;  3RVW A;  3MTN A;  4CZW A;  1EWP A;  4PP2 E;  2NQD B;  4FIP A;  2Z84 A;  2Y5B A;  1AYV A;  2G7Y A;  5JA7 A;  1EWM A;  1NB5 A;  3RVV A;  2JTC A;  1MDW A;  5E6J A;  4W5B A;  3O65 A;  4YYR A;  3BBA A;  3KKU A;  3OVX A;  2DCA A;  2PBH A;  2UZJ A;  4D8E A;  4CDF B;  1UKF A;  2YJB A;  2YJ2 A;  5PAD A;  4XR7 A;  3K24 A;  1AU2 A;  4GUA A;  1PBH A;  2BTW A;  1IWD A;  4MI7 A;  2O6X A;  1CTE A;  3OVZ A;  4XZX A;  3PDF A;  3K9M A;  1BY8 A;  2HWK A;  3C0R A;  3KWZ A;  3F75 A;  3MTV A;  5A24 A;  2ARY A;  3HHA A;  3O1G A;  3BC3 A;  2DC7 A;  2XU1 A;  3OF8 A;  2BU3 A;  2R9C A;  3DF0 A;  3QJ3 A;  2JQG R;  3H6S A;  1CSB B;  3WXE A;  3H8C A;  1DKI A;  1GCB A;  2GFO A;  1GMY A;  1PAD A;  2J7Q C;  3P5V A;  1PPP A;  4RKX A;  4OVZ B;  3H8B A;  4IP3 A;  3QT4 A;  3LFY A;  1NL6 A;  1ITO A;  3N4C A;  3V6E A;  4MM3 B;  1STF E;  4W4U A;  1F2A A;  9PAP A;  4YYV A;  1VJV A;  2G8J A;  1GLO A;  2OUL A;  1FH0 A;  4ZUX U;  1KXR A;  1AEC A;  2P0R A;  1ATK A;  2G6D A;  3ERV A;  1MEG A;  3KWB X;  4BSQ A;  1AYW A;  2R9F A;  3KX1 A;  4N8W A;  1BQI A;  4BQV A;  2DC8 A;  2XU4 A;  3N3K A;  1ICF A;  2VHS A;  2PNS A;  1ZIV A;  4YYU A;  2BDZ A;  2OP3 A;  1Y08 A;  2HHN A;  3P5W A;  3HD3 A;  3USV A;  1NPZ A;  3PHU A;  1X9Y A;  1U5I A;  3KSE A;  3OIS A;  2ATO A;  2AUX A;  4HWY A;  3CBJ A;  5F02 A;  2E01 A;  3H7D A;  1U9Q X;  1PCI A;  2DOS A;  3OQC A;  4PI3 A;  1U9W A;  2XU5 A;  1BGO A;  2B1N A;  4BOQ A;  4PT5 A;  4D8I A;  4YYW A;  2FRA A;  1Y4H A;  1CJL A;  4MSX A;  2PAD A;  2DCD A;  4D8B A;  3RNV A;  2YJ9 A;  1U9X A;  1F2B A;  4YVA A;  4RNA A;  2FQ9 A;  4AXL A;  1AIM A;  1F29 A;  1CB5 A;  3PRP A;  2PRE A;  1K3B B;  3IFU A;  1EWL A;  5J94 A;  1SNK A;  3M99 A;  2H7J A;  4P16 A;  4QH6 A;  1YT7 A;  3B21 A;  1CPJ A;  2AYN A;  1AU0 A;  1EF7 A;  3O0U A;  3CH3 X;  2NQI A;  2F1G A;  3IV2 A;  1ME3 A;  3AI8 A;  3IOQ A;  1Q6K A;  1A6R A;  2YJ8 A;  2R9O A;  4RF0 A;  3H89 A;  3IHP A;  3MHH A;  3MP2 A;  2YJC A;  5CVO B;  3MJ5 A;  3BY4 A;  3PW3 A;  1AYU A;  3F5V A;  3NHE A;  2XU3 A;  3KW9 A;  1HUC B;  4BOP A;  3IMA A;  2C0Y A;  4A5U A;  1KHQ A;  1TL9 A;  4X6H A;  4KLB A;  3PNR A;  4I07 A;  3PBH A;  1NLJ A;  1SP4 B;  3CH2 X;  3RVX A;  4K7C A;  1CVZ A;  1KHP A;  2B1M A;  2DZY A;  4M0W A;  5EZQ A;  4DMX A;  3LXS A;  4MZO A;  2HH5 A;  1YZB A;  3P5X A;  3I06 A;  4X6J A;  3U8E A;  1KFX L;  2J7Q A;  5EF4 A;  5EZS A;  7PCK A;  1U9V A;  3TRK A;  2DC9 A;  4QRX A;  3OF9 A;  4FK5 A;  4G54 A;  2OZ2 A;  4R3D A;  1CS8 A;  4YYQ A;  2P7U A;  5CVN B;  1PXV A;  3ZUA A;  4QRG A;  3S3R A;  1S4V A;  4REZ A;  2F7D A;  3IEJ A;  1QOL A;  4BS5 A;  3QSD A;  4P6G A;  1MHW A;  2BDL A;  1PE6 A;  4OEM A;  1AU3 A;  8PCH A;  3TNX A;  4QRV A;  1CV8 A;  3PT2 A;  2AYO A;  6PAD A;  2E00 A;  1POP A;  2AVW A;  3P5U A;  1MIR A;  2R9M A;  4W5C A;  2DJG B;  4BOU A;  4N4Z A;  2DCB A;  1PPD A;  3MOR A;  5JZE A;  3BPF A;  3I3T A;  3HHI A;  2DZZ A;  3HWN A;  2AS8 A;  2R6N A;  4I04 A;  4YV8 A;  3E1Z B;  4BOS A;  1EWO A;  2P86 A;  4MZS A;  2E02 A;  3BOW A;  1ZCM A;  2DC6 A;  5CHV A;  5EGW A;  3BWK A;  2FTD A;  3K8U A;  3CBK A;  3MHS A;  4WA6 A;  2IBI A;  1DF0 A;  1XKG A; 
#chains in the Genus database with same CATH homology
 4X6I A;  2HD5 A;  1AU4 A;  3WXF A;  1THE A;  4N79 A;  4YYS A;  2AUZ A;  1NB3 A;  1QXP A;  5CHT A;  2AIM A;  4DMY A;  4FJC A;  4PAD A;  3BPM A;  4BPV A;  1PPO A;  1YAL A;  4Q8H A;  4CDC B;  2FO5 A;  4P6E A;  4PP1 A;  3V6C A;  2FT2 A;  2CIO A;  3GCB A;  2FRQ A;  3KFQ A;  1W4T A;  5K16 A;  3WXG A;  1ME4 A;  1MS6 A;  2G8E A;  2E03 A;  4XUI A;  1QMY A;  5CVM A;  3B79 A;  4CDE B;  1F2C A;  4OEL A;  2CB5 A;  1PIP A;  5JH3 A;  2IPP B;  2NQA A;  1O0E A;  3N3G A;  1TU6 A;  1DEU A;  1YVB A;  1CQD A;  4Q8G A;  1MEM A;  3S3Q A;  1QDQ A;  1YK8 A;  2R9N A;  2WBF X;  2VFB A;  4CDD B;  2DCC A;  4AXM A;  1YK7 A;  2VHF A;  2NQG A;  3D9W A;  3C9E A;  2Y6E A;  1M6D A;  2DJF B;  2AU1 A;  5FPW A;  1GEC E;  1NQC A;  1VSN A;  2ACT A;  4QBB A;  2JQF R;  1W5R A;  2FYE A;  4RY2 A;  4I05 A;  3D6S A;  1JQP A;  1KFU L;  4B55 A;  2GHU A;  1TLO A;  3BCN A;  1PPN A;  1GX3 A;  2HXZ A;  3IUT A;  4BS6 A;  1BP4 A;  2FUD A;  3RVW A;  3MTN A;  4CZW A;  1EWP A;  4PP2 E;  2NQD B;  4FIP A;  2Y5B A;  1AYV A;  2G7Y A;  5JA7 A;  1EWM A;  3LTW A;  1NB5 A;  3RVV A;  1MDW A;  4W5B A;  4YYR A;  3KKU A;  3OVX A;  2DCA A;  2PBH A;  4CDF B;  2YJB A;  2YJ2 A;  5PAD A;  4XR7 A;  3K24 A;  1AU2 A;  1PBH A;  1IWD A;  2O6X A;  1CTE A;  3OVZ A;  3PDF A;  3K9M A;  1BY8 A;  3KWZ A;  3F75 A;  5A24 A;  2ARY A;  3HHA A;  3O1G A;  3BC3 A;  1E2T A;  2DC7 A;  2XU1 A;  3OF8 A;  2R9C A;  3DF0 A;  3QJ3 A;  2JQG R;  3H6S A;  4NV8 A;  1CSB B;  3WXE A;  3H8C A;  1GCB A;  2GFO A;  1GMY A;  1PAD A;  3P5V A;  2VFC A;  1PPP A;  3H8B A;  3QT4 A;  3LFY A;  1NL6 A;  1ITO A;  3N4C A;  3V6E A;  1STF E;  4GUZ A;  4W4U A;  1F2A A;  9PAP A;  4YYV A;  1VJV A;  2G8J A;  1GLO A;  2OUL A;  1FH0 A;  4ZUX U;  1KXR A;  1AEC A;  2P0R A;  1ATK A;  2G6D A;  3ERV A;  1MEG A;  3KWB X;  4BSQ A;  1AYW A;  2R9F A;  3KX1 A;  4N8W A;  1BQI A;  4BQV A;  2DC8 A;  2XU4 A;  3N3K A;  1ICF A;  2VHS A;  2PNS A;  1ZIV A;  4YYU A;  2BDZ A;  2OP3 A;  1Y08 A;  2HHN A;  3P5W A;  3HD3 A;  3USV A;  1NPZ A;  1X9Y A;  1U5I A;  3KSE A;  3OIS A;  2ATO A;  2AUX A;  4HWY A;  3CBJ A;  5F02 A;  2E01 A;  3H7D A;  1U9Q X;  1PCI A;  4PI3 A;  1U9W A;  2XU5 A;  1BGO A;  2B1N A;  4YYW A;  2FRA A;  1Y4H A;  1CJL A;  4MSX A;  2PAD A;  2DCD A;  2YJ9 A;  1U9X A;  1F2B A;  4YVA A;  2FQ9 A;  4AXL A;  1AIM A;  1F29 A;  1CB5 A;  1W6F A;  2PRE A;  1K3B B;  1EWL A;  5J94 A;  1SNK A;  3M99 A;  2H7J A;  4QH6 A;  1YT7 A;  1CPJ A;  2AYN A;  1AU0 A;  1EF7 A;  3O0U A;  3CH3 X;  2NQI A;  2F1G A;  3IV2 A;  1ME3 A;  3AI8 A;  3IOQ A;  1Q6K A;  1A6R A;  2YJ8 A;  2R9O A;  3H89 A;  3IHP A;  3MHH A;  2YJC A;  5CVO B;  3PW3 A;  1AYU A;  3F5V A;  3NHE A;  2XU3 A;  3KW9 A;  1HUC B;  3IMA A;  2C0Y A;  1KHQ A;  1TL9 A;  4X6H A;  4KLB A;  3PNR A;  4I07 A;  3PBH A;  1NLJ A;  1SP4 B;  3CH2 X;  3RVX A;  4K7C A;  1CVZ A;  1KHP A;  2B1M A;  2DZY A;  4DMX A;  3LXS A;  4MZO A;  2HH5 A;  3P5X A;  3I06 A;  4X6J A;  3U8E A;  1KFX L;  5EF4 A;  7PCK A;  1U9V A;  2DC9 A;  4QRX A;  4NV7 A;  3OF9 A;  4FK5 A;  4G54 A;  2OZ2 A;  1CS8 A;  4YYQ A;  2P7U A;  5CVN B;  1PXV A;  3ZUA A;  4QRG A;  3S3R A;  1S4V A;  2F7D A;  3IEJ A;  1QOL A;  4BS5 A;  3QSD A;  4P6G A;  1MHW A;  4C5P A;  2BDL A;  1PE6 A;  4OEM A;  1AU3 A;  8PCH A;  3TNX A;  4QRV A;  1CV8 A;  2AYO A;  6PAD A;  2E00 A;  1POP A;  2AVW A;  3P5U A;  1MIR A;  2R9M A;  4W5C A;  2DJG B;  4N4Z A;  2DCB A;  1PPD A;  3MOR A;  3BPF A;  3I3T A;  3HHI A;  2DZZ A;  3HWN A;  2AS8 A;  2R6N A;  4I04 A;  4YV8 A;  3E1Z B;  4BGF A;  1EWO A;  2P86 A;  4MZS A;  2E02 A;  3BOW A;  1ZCM A;  2DC6 A;  5CHV A;  5EGW A;  3BWK A;  2FTD A;  3K8U A;  3CBK A;  3MHS A;  4WA6 A;  2IBI A;  1DF0 A;  1XKG A;  2BSZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...