2G6DA

Human cathepsin s mutant with vinyl sulfone inhibitor cra-14009
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
217
structure length
217
Chain Sequence
LPDSVDWREKGCVTEVKYQGSCGACWAFSAVGALEAQLKLKTGKLVSLSAQNLVDCSTEKYGNKGCNGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYDSKYRAATCRKYTELPYGREDVLKEAVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSWGHNFGEKGYIRMARNKGNHCGIASFPSYPEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cathepsin S
publication title Human cathepsin S mutant with vinyl sulfone inhibitor CRA-14009
rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 67
structure length 217
sequence length 217
ec nomenclature ec 3.4.22.27: Cathepsin S.
pdb deposition date 2006-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2g6dA00
4Q8HA 2H7JA 5A24A 1EWOA 5EGWA 3CBJA 4WA6A 1U9VA 4K7CA 5CVNB 1CV8A 1AU2A 1MEMA 4X6HA 1S4VA 4XUIA 1YK8A 9PAPA 4Q8GA 1PPDA 2JQGR 2DCAA 4CZWA 1EWPA 3AI8A 1AYWA 1DF0A 2AUXA 4I05A 2HXZA 3IHPA 1BGOA 4BS5A 3QSDA 1PADA 2XU1A 2AIMA 4CDCB 1U9XA 2B1MA 3MTNA 4AXLA 3V6CA 4YYUA 3U8EA 2DCCA 2ACTA 4X6JA 4BQVA 1F2AA 2FTDA 1X9YA 4W5CA 1F2BA 1KHQA 1THEA 1MEGA 1U5IA 3KX1A 1QMYA 1KHPA 4I07A 4YYWA 3P5WA 1MDWA 5F02A 1DEUA 3E1ZB 3F5VA 3USVA 1TL9A 2F7DA 2BDLA 3KFQA 4FIPA 3WXEA 1AYVA 5FPWA 2O6XA 4CDEB 3RVXA 1CQDA 3HHAA 3K24A 4FK5A 4ZUXU 2AYOA 3NHEA 1GLOA 2AU1A 2E00A 1ICFA 3ZUAA 1YT7A 4CDDB 2Y5BA 2E03A 1BY8A 1O0EA 2VHSA 2DCBA 1KFXL 1BQIA 3IMAA 2ARYA 4YV8A 3KW9A 4G54A 3OVXA 3HHIA 4PP2E 1STFE 2G8EA 2AYNA 1XKGA 3BC3A 1A6RA 2CIOA 2AVWA 5K16A 3GCBA 3HD3A 3ERVA 1SP4B 4I04A 1Q6KA 4QBBA 4BS6A 5CVMA 2FYEA 2AS8A 4X6IA 2XU3A 5PADA 1CVZA 1HUCB 5JH3A 4KLBA 2PADA 3OF9A 3O0UA 1KXRA 4N79A 5EF4A 3IUTA 3N3KA 4XR7A 1NB5A 1MS6A 1BP4A 2DC7A 3K9MA 1AU3A 3OF8A 3PDFA 2E01A 3N3GA 1QDQA 2NQIA 2DJFB 2YJBA 2NQGA 2Y6EA 1FH0A 4OEMA 1U9QX 1PPNA 2FT2A 1ZIVA 1MIRA 3KWBX 3KSEA 2PBHA 2R9CA 2YJCA 3D6SA 2G7YA 1AYUA 2FO5A 4MZOA 4P6GA 4QH6A 4FJCA 4YYSA 1IWDA 2HD5A 1JQPA 2OZ2A 2YJ2A 3WXGA 1ME3A 1PE6A 3P5UA 4AXMA 1PXVA 1PPOA 1NPZA 3H8BA 2YJ9A 3S3QA 1PIPA 1YK7A 2OULA 2R9NA 2OP3A 2FUDA 2DZYA 2CB5A 2NQAA 3MHHA 4N8WA 1AIMA 2IBIA 2AUZA 3N4CA 3RVWA 2HHNA 3OVZA 4YYQA 3O1GA 2XU4A 1GMYA 3CBKA 3S3RA 2R6NA 1ZCMA 4BPVA 4DMXA 1TLOA 3H89A 4QRGA 4QRXA 1YVBA 2JQFR 3RVVA 1AECA 2PNSA 1M6DA 2WBFX 1CJLA 1QOLA 2ATOA 3F75A 4BSQA 3H6SA 4OELA 4W4UA 1AU0A 2IPPB 5CHTA 4DMYA 2PREA 3P5VA 2R9MA 4HWYA 4P6EA 1EF7A 2C0YA 4YYVA 3QT4A 3KWZA 3B79A 1PBHA 3H8CA 1NLJA 2HH5A 3C9EA 1K3BB 1QXPA 1ME4A 3V6EA 1PCIA 1MHWA 2R9FA 2YJ8A 3BOWA 3BPMA 3IEJA 3BPFA 5JA7A 1CSBB 4MZSA 4N4ZA 2DCDA 5CVOB 1TU6A 1EWMA 1VJVA 2FRAA 3BCNA 1AU4A 2B1NA 3IV2A 2GHUA 3TNXA 3I06A 3PNRA 2G8JA 2BDZA 1KFUL 8PCHA 1F2CA 3IOQA 2FRQA 2R9OA 2GFOA 2P0RA 2DC8A 7PCKA 1CPJA 1GECE 1YALA 4YYRA 1U9WA 3MHSA 3CH2X 2DZZA 3PBHA 4YVAA 2E02A 5CHVA 2XU5A 1ITOA 2NQDB 1SNKA 4PADA 1CS8A 3WXFA 4MSXA 3LFYA 1Y4HA 2DJGB 1NQCA 2FQ9A 3M99A 3MORA 1POPA 1PPPA 3DF0A 1CB5A 3KKUA 3LXSA 2G6DA 3I3TA 1Y08A 2DC9A 6PADA 4QRVA 1NL6A 2P7UA 1VSNA 3H7DA 1ATKA 2P86A 5J94A 2VHFA 3QJ3A 3BWKA 4RY2A 1F29A 1EWLA 3P5XA 1GCBA 4W5BA 4PI3A 3PW3A 3CH3X 2DC6A 3HWNA 2F1GA 1NB3A 1CTEA 3K8UA 3OISA 4CDFB 4PP1A
chains in the Genus database with same CATH superfamily
2BTWB 4Q8HA 2H7JA 2FE8A 5A24A 1EWOA 5EGWA 3CBJA 4WA6A 1U9VA 3E9SA 4K7CA 5CVNB 1CV8A 4A5UA 1AU2A 1MEMA 4X6HA 1S4VA 4XUIA 1YK8A 3BBAA 9PAPA 4Q8GA 1PPDA 2JQGR 2DCAA 4D8EA 4CZWA 1EWPA 3AI8A 1AYWA 1DF0A 1YZBA 2AUXA 4I05A 4D8IA 2HXZA 3B21A 3IHPA 1BGOA 4BS5A 3QSDA 1PADA 2XU1A 3C0RA 2AIMA 4CDCB 1U9XA 2B1MA 3MTNA 4AXLA 3V6CA 4YYUA 3U8EA 2DCCA 2ACTA 4X6JA 4BQVA 4XZXA 1F2AA 2FTDA 2HWKA 1X9YA 4W5CA 1F2BA 1KHQA 3ZNHA 1THEA 1MEGA 1U5IA 5JZEA 2Z84A 4OW0A 3OQCA 3PHUA 3KX1A 1QMYA 1KHPA 4I07A 4BOSA 4YYWA 3P5WA 1MDWA 5F02A 1DEUA 3PRPA 3E1ZB 3F5VA 4RNAA 3USVA 3MJ5A 1TL9A 2F7DA 2BDLA 3KFQA 4FIPA 3WXEA 1AYVA 5FPWA 1PVJA 2JTCA 2O6XA 4CDEB 5E6JA 3RVXA 1CQDA 3HHAA 3K24A 4FK5A 4ZUXU 2AYOA 3NHEA 1GLOA 2AU1A 2E00A 1ICFA 3ZUAA 1YT7A 4CDDB 2Y5BA 2E03A 1BY8A 5EZSA 1O0EA 2VHSA 2DCBA 1KFXL 1BQIA 2JRIA 3IMAA 2ARYA 4YV8A 3RNVA 3KW9A 4G54A 3OVXA 3HHIA 1STFE 2G8EA 4PP2E 4MM3B 3PT2A 2AYNA 1XKGA 4P16A 3BC3A 1A6RA 2CIOA 2AVWA 5K16A 3GCBA 3HD3A 3ERVA 1SP4B 4I04A 1Q6KA 4QBBA 4BS6A 5CVMA 2FYEA 4BOQA 2AS8A 4X6IA 2XU3A 4ZTBA 5EZQA 3TMPA 5PADA 1CVZA 1HUCB 5JH3A 4KLBA 2PADA 3OF9A 3IFUA 3O0UA 1KXRA 3W30A 4N79A 5EF4A 3IUTA 4GUAA 3N3KA 4XR7A 1NB5A 1MS6A 4OVZA 1BP4A 2DC7A 3K9MA 1AU3A 3OF8A 3PRMA 3PDFA 2E01A 3N3GA 1QDQA 2NQIA 4MI7A 2DJFB 2YJBA 2NQGA 2Y6EA 1FH0A 4OEMA 1U9QX 1PPNA 2FT2A 1ZIVA 1MIRA 3KWBX 3KSEA 2PBHA 2R9CA 2YJCA 3D6SA 2G7YA 1AYUA 2FO5A 1UKFA 3PHWA 4MZOA 4P6GA 4QH6A 2UZJA 4FJCA 4YYSA 4R3DA 1IWDA 2HD5A 1JQPA 4IP3A 2OZ2A 2YJ2A 3WXGA 1ME3A 1PE6A 2J7QC 3P5UA 2BU3A 4AXMA 3PHXA 1PXVA 1PPOA 1NPZA 3H8BA 2YJ9A 3S3QA 1PIPA 1YK7A 2OULA 2R9NA 2OP3A 2FUDA 2DZYA 2CB5A 2NQAA 3MHHA 4N8WA 3BB7A 1AIMA 2IBIA 2AUZA 3N4CA 3RVWA 2HHNA 3OVZA 4YYQA 3O1GA 2J7QA 2BTWA 2XU4A 1GMYA 3CBKA 3S3RA 2R6NA 1ZCMA 4PT5A 3PSEA 4BPVA 4DMXA 1TLOA 3H89A 4QRGA 4QRXA 1YVBA 2JQFR 4BOUA 3W31A 4RKXA 3RVVA 1AECA 2PNSA 1M6DA 2WBFX 1CJLA 1QOLA 4M0WA 2ATOA 3F75A 4BSQA 3H6SA 4OELA 4W4UA 1AU0A 2IPPB 5CHTA 4DMYA 2PREA 3P5VA 2R9MA 4HWYA 1EF7A 4P6EA 2C0YA 3MP2A 3QT4A 3KWZA 4YYVA 3B79A 1PBHA 3H8CA 1NLJA 2HH5A 3C9EA 1K3BB 1QXPA 1ME4A 4IUMA 3V6EA 1PCIA 1MHWA 2R9FA 2YJ8A 3BOWA 3BPMA 3IEJA 3BPFA 5JA7A 1CSBB 4MZSA 4N4ZA 2DCDA 5CVOB 1TU6A 1EWMA 4OVZB 1VJVA 2FRAA 3BCNA 4BOPA 1AU4A 2B1NA 3IV2A 2GHUA 3TNXA 3I06A 3BY4A 3PNRA 4WURA 2AGAA 2G8JA 4HXDB 2BDZA 1KFUL 8PCHA 1F2CA 3IOQA 4RF0A 2FRQA 5KO3A 2R9OA 2GFOA 2P0RA 2DC8A 7PCKA 1CPJA 1GECE 1YALA 4YYRA 1U9WA 3MHSA 3CH2X 1DKIA 2DZZA 3PBHA 4YVAA 2E02A 5CHVA 2XU5A 1ITOA 2NQDB 1SNKA 4PADA 1CS8A 3WXFA 4MSXA 3LFYA 1Y4HA 2DJGB 2DOSA 1NQCA 4REZA 2FQ9A 3M99A 3MORA 1POPA 1PPPA 3DF0A 1CB5A 3KKUA 3LXSA 2G6DA 3I3TA 1Y08A 2DC9A 6PADA 4QRVA 1NL6A 2P7UA 1VSNA 3H7DA 4D8BA 1ATKA 2P86A 5J94A 4BOZA 2VHFA 3MTVA 3QJ3A 3BWKA 4RY2A 1F29A 1EWLA 3P5XA 3O65A 1GCBA 4W5BA 4PI3A 3PW3A 3CH3X 2DC6A 3HWNA 2F1GA 1NB3A 1CTEA 4RF1A 3K8UA 3OISA 4CDFB 3TRKA 4PP1A
chains in the Genus database with same CATH topology
4Q8HA 2H7JA 5A24A 1EWOA 5EGWA 2VFBA 3CBJA 4WA6A 1U9VA 4K7CA 5CVNB 1CV8A 1AU2A 1MEMA 4X6HA 1S4VA 4XUIA 1YK8A 9PAPA 4Q8GA 1PPDA 2JQGR 2DCAA 4NV8A 4CZWA 1EWPA 3AI8A 1AYWA 1DF0A 2AUXA 4I05A 2HXZA 3IHPA 1BGOA 4BS5A 3QSDA 1PADA 2XU1A 2AIMA 4CDCB 1U9XA 2B1MA 3MTNA 4AXLA 3V6CA 1W5RA 4YYUA 3U8EA 2DCCA 2ACTA 4X6JA 4BQVA 1F2AA 2FTDA 1X9YA 4W5CA 1F2BA 1KHQA 1THEA 1MEGA 1U5IA 3KX1A 1QMYA 1KHPA 4I07A 4YYWA 3P5WA 1MDWA 5F02A 1DEUA 3E1ZB 3F5VA 3USVA 1TL9A 2F7DA 2BDLA 3KFQA 4FIPA 3WXEA 1AYVA 5FPWA 2O6XA 4CDEB 3RVXA 1CQDA 3HHAA 3K24A 4FK5A 4ZUXU 2AYOA 3NHEA 1GLOA 2AU1A 2E00A 1ICFA 3ZUAA 1YT7A 4CDDB 2Y5BA 2E03A 1BY8A 1O0EA 2VHSA 2DCBA 1KFXL 1BQIA 3IMAA 2ARYA 4YV8A 3KW9A 4BGFA 4G54A 3OVXA 3HHIA 1STFE 2G8EA 4PP2E 2AYNA 1XKGA 3BC3A 1A6RA 2CIOA 2AVWA 5K16A 3GCBA 3HD3A 2VFCA 3ERVA 1SP4B 4I04A 1Q6KA 4QBBA 4BS6A 5CVMA 2FYEA 2AS8A 4X6IA 2XU3A 5PADA 1CVZA 1HUCB 5JH3A 4KLBA 2PADA 3OF9A 3O0UA 1KXRA 4N79A 5EF4A 3IUTA 3N3KA 4XR7A 1NB5A 1MS6A 4NV7A 1BP4A 2DC7A 3K9MA 1AU3A 3OF8A 3PDFA 2E01A 3N3GA 1QDQA 2NQIA 2DJFB 2YJBA 2NQGA 2Y6EA 1FH0A 4OEMA 1U9QX 1PPNA 2FT2A 1ZIVA 1MIRA 3KWBX 3KSEA 2PBHA 2R9CA 2YJCA 3D6SA 2G7YA 1AYUA 2FO5A 4MZOA 4P6GA 4QH6A 4FJCA 4YYSA 1IWDA 1GX3A 2HD5A 1JQPA 2OZ2A 2YJ2A 3WXGA 1ME3A 1PE6A 3P5UA 4AXMA 1PXVA 1PPOA 1NPZA 3H8BA 2YJ9A 3S3QA 1PIPA 1YK7A 2OULA 2R9NA 2OP3A 2FUDA 2DZYA 2CB5A 2NQAA 3MHHA 4N8WA 1AIMA 1W4TA 2IBIA 2AUZA 3D9WA 3N4CA 3RVWA 2HHNA 3OVZA 4YYQA 3O1GA 2XU4A 1GMYA 3CBKA 4B55A 3S3RA 2R6NA 1ZCMA 4BPVA 4DMXA 1TLOA 3H89A 4QRGA 4QRXA 1YVBA 2JQFR 3RVVA 1AECA 2PNSA 1M6DA 2WBFX 1CJLA 1QOLA 2ATOA 3F75A 4BSQA 3H6SA 4OELA 4W4UA 1AU0A 2IPPB 5CHTA 4DMYA 2PREA 3P5VA 2R9MA 4HWYA 3LTWA 2BSZA 1EF7A 4P6EA 2C0YA 4YYVA 3QT4A 3KWZA 3B79A 1PBHA 3H8CA 4C5PA 1NLJA 4GUZA 2HH5A 3C9EA 1K3BB 1QXPA 1ME4A 3V6EA 1PCIA 1MHWA 2R9FA 2YJ8A 3BOWA 3BPMA 3IEJA 3BPFA 5JA7A 1CSBB 4MZSA 4N4ZA 2DCDA 5CVOB 1TU6A 1EWMA 1VJVA 2FRAA 3BCNA 1AU4A 2B1NA 3IV2A 2GHUA 3TNXA 3I06A 3PNRA 2G8JA 2BDZA 1KFUL 8PCHA 1F2CA 3IOQA 2FRQA 2R9OA 2GFOA 2P0RA 2DC8A 7PCKA 1CPJA 1GECE 1YALA 4YYRA 1U9WA 3MHSA 3CH2X 2DZZA 3PBHA 4YVAA 2E02A 5CHVA 2XU5A 1ITOA 2NQDB 1SNKA 4PADA 1CS8A 3WXFA 4MSXA 3LFYA 1Y4HA 2DJGB 1NQCA 2FQ9A 3M99A 3MORA 1POPA 1PPPA 3DF0A 1CB5A 3KKUA 3LXSA 2G6DA 3I3TA 1W6FA 1Y08A 2DC9A 6PADA 4QRVA 1NL6A 2P7UA 1VSNA 3H7DA 1ATKA 2P86A 5J94A 2VHFA 3QJ3A 3BWKA 4RY2A 1F29A 1EWLA 3P5XA 1GCBA 1E2TA 4W5BA 4PI3A 3PW3A 3CH3X 2DC6A 3HWNA 2F1GA 1NB3A 1CTEA 3K8UA 3OISA 4CDFB 4PP1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Q8H A;  2H7J A;  5A24 A;  1EWO A;  5EGW A;  3CBJ A;  4WA6 A;  1U9V A;  4K7C A;  5CVN B;  1CV8 A;  1AU2 A;  1MEM A;  4X6H A;  1S4V A;  4XUI A;  1YK8 A;  9PAP A;  4Q8G A;  1PPD A;  2JQG R;  2DCA A;  4CZW A;  1EWP A;  3AI8 A;  1AYW A;  1DF0 A;  2AUX A;  4I05 A;  2HXZ A;  3IHP A;  1BGO A;  4BS5 A;  3QSD A;  1PAD A;  2XU1 A;  2AIM A;  4CDC B;  1U9X A;  2B1M A;  3MTN A;  4AXL A;  3V6C A;  4YYU A;  3U8E A;  2DCC A;  2ACT A;  4X6J A;  4BQV A;  1F2A A;  2FTD A;  1X9Y A;  4W5C A;  1F2B A;  1KHQ A;  1THE A;  1MEG A;  1U5I A;  3KX1 A;  1QMY A;  1KHP A;  4I07 A;  4YYW A;  3P5W A;  1MDW A;  5F02 A;  1DEU A;  3E1Z B;  3F5V A;  3USV A;  1TL9 A;  2F7D A;  2BDL A;  3KFQ A;  4FIP A;  3WXE A;  1AYV A;  5FPW A;  2O6X A;  4CDE B;  3RVX A;  1CQD A;  3HHA A;  3K24 A;  4FK5 A;  4ZUX U;  2AYO A;  3NHE A;  1GLO A;  2AU1 A;  2E00 A;  1ICF A;  3ZUA A;  1YT7 A;  4CDD B;  2Y5B A;  2E03 A;  1BY8 A;  1O0E A;  2VHS A;  2DCB A;  1KFX L;  1BQI A;  3IMA A;  2ARY A;  4YV8 A;  3KW9 A;  4G54 A;  3OVX A;  3HHI A;  4PP2 E;  1STF E;  2G8E A;  2AYN A;  1XKG A;  3BC3 A;  1A6R A;  2CIO A;  2AVW A;  5K16 A;  3GCB A;  3HD3 A;  3ERV A;  1SP4 B;  4I04 A;  1Q6K A;  4QBB A;  4BS6 A;  5CVM A;  2FYE A;  2AS8 A;  4X6I A;  2XU3 A;  5PAD A;  1CVZ A;  1HUC B;  5JH3 A;  4KLB A;  2PAD A;  3OF9 A;  3O0U A;  1KXR A;  4N79 A;  5EF4 A;  3IUT A;  3N3K A;  4XR7 A;  1NB5 A;  1MS6 A;  1BP4 A;  2DC7 A;  3K9M A;  1AU3 A;  3OF8 A;  3PDF A;  2E01 A;  3N3G A;  1QDQ A;  2NQI A;  2DJF B;  2YJB A;  2NQG A;  2Y6E A;  1FH0 A;  4OEM A;  1U9Q X;  1PPN A;  2FT2 A;  1ZIV A;  1MIR A;  3KWB X;  3KSE A;  2PBH A;  2R9C A;  2YJC A;  3D6S A;  2G7Y A;  1AYU A;  2FO5 A;  4MZO A;  4P6G A;  4QH6 A;  4FJC A;  4YYS A;  1IWD A;  2HD5 A;  1JQP A;  2OZ2 A;  2YJ2 A;  3WXG A;  1ME3 A;  1PE6 A;  3P5U A;  4AXM A;  1PXV A;  1PPO A;  1NPZ A;  3H8B A;  2YJ9 A;  3S3Q A;  1PIP A;  1YK7 A;  2OUL A;  2R9N A;  2OP3 A;  2FUD A;  2DZY A;  2CB5 A;  2NQA A;  3MHH A;  4N8W A;  1AIM A;  2IBI A;  2AUZ A;  3N4C A;  3RVW A;  2HHN A;  3OVZ A;  4YYQ A;  3O1G A;  2XU4 A;  1GMY A;  3CBK A;  3S3R A;  2R6N A;  1ZCM A;  4BPV A;  4DMX A;  1TLO A;  3H89 A;  4QRG A;  4QRX A;  1YVB A;  2JQF R;  3RVV A;  1AEC A;  2PNS A;  1M6D A;  2WBF X;  1CJL A;  1QOL A;  2ATO A;  3F75 A;  4BSQ A;  3H6S A;  4OEL A;  4W4U A;  1AU0 A;  2IPP B;  5CHT A;  4DMY A;  2PRE A;  3P5V A;  2R9M A;  4HWY A;  4P6E A;  1EF7 A;  2C0Y A;  4YYV A;  3QT4 A;  3KWZ A;  3B79 A;  1PBH A;  3H8C A;  1NLJ A;  2HH5 A;  3C9E A;  1K3B B;  1QXP A;  1ME4 A;  3V6E A;  1PCI A;  1MHW A;  2R9F A;  2YJ8 A;  3BOW A;  3BPM A;  3IEJ A;  3BPF A;  5JA7 A;  1CSB B;  4MZS A;  4N4Z A;  2DCD A;  5CVO B;  1TU6 A;  1EWM A;  1VJV A;  2FRA A;  3BCN A;  1AU4 A;  2B1N A;  3IV2 A;  2GHU A;  3TNX A;  3I06 A;  3PNR A;  2G8J A;  2BDZ A;  1KFU L;  8PCH A;  1F2C A;  3IOQ A;  2FRQ A;  2R9O A;  2GFO A;  2P0R A;  2DC8 A;  7PCK A;  1CPJ A;  1GEC E;  1YAL A;  4YYR A;  1U9W A;  3MHS A;  3CH2 X;  2DZZ A;  3PBH A;  4YVA A;  2E02 A;  5CHV A;  2XU5 A;  1ITO A;  2NQD B;  1SNK A;  4PAD A;  1CS8 A;  3WXF A;  4MSX A;  3LFY A;  1Y4H A;  2DJG B;  1NQC A;  2FQ9 A;  3M99 A;  3MOR A;  1POP A;  1PPP A;  3DF0 A;  1CB5 A;  3KKU A;  3LXS A;  2G6D A;  3I3T A;  1Y08 A;  2DC9 A;  6PAD A;  4QRV A;  1NL6 A;  2P7U A;  1VSN A;  3H7D A;  1ATK A;  2P86 A;  5J94 A;  2VHF A;  3QJ3 A;  3BWK A;  4RY2 A;  1F29 A;  1EWL A;  3P5X A;  1GCB A;  4W5B A;  4PI3 A;  3PW3 A;  3CH3 X;  2DC6 A;  3HWN A;  2F1G A;  1NB3 A;  1CTE A;  3K8U A;  3OIS A;  4CDF B;  4PP1 A; 
#chains in the Genus database with same CATH topology
 2BTW B;  4Q8H A;  2H7J A;  2FE8 A;  5A24 A;  1EWO A;  5EGW A;  3CBJ A;  4WA6 A;  1U9V A;  3E9S A;  4K7C A;  5CVN B;  1CV8 A;  4A5U A;  1AU2 A;  1MEM A;  4X6H A;  1S4V A;  4XUI A;  1YK8 A;  3BBA A;  9PAP A;  4Q8G A;  1PPD A;  2JQG R;  2DCA A;  4D8E A;  4CZW A;  1EWP A;  3AI8 A;  1AYW A;  1DF0 A;  1YZB A;  2AUX A;  4I05 A;  4D8I A;  2HXZ A;  3B21 A;  3IHP A;  1BGO A;  4BS5 A;  3QSD A;  1PAD A;  2XU1 A;  3C0R A;  2AIM A;  4CDC B;  1U9X A;  2B1M A;  3MTN A;  4AXL A;  3V6C A;  4YYU A;  3U8E A;  2DCC A;  2ACT A;  4X6J A;  4BQV A;  4XZX A;  1F2A A;  2FTD A;  2HWK A;  1X9Y A;  4W5C A;  1F2B A;  1KHQ A;  3ZNH A;  1THE A;  1MEG A;  1U5I A;  5JZE A;  2Z84 A;  4OW0 A;  3OQC A;  3PHU A;  3KX1 A;  1QMY A;  1KHP A;  4I07 A;  4BOS A;  4YYW A;  3P5W A;  1MDW A;  5F02 A;  1DEU A;  3PRP A;  3E1Z B;  3F5V A;  4RNA A;  3USV A;  3MJ5 A;  1TL9 A;  2F7D A;  2BDL A;  3KFQ A;  4FIP A;  3WXE A;  1AYV A;  5FPW A;  1PVJ A;  2JTC A;  2O6X A;  4CDE B;  5E6J A;  3RVX A;  1CQD A;  3HHA A;  3K24 A;  4FK5 A;  4ZUX U;  2AYO A;  3NHE A;  1GLO A;  2AU1 A;  2E00 A;  1ICF A;  3ZUA A;  1YT7 A;  4CDD B;  2Y5B A;  2E03 A;  1BY8 A;  5EZS A;  1O0E A;  2VHS A;  2DCB A;  1KFX L;  1BQI A;  2JRI A;  3IMA A;  2ARY A;  4YV8 A;  3RNV A;  3KW9 A;  4G54 A;  3OVX A;  3HHI A;  1STF E;  2G8E A;  4PP2 E;  4MM3 B;  3PT2 A;  2AYN A;  1XKG A;  4P16 A;  3BC3 A;  1A6R A;  2CIO A;  2AVW A;  5K16 A;  3GCB A;  3HD3 A;  3ERV A;  1SP4 B;  4I04 A;  1Q6K A;  4QBB A;  4BS6 A;  5CVM A;  2FYE A;  4BOQ A;  2AS8 A;  4X6I A;  2XU3 A;  4ZTB A;  5EZQ A;  3TMP A;  5PAD A;  1CVZ A;  1HUC B;  5JH3 A;  4KLB A;  2PAD A;  3OF9 A;  3IFU A;  3O0U A;  1KXR A;  3W30 A;  4N79 A;  5EF4 A;  3IUT A;  4GUA A;  3N3K A;  4XR7 A;  1NB5 A;  1MS6 A;  4OVZ A;  1BP4 A;  2DC7 A;  3K9M A;  1AU3 A;  3OF8 A;  3PRM A;  3PDF A;  2E01 A;  3N3G A;  1QDQ A;  2NQI A;  4MI7 A;  2DJF B;  2YJB A;  2NQG A;  2Y6E A;  1FH0 A;  4OEM A;  1U9Q X;  1PPN A;  2FT2 A;  1ZIV A;  1MIR A;  3KWB X;  3KSE A;  2PBH A;  2R9C A;  2YJC A;  3D6S A;  2G7Y A;  1AYU A;  2FO5 A;  1UKF A;  3PHW A;  4MZO A;  4P6G A;  4QH6 A;  2UZJ A;  4FJC A;  4YYS A;  4R3D A;  1IWD A;  2HD5 A;  1JQP A;  4IP3 A;  2OZ2 A;  2YJ2 A;  3WXG A;  1ME3 A;  1PE6 A;  2J7Q C;  3P5U A;  2BU3 A;  4AXM A;  3PHX A;  1PXV A;  1PPO A;  1NPZ A;  3H8B A;  2YJ9 A;  3S3Q A;  1PIP A;  1YK7 A;  2OUL A;  2R9N A;  2OP3 A;  2FUD A;  2DZY A;  2CB5 A;  2NQA A;  3MHH A;  4N8W A;  3BB7 A;  1AIM A;  2IBI A;  2AUZ A;  3N4C A;  3RVW A;  2HHN A;  3OVZ A;  4YYQ A;  3O1G A;  2J7Q A;  2BTW A;  2XU4 A;  1GMY A;  3CBK A;  3S3R A;  2R6N A;  1ZCM A;  4PT5 A;  3PSE A;  4BPV A;  4DMX A;  1TLO A;  3H89 A;  4QRG A;  4QRX A;  1YVB A;  2JQF R;  4BOU A;  3W31 A;  4RKX A;  3RVV A;  1AEC A;  2PNS A;  1M6D A;  2WBF X;  1CJL A;  1QOL A;  4M0W A;  2ATO A;  3F75 A;  4BSQ A;  3H6S A;  4OEL A;  4W4U A;  1AU0 A;  2IPP B;  5CHT A;  4DMY A;  2PRE A;  3P5V A;  2R9M A;  4HWY A;  1EF7 A;  4P6E A;  2C0Y A;  3MP2 A;  3QT4 A;  3KWZ A;  4YYV A;  3B79 A;  1PBH A;  3H8C A;  1NLJ A;  2HH5 A;  3C9E A;  1K3B B;  1QXP A;  1ME4 A;  4IUM A;  3V6E A;  1PCI A;  1MHW A;  2R9F A;  2YJ8 A;  3BOW A;  3BPM A;  3IEJ A;  3BPF A;  5JA7 A;  1CSB B;  4MZS A;  4N4Z A;  2DCD A;  5CVO B;  1TU6 A;  1EWM A;  4OVZ B;  1VJV A;  2FRA A;  3BCN A;  4BOP A;  1AU4 A;  2B1N A;  3IV2 A;  2GHU A;  3TNX A;  3I06 A;  3BY4 A;  3PNR A;  4WUR A;  2AGA A;  2G8J A;  4HXD B;  2BDZ A;  1KFU L;  8PCH A;  1F2C A;  3IOQ A;  4RF0 A;  2FRQ A;  5KO3 A;  2R9O A;  2GFO A;  2P0R A;  2DC8 A;  7PCK A;  1CPJ A;  1GEC E;  1YAL A;  4YYR A;  1U9W A;  3MHS A;  3CH2 X;  1DKI A;  2DZZ A;  3PBH A;  4YVA A;  2E02 A;  5CHV A;  2XU5 A;  1ITO A;  2NQD B;  1SNK A;  4PAD A;  1CS8 A;  3WXF A;  4MSX A;  3LFY A;  1Y4H A;  2DJG B;  2DOS A;  1NQC A;  4REZ A;  2FQ9 A;  3M99 A;  3MOR A;  1POP A;  1PPP A;  3DF0 A;  1CB5 A;  3KKU A;  3LXS A;  2G6D A;  3I3T A;  1Y08 A;  2DC9 A;  6PAD A;  4QRV A;  1NL6 A;  2P7U A;  1VSN A;  3H7D A;  4D8B A;  1ATK A;  2P86 A;  5J94 A;  4BOZ A;  2VHF A;  3MTV A;  3QJ3 A;  3BWK A;  4RY2 A;  1F29 A;  1EWL A;  3P5X A;  3O65 A;  1GCB A;  4W5B A;  4PI3 A;  3PW3 A;  3CH3 X;  2DC6 A;  3HWN A;  2F1G A;  1NB3 A;  1CTE A;  4RF1 A;  3K8U A;  3OIS A;  4CDF B;  3TRK A;  4PP1 A; 
#chains in the Genus database with same CATH homology
 4Q8H A;  2H7J A;  5A24 A;  1EWO A;  5EGW A;  2VFB A;  3CBJ A;  4WA6 A;  1U9V A;  4K7C A;  5CVN B;  1CV8 A;  1AU2 A;  1MEM A;  4X6H A;  1S4V A;  4XUI A;  1YK8 A;  9PAP A;  4Q8G A;  1PPD A;  2JQG R;  2DCA A;  4NV8 A;  4CZW A;  1EWP A;  3AI8 A;  1AYW A;  1DF0 A;  2AUX A;  4I05 A;  2HXZ A;  3IHP A;  1BGO A;  4BS5 A;  3QSD A;  1PAD A;  2XU1 A;  2AIM A;  4CDC B;  1U9X A;  2B1M A;  3MTN A;  4AXL A;  3V6C A;  1W5R A;  4YYU A;  3U8E A;  2DCC A;  2ACT A;  4X6J A;  4BQV A;  1F2A A;  2FTD A;  1X9Y A;  4W5C A;  1F2B A;  1KHQ A;  1THE A;  1MEG A;  1U5I A;  3KX1 A;  1QMY A;  1KHP A;  4I07 A;  4YYW A;  3P5W A;  1MDW A;  5F02 A;  1DEU A;  3E1Z B;  3F5V A;  3USV A;  1TL9 A;  2F7D A;  2BDL A;  3KFQ A;  4FIP A;  3WXE A;  1AYV A;  5FPW A;  2O6X A;  4CDE B;  3RVX A;  1CQD A;  3HHA A;  3K24 A;  4FK5 A;  4ZUX U;  2AYO A;  3NHE A;  1GLO A;  2AU1 A;  2E00 A;  1ICF A;  3ZUA A;  1YT7 A;  4CDD B;  2Y5B A;  2E03 A;  1BY8 A;  1O0E A;  2VHS A;  2DCB A;  1KFX L;  1BQI A;  3IMA A;  2ARY A;  4YV8 A;  3KW9 A;  4BGF A;  4G54 A;  3OVX A;  3HHI A;  1STF E;  2G8E A;  4PP2 E;  2AYN A;  1XKG A;  3BC3 A;  1A6R A;  2CIO A;  2AVW A;  5K16 A;  3GCB A;  3HD3 A;  2VFC A;  3ERV A;  1SP4 B;  4I04 A;  1Q6K A;  4QBB A;  4BS6 A;  5CVM A;  2FYE A;  2AS8 A;  4X6I A;  2XU3 A;  5PAD A;  1CVZ A;  1HUC B;  5JH3 A;  4KLB A;  2PAD A;  3OF9 A;  3O0U A;  1KXR A;  4N79 A;  5EF4 A;  3IUT A;  3N3K A;  4XR7 A;  1NB5 A;  1MS6 A;  4NV7 A;  1BP4 A;  2DC7 A;  3K9M A;  1AU3 A;  3OF8 A;  3PDF A;  2E01 A;  3N3G A;  1QDQ A;  2NQI A;  2DJF B;  2YJB A;  2NQG A;  2Y6E A;  1FH0 A;  4OEM A;  1U9Q X;  1PPN A;  2FT2 A;  1ZIV A;  1MIR A;  3KWB X;  3KSE A;  2PBH A;  2R9C A;  2YJC A;  3D6S A;  2G7Y A;  1AYU A;  2FO5 A;  4MZO A;  4P6G A;  4QH6 A;  4FJC A;  4YYS A;  1IWD A;  1GX3 A;  2HD5 A;  1JQP A;  2OZ2 A;  2YJ2 A;  3WXG A;  1ME3 A;  1PE6 A;  3P5U A;  4AXM A;  1PXV A;  1PPO A;  1NPZ A;  3H8B A;  2YJ9 A;  3S3Q A;  1PIP A;  1YK7 A;  2OUL A;  2R9N A;  2OP3 A;  2FUD A;  2DZY A;  2CB5 A;  2NQA A;  3MHH A;  4N8W A;  1AIM A;  1W4T A;  2IBI A;  2AUZ A;  3D9W A;  3N4C A;  3RVW A;  2HHN A;  3OVZ A;  4YYQ A;  3O1G A;  2XU4 A;  1GMY A;  3CBK A;  4B55 A;  3S3R A;  2R6N A;  1ZCM A;  4BPV A;  4DMX A;  1TLO A;  3H89 A;  4QRG A;  4QRX A;  1YVB A;  2JQF R;  3RVV A;  1AEC A;  2PNS A;  1M6D A;  2WBF X;  1CJL A;  1QOL A;  2ATO A;  3F75 A;  4BSQ A;  3H6S A;  4OEL A;  4W4U A;  1AU0 A;  2IPP B;  5CHT A;  4DMY A;  2PRE A;  3P5V A;  2R9M A;  4HWY A;  3LTW A;  2BSZ A;  1EF7 A;  4P6E A;  2C0Y A;  4YYV A;  3QT4 A;  3KWZ A;  3B79 A;  1PBH A;  3H8C A;  4C5P A;  1NLJ A;  4GUZ A;  2HH5 A;  3C9E A;  1K3B B;  1QXP A;  1ME4 A;  3V6E A;  1PCI A;  1MHW A;  2R9F A;  2YJ8 A;  3BOW A;  3BPM A;  3IEJ A;  3BPF A;  5JA7 A;  1CSB B;  4MZS A;  4N4Z A;  2DCD A;  5CVO B;  1TU6 A;  1EWM A;  1VJV A;  2FRA A;  3BCN A;  1AU4 A;  2B1N A;  3IV2 A;  2GHU A;  3TNX A;  3I06 A;  3PNR A;  2G8J A;  2BDZ A;  1KFU L;  8PCH A;  1F2C A;  3IOQ A;  2FRQ A;  2R9O A;  2GFO A;  2P0R A;  2DC8 A;  7PCK A;  1CPJ A;  1GEC E;  1YAL A;  4YYR A;  1U9W A;  3MHS A;  3CH2 X;  2DZZ A;  3PBH A;  4YVA A;  2E02 A;  5CHV A;  2XU5 A;  1ITO A;  2NQD B;  1SNK A;  4PAD A;  1CS8 A;  3WXF A;  4MSX A;  3LFY A;  1Y4H A;  2DJG B;  1NQC A;  2FQ9 A;  3M99 A;  3MOR A;  1POP A;  1PPP A;  3DF0 A;  1CB5 A;  3KKU A;  3LXS A;  2G6D A;  3I3T A;  1W6F A;  1Y08 A;  2DC9 A;  6PAD A;  4QRV A;  1NL6 A;  2P7U A;  1VSN A;  3H7D A;  1ATK A;  2P86 A;  5J94 A;  2VHF A;  3QJ3 A;  3BWK A;  4RY2 A;  1F29 A;  1EWL A;  3P5X A;  1GCB A;  1E2T A;  4W5B A;  4PI3 A;  3PW3 A;  3CH3 X;  2DC6 A;  3HWN A;  2F1G A;  1NB3 A;  1CTE A;  3K8U A;  3OIS A;  4CDF B;  4PP1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...