2G6DA

Human cathepsin s mutant with vinyl sulfone inhibitor cra-14009
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
217
structure length
217
Chain Sequence
b'LPDSVDWREKGCVTEVKYQGSCGACWAFSAVGALEAQLKLKTGKLVSLSAQNLVDCSTEKYGNKGCNGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYDSKYRAATCRKYTELPYGREDVLKEAVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSWGHNFGEKGYIRMARNKGNHCGIASFPSYPEI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cathepsin S
publication title Human cathepsin S mutant with vinyl sulfone inhibitor CRA-14009
rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 67
structure length 217
sequence length 217
ec nomenclature ec 3.4.22.27: Cathepsin S.
pdb deposition date 2006-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2g6dA00
3OF8A 2DC7A 1JQPA 3K9MA 2FO5A 4DMXA 3V6CA 3WXEA 4YYQA 2ATOA 1CSBB 3H89A 2GHUA 4QRGA 4I05A 3O1GA 1EWMA 1AYUA 3BPMA 3B79A 3ERVA 3KX1A 4CDFB 5CVMA 3GCBA 2VHFA 2R9OA 1NLJA 1EWLA 1S4VA 1AYWA 3IV2A 2R9NA 4PI3A 4FIPA 3MHSA 3DF0A 1BP4A 3LFYA 4RY2A 1BQIA 4YYRA 3P5WA 2YJBA 1Y4HA 1CVZA 1EWPA 1U9VA 4BS5A 2JQFR 1U9QX 1KHPA 3H8CA 3PBHA 4CDDB 2G8EA 4N79A 3KWZA 3PDFA 1MIRA 2Y6EA 1U9XA 1KXRA 2VHSA 2WBFX 4QBBA 5JA7A 2PNSA 2HH5A 3IUTA 1DEUA 2NQGA 1TL9A 3S3QA 4CDCB 2XU1A 4DMYA 3RVXA 4Q8GA 1BY8A 1AU2A 3E1ZB 5CVOB 1ZIVA 1SNKA 3QT4A 1AIMA 2R9CA 2E03A 2R6NA 4N8WA 2C0YA 4N4ZA 3KKUA 2B1NA 2OULA 4YYVA 1Y08A 1AU4A 3V6EA 2NQIA 1VSNA 1YK7A 1YT7A 3N4CA 4XR7A 4FK5A 2AU1A 4PADA 1QMYA 3F5VA 3S3RA 2JQGR 1CQDA 2YJ8A 3BPFA 3F75A 3H7DA 2PADA 3M99A 2FTDA 5F02A 1QXPA 4ZUXU 1POPA 2AS8A 1PXVA 1CJLA 2FYEA 3U8EA 1MEMA 1TU6A 3RVWA 4X6JA 2P7UA 2ARYA 1ICFA 1VJVA 2CB5A 1STFE 3KW9A 1CV8A 4CZWA 3C9EA 1AECA 3IEJA 5CHVA 2DJFB 4BSQA 1MEGA 1YK8A 1PADA 2PREA 2BDLA 4X6IA 3P5VA 4P6GA 3IMAA 1ME3A 2B1MA 4AXMA 1IWDA 2DCCA 2CIOA 4PP2E 1AU3A 1SP4B 5EGWA 4YVAA 7PCKA 2AUZA 1CPJA 2YJCA 1YVBA 2AVWA 2G7YA 4PP1A 4P6EA 2F1GA 2NQDB 3NHEA 1KHQA 1YALA 2FRQA 1F2BA 4K7CA 1MHWA 4X6HA 2DC8A 1K3BB 2DCDA 1GCBA 3USVA 5FPWA 1EF7A 2BDZA 5A24A 1MDWA 4BPVA 3N3KA 1XKGA 1PPOA 5EF4A 2FRAA 2DC6A 2XU4A 3P5UA 1TLOA 3K24A 1A6RA 3H8BA 3I3TA 5K16A 1PPPA 3IOQA 4I07A 3HHIA 4HWYA 3BCNA 4BQVA 3K8UA 2DCAA 2GFOA 4Q8HA 2FUDA 1GECE 3N3GA 5PADA 1CB5A 2Y5BA 3OISA 3WXFA 1MS6A 1PE6A 2YJ9A 3WXGA 3H6SA 1BGOA 3CBKA 1NQCA 3LXSA 1Q6KA 4OEMA 4KLBA 2AYOA 2XU5A 4YYUA 2PBHA 5CVNB 3HD3A 1U9WA 1PPDA 1PIPA 4YYSA 4QRVA 1ME4A 3MORA 9PAPA 2IPPB 2OP3A 5J94A 3ZUAA 2FQ9A 2DC9A 1GLOA 2ACTA 1F2CA 3P5XA 2G6DA 1KFUL 1U5IA 1CTEA 1FH0A 3PW3A 4CDEB 4OELA 4XUIA 3MHHA 2G8JA 2YJ2A 1PBHA 3OVXA 4BS6A 2AUXA 2AYNA 1ZCMA 1PCIA 3CH2X 3I06A 2FT2A 1NB5A 1PPNA 4YV8A 3TNXA 1KFXL 1F2AA 3RVVA 3IHPA 1X9YA 4W5BA 4MZOA 1NB3A 1O0EA 1AYVA 3PNRA 4WA6A 1DF0A 3OF9A 2DZYA 3MTNA 3KWBX 3KFQA 2F7DA 2DZZA 2E00A 1NPZA 2HHNA 3HWNA 4G54A 4MSXA 4W5CA 1CS8A 2OZ2A 1QDQA 2H7JA 1AU0A 3BOWA 3D6SA 2DCBA 3OVZA 3BWKA 2R9MA 3QJ3A 1F29A 2IBIA 1THEA 4YYWA 2P86A 3HHAA 2NQAA 2P0RA 3O0UA 6PADA 2O6XA 3CH3X 4W4UA 1QOLA 2HXZA 1ITOA 4AXLA 3QSDA 3CBJA 1HUCB 3BC3A 2E01A 3KSEA 4QH6A 2XU3A 2AIMA 5CHTA 1GMYA 4FJCA 1EWOA 4QRXA 8PCHA 3AI8A 2DJGB 5JH3A 1ATKA 1NL6A 2E02A 2R9FA 1M6DA 4I04A 4MZSA 2HD5A
chains in the Genus database with same CATH superfamily
3OF8A 2DC7A 1JQPA 3K9MA 2FO5A 4DMXA 3V6CA 3WXEA 4YYQA 2ATOA 1CSBB 3TMPA 3H89A 2GHUA 4QRGA 4I05A 3O1GA 1EWMA 2BTWA 1AYUA 3BPMA 3B79A 3ERVA 3KX1A 4CDFB 5CVMA 4HXDB 3GCBA 2VHFA 2R9OA 1NLJA 1EWLA 1S4VA 1AYWA 3IV2A 2R9NA 4PI3A 4FIPA 3MHSA 3DF0A 1BP4A 3LFYA 4RY2A 1BQIA 4YYRA 3P5WA 3BBAA 2YJBA 1Y4HA 1CVZA 3MTVA 1EWPA 3W30A 3MP2A 1U9VA 4BS5A 2JQFR 1U9QX 1KHPA 3H8CA 3PBHA 4CDDB 2G8EA 4N79A 3KWZA 3PDFA 4BOQA 1MIRA 4D8IA 2Y6EA 1U9XA 1KXRA 2VHSA 2WBFX 4QBBA 5JA7A 2PNSA 2HH5A 3IUTA 1DEUA 2NQGA 1TL9A 3S3QA 4CDCB 2XU1A 4DMYA 3RVXA 4Q8GA 1BY8A 1AU2A 3E1ZB 3PSEA 5CVOB 1ZIVA 1SNKA 3QT4A 1AIMA 1UKFA 2R9CA 2E03A 2R6NA 4N8WA 2C0YA 4N4ZA 3KKUA 4XZXA 2B1NA 2OULA 4YYVA 3PRMA 1Y08A 1AU4A 3V6EA 2NQIA 3TRKA 1VSNA 1YK7A 1YT7A 3N4CA 4XR7A 4FK5A 4WURA 2AU1A 4PADA 1PVJA 1QMYA 3F5VA 3S3RA 3PT2A 2JQGR 1CQDA 2YJ8A 4A5UA 3BPFA 3F75A 3H7DA 2PADA 4RNAA 3M99A 3MJ5A 2FTDA 5F02A 1QXPA 4ZUXU 1POPA 2AS8A 1PXVA 1CJLA 2FYEA 3E9SA 3U8EA 1MEMA 1TU6A 3RVWA 4R3DA 4X6JA 2HWKA 2P7UA 2ARYA 1ICFA 1VJVA 2CB5A 1STFE 3KW9A 1CV8A 4CZWA 3C9EA 1AECA 2BU3A 3IEJA 1YZBA 5CHVA 2DJFB 4BSQA 1MEGA 4RF0A 4GUAA 1YK8A 1PADA 2PREA 5E6JA 2AGAA 2BDLA 4X6IA 3P5VA 4P6GA 3IMAA 1ME3A 2B1MA 3C0RA 4AXMA 1IWDA 2DCCA 2CIOA 4PP2E 1AU3A 1SP4B 4PT5A 5EGWA 4YVAA 7PCKA 2AUZA 1CPJA 2FE8A 2YJCA 4IP3A 5KO3A 1YVBA 2AVWA 2G7YA 4PP1A 1DKIA 4P6EA 3PHWA 2F1GA 2NQDB 3NHEA 4M0WA 1KHQA 1YALA 2FRQA 1F2BA 4K7CA 1MHWA 4X6HA 2DC8A 1K3BB 4BOSA 2DCDA 1GCBA 3USVA 5FPWA 3O65A 1EF7A 2BDZA 5A24A 3ZNHA 3BY4A 5EZSA 1MDWA 4BOZA 4BPVA 3BB7A 3N3KA 4REZA 2J7QA 4OVZA 1XKGA 4D8EA 1PPOA 5EF4A 2FRAA 2DC6A 2XU4A 3P5UA 1TLOA 2Z84A 3K24A 1A6RA 3H8BA 3I3TA 5K16A 1PPPA 3IOQA 4I07A 3HHIA 4HWYA 3BCNA 4BQVA 3K8UA 2DCAA 2GFOA 4Q8HA 2FUDA 1GECE 3N3GA 4MM3B 5PADA 1CB5A 2Y5BA 3OISA 3WXFA 1MS6A 1PE6A 2YJ9A 3WXGA 3H6SA 1BGOA 3CBKA 1NQCA 4MI7A 3LXSA 1Q6KA 4OEMA 4BOUA 4KLBA 2DOSA 2AYOA 2XU5A 4YYUA 2PBHA 5CVNB 3HD3A 1U9WA 1PPDA 1PIPA 4YYSA 4D8BA 4QRVA 1ME4A 3MORA 9PAPA 2IPPB 2OP3A 5J94A 3ZUAA 4OVZB 2FQ9A 2DC9A 2JTCA 1GLOA 2ACTA 1F2CA 3P5XA 2G6DA 1KFUL 1U5IA 1CTEA 1FH0A 3PW3A 5EZQA 4CDEB 4OELA 4XUIA 3MHHA 2G8JA 3B21A 2YJ2A 1PBHA 3OVXA 4BS6A 2AUXA 2AYNA 1ZCMA 1PCIA 3CH2X 3I06A 3OQCA 2FT2A 1NB5A 1PPNA 5JZEA 3RNVA 4YV8A 4P16A 3TNXA 1KFXL 1F2AA 3W31A 3RVVA 3IHPA 4OW0A 1X9YA 4W5BA 4MZOA 4IUMA 2JRIA 1NB3A 1O0EA 3PHXA 1AYVA 3PNRA 4WA6A 1DF0A 3OF9A 2DZYA 3MTNA 3KWBX 3KFQA 2F7DA 2DZZA 2E00A 1NPZA 2HHNA 3HWNA 4G54A 3IFUA 4MSXA 4W5CA 1CS8A 2OZ2A 1QDQA 2J7QC 2H7JA 1AU0A 3BOWA 3D6SA 2DCBA 3OVZA 3BWKA 2R9MA 2BTWB 3QJ3A 1F29A 2IBIA 1THEA 4RF1A 4YYWA 2P86A 3HHAA 2NQAA 2P0RA 3O0UA 6PADA 2O6XA 3CH3X 4W4UA 1QOLA 2HXZA 1ITOA 4AXLA 3QSDA 3CBJA 1HUCB 3BC3A 4ZTBA 2E01A 3KSEA 4QH6A 2XU3A 2AIMA 5CHTA 1GMYA 4FJCA 1EWOA 2UZJA 4QRXA 4BOPA 8PCHA 3AI8A 2DJGB 5JH3A 4RKXA 1ATKA 1NL6A 3PHUA 2E02A 2R9FA 1M6DA 4I04A 3PRPA 4MZSA 2HD5A
chains in the Genus database with same CATH topology
3OF8A 2DC7A 1JQPA 3K9MA 2FO5A 4DMXA 3V6CA 3WXEA 2VFBA 4YYQA 2ATOA 1CSBB 3H89A 2GHUA 4QRGA 4I05A 3O1GA 1EWMA 1AYUA 3BPMA 3B79A 3ERVA 3KX1A 4CDFB 5CVMA 3GCBA 2VHFA 2R9OA 1NLJA 1EWLA 1S4VA 1AYWA 3IV2A 2R9NA 4PI3A 4FIPA 3MHSA 3DF0A 1W5RA 1BP4A 3LFYA 4RY2A 1BQIA 4YYRA 3P5WA 2YJBA 1Y4HA 1CVZA 1EWPA 1U9VA 4BS5A 2JQFR 1U9QX 1KHPA 3H8CA 3PBHA 4CDDB 2G8EA 4N79A 3KWZA 3PDFA 1MIRA 2Y6EA 1U9XA 1KXRA 2VHSA 2WBFX 4QBBA 5JA7A 2PNSA 2HH5A 3IUTA 1DEUA 2NQGA 1TL9A 3S3QA 4CDCB 2XU1A 4DMYA 3RVXA 4Q8GA 1BY8A 1AU2A 3E1ZB 5CVOB 1ZIVA 1SNKA 3QT4A 1AIMA 2R9CA 2E03A 2R6NA 4N8WA 2C0YA 4N4ZA 3KKUA 2B1NA 2OULA 4YYVA 1Y08A 1AU4A 3V6EA 2NQIA 1VSNA 1YK7A 1YT7A 3N4CA 4XR7A 4FK5A 2AU1A 4PADA 1QMYA 3F5VA 3S3RA 2JQGR 1CQDA 2YJ8A 3BPFA 3F75A 3H7DA 2PADA 3M99A 2FTDA 5F02A 1QXPA 4ZUXU 1POPA 2AS8A 1PXVA 1CJLA 2FYEA 3U8EA 1MEMA 1TU6A 3RVWA 4X6JA 2P7UA 2ARYA 1ICFA 1VJVA 2CB5A 1STFE 3KW9A 1CV8A 4CZWA 4NV7A 3C9EA 1AECA 3IEJA 5CHVA 2DJFB 1E2TA 4BSQA 1MEGA 1YK8A 1PADA 2PREA 2BDLA 4X6IA 3P5VA 4P6GA 3IMAA 1ME3A 2B1MA 4AXMA 1IWDA 2DCCA 2CIOA 4PP2E 1AU3A 1SP4B 5EGWA 4YVAA 7PCKA 2AUZA 1CPJA 2YJCA 1YVBA 2AVWA 2G7YA 4PP1A 4P6EA 2F1GA 2NQDB 3NHEA 1KHQA 1YALA 2FRQA 1F2BA 4K7CA 1MHWA 4X6HA 2DC8A 1K3BB 3D9WA 2DCDA 1GCBA 3USVA 4NV8A 5FPWA 1EF7A 1W6FA 2BDZA 5A24A 1MDWA 4BPVA 3N3KA 1XKGA 1PPOA 5EF4A 2FRAA 2DC6A 2XU4A 4BGFA 3P5UA 1TLOA 3LTWA 3K24A 1A6RA 3H8BA 3I3TA 5K16A 1PPPA 3IOQA 4I07A 3HHIA 4HWYA 3BCNA 4BQVA 3K8UA 2DCAA 2GFOA 4Q8HA 2FUDA 1GECE 3N3GA 5PADA 1CB5A 2Y5BA 3OISA 3WXFA 1MS6A 1PE6A 2YJ9A 3WXGA 3H6SA 1BGOA 3CBKA 1NQCA 3LXSA 1Q6KA 4OEMA 4KLBA 2AYOA 2XU5A 4YYUA 2PBHA 5CVNB 3HD3A 1U9WA 1PPDA 1PIPA 4YYSA 4QRVA 1ME4A 3MORA 9PAPA 2IPPB 2OP3A 5J94A 3ZUAA 2FQ9A 2DC9A 1GLOA 2BSZA 2ACTA 1F2CA 3P5XA 2G6DA 1KFUL 1U5IA 1CTEA 1FH0A 3PW3A 4CDEB 4OELA 4XUIA 3MHHA 2G8JA 2YJ2A 1PBHA 3OVXA 4BS6A 2AUXA 2AYNA 1ZCMA 1PCIA 3CH2X 3I06A 2FT2A 1NB5A 1PPNA 1GX3A 4YV8A 3TNXA 1KFXL 1F2AA 3RVVA 3IHPA 1X9YA 4W5BA 4MZOA 1NB3A 1O0EA 1AYVA 3PNRA 4WA6A 1DF0A 3OF9A 2DZYA 3MTNA 3KWBX 4B55A 3KFQA 2F7DA 2DZZA 2E00A 1NPZA 2HHNA 3HWNA 4G54A 4MSXA 4W5CA 1CS8A 2OZ2A 1W4TA 1QDQA 2H7JA 1AU0A 3BOWA 3D6SA 2DCBA 3OVZA 3BWKA 2R9MA 3QJ3A 1F29A 2IBIA 1THEA 4YYWA 2P86A 3HHAA 2NQAA 2P0RA 3O0UA 6PADA 2O6XA 3CH3X 4W4UA 1QOLA 2HXZA 1ITOA 4AXLA 3QSDA 3CBJA 1HUCB 3BC3A 2E01A 3KSEA 4QH6A 2XU3A 2AIMA 5CHTA 1GMYA 4FJCA 1EWOA 2VFCA 4QRXA 8PCHA 3AI8A 2DJGB 5JH3A 4C5PA 1ATKA 1NL6A 2E02A 2R9FA 1M6DA 4I04A 4GUZA 4MZSA 2HD5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OF8 A;  2DC7 A;  1JQP A;  3K9M A;  2FO5 A;  4DMX A;  3V6C A;  3WXE A;  4YYQ A;  2ATO A;  1CSB B;  3H89 A;  2GHU A;  4QRG A;  4I05 A;  3O1G A;  1EWM A;  1AYU A;  3BPM A;  3B79 A;  3ERV A;  3KX1 A;  4CDF B;  5CVM A;  3GCB A;  2VHF A;  2R9O A;  1NLJ A;  1EWL A;  1S4V A;  1AYW A;  3IV2 A;  2R9N A;  4PI3 A;  4FIP A;  3MHS A;  3DF0 A;  1BP4 A;  3LFY A;  4RY2 A;  1BQI A;  4YYR A;  3P5W A;  2YJB A;  1Y4H A;  1CVZ A;  1EWP A;  1U9V A;  4BS5 A;  2JQF R;  1U9Q X;  1KHP A;  3H8C A;  3PBH A;  4CDD B;  2G8E A;  4N79 A;  3KWZ A;  3PDF A;  1MIR A;  2Y6E A;  1U9X A;  1KXR A;  2VHS A;  2WBF X;  4QBB A;  5JA7 A;  2PNS A;  2HH5 A;  3IUT A;  1DEU A;  2NQG A;  1TL9 A;  3S3Q A;  4CDC B;  2XU1 A;  4DMY A;  3RVX A;  4Q8G A;  1BY8 A;  1AU2 A;  3E1Z B;  5CVO B;  1ZIV A;  1SNK A;  3QT4 A;  1AIM A;  2R9C A;  2E03 A;  2R6N A;  4N8W A;  2C0Y A;  4N4Z A;  3KKU A;  2B1N A;  2OUL A;  4YYV A;  1Y08 A;  1AU4 A;  3V6E A;  2NQI A;  1VSN A;  1YK7 A;  1YT7 A;  3N4C A;  4XR7 A;  4FK5 A;  2AU1 A;  4PAD A;  1QMY A;  3F5V A;  3S3R A;  2JQG R;  1CQD A;  2YJ8 A;  3BPF A;  3F75 A;  3H7D A;  2PAD A;  3M99 A;  2FTD A;  5F02 A;  1QXP A;  4ZUX U;  1POP A;  2AS8 A;  1PXV A;  1CJL A;  2FYE A;  3U8E A;  1MEM A;  1TU6 A;  3RVW A;  4X6J A;  2P7U A;  2ARY A;  1ICF A;  1VJV A;  2CB5 A;  1STF E;  3KW9 A;  1CV8 A;  4CZW A;  3C9E A;  1AEC A;  3IEJ A;  5CHV A;  2DJF B;  4BSQ A;  1MEG A;  1YK8 A;  1PAD A;  2PRE A;  2BDL A;  4X6I A;  3P5V A;  4P6G A;  3IMA A;  1ME3 A;  2B1M A;  4AXM A;  1IWD A;  2DCC A;  2CIO A;  4PP2 E;  1AU3 A;  1SP4 B;  5EGW A;  4YVA A;  7PCK A;  2AUZ A;  1CPJ A;  2YJC A;  1YVB A;  2AVW A;  2G7Y A;  4PP1 A;  4P6E A;  2F1G A;  2NQD B;  3NHE A;  1KHQ A;  1YAL A;  2FRQ A;  1F2B A;  4K7C A;  1MHW A;  4X6H A;  2DC8 A;  1K3B B;  2DCD A;  1GCB A;  3USV A;  5FPW A;  1EF7 A;  2BDZ A;  5A24 A;  1MDW A;  4BPV A;  3N3K A;  1XKG A;  1PPO A;  5EF4 A;  2FRA A;  2DC6 A;  2XU4 A;  3P5U A;  1TLO A;  3K24 A;  1A6R A;  3H8B A;  3I3T A;  5K16 A;  1PPP A;  3IOQ A;  4I07 A;  3HHI A;  4HWY A;  3BCN A;  4BQV A;  3K8U A;  2DCA A;  2GFO A;  4Q8H A;  2FUD A;  1GEC E;  3N3G A;  5PAD A;  1CB5 A;  2Y5B A;  3OIS A;  3WXF A;  1MS6 A;  1PE6 A;  2YJ9 A;  3WXG A;  3H6S A;  1BGO A;  3CBK A;  1NQC A;  3LXS A;  1Q6K A;  4OEM A;  4KLB A;  2AYO A;  2XU5 A;  4YYU A;  2PBH A;  5CVN B;  3HD3 A;  1U9W A;  1PPD A;  1PIP A;  4YYS A;  4QRV A;  1ME4 A;  3MOR A;  9PAP A;  2IPP B;  2OP3 A;  5J94 A;  3ZUA A;  2FQ9 A;  2DC9 A;  1GLO A;  2ACT A;  1F2C A;  3P5X A;  2G6D A;  1KFU L;  1U5I A;  1CTE A;  1FH0 A;  3PW3 A;  4CDE B;  4OEL A;  4XUI A;  3MHH A;  2G8J A;  2YJ2 A;  1PBH A;  3OVX A;  4BS6 A;  2AUX A;  2AYN A;  1ZCM A;  1PCI A;  3CH2 X;  3I06 A;  2FT2 A;  1NB5 A;  1PPN A;  4YV8 A;  3TNX A;  1KFX L;  1F2A A;  3RVV A;  3IHP A;  1X9Y A;  4W5B A;  4MZO A;  1NB3 A;  1O0E A;  1AYV A;  3PNR A;  4WA6 A;  1DF0 A;  3OF9 A;  2DZY A;  3MTN A;  3KWB X;  3KFQ A;  2F7D A;  2DZZ A;  2E00 A;  1NPZ A;  2HHN A;  3HWN A;  4G54 A;  4MSX A;  4W5C A;  1CS8 A;  2OZ2 A;  1QDQ A;  2H7J A;  1AU0 A;  3BOW A;  3D6S A;  2DCB A;  3OVZ A;  3BWK A;  2R9M A;  3QJ3 A;  1F29 A;  2IBI A;  1THE A;  4YYW A;  2P86 A;  3HHA A;  2NQA A;  2P0R A;  3O0U A;  6PAD A;  2O6X A;  3CH3 X;  4W4U A;  1QOL A;  2HXZ A;  1ITO A;  4AXL A;  3QSD A;  3CBJ A;  1HUC B;  3BC3 A;  2E01 A;  3KSE A;  4QH6 A;  2XU3 A;  2AIM A;  5CHT A;  1GMY A;  4FJC A;  1EWO A;  4QRX A;  8PCH A;  3AI8 A;  2DJG B;  5JH3 A;  1ATK A;  1NL6 A;  2E02 A;  2R9F A;  1M6D A;  4I04 A;  4MZS A;  2HD5 A; 
#chains in the Genus database with same CATH topology
 3OF8 A;  2DC7 A;  1JQP A;  3K9M A;  2FO5 A;  4DMX A;  3V6C A;  3WXE A;  4YYQ A;  2ATO A;  1CSB B;  3TMP A;  3H89 A;  2GHU A;  4QRG A;  4I05 A;  3O1G A;  1EWM A;  2BTW A;  1AYU A;  3BPM A;  3B79 A;  3ERV A;  3KX1 A;  4CDF B;  5CVM A;  4HXD B;  3GCB A;  2VHF A;  2R9O A;  1NLJ A;  1EWL A;  1S4V A;  1AYW A;  3IV2 A;  2R9N A;  4PI3 A;  4FIP A;  3MHS A;  3DF0 A;  1BP4 A;  3LFY A;  4RY2 A;  1BQI A;  4YYR A;  3P5W A;  3BBA A;  2YJB A;  1Y4H A;  1CVZ A;  3MTV A;  1EWP A;  3W30 A;  3MP2 A;  1U9V A;  4BS5 A;  2JQF R;  1U9Q X;  1KHP A;  3H8C A;  3PBH A;  4CDD B;  2G8E A;  4N79 A;  3KWZ A;  3PDF A;  4BOQ A;  1MIR A;  4D8I A;  2Y6E A;  1U9X A;  1KXR A;  2VHS A;  2WBF X;  4QBB A;  5JA7 A;  2PNS A;  2HH5 A;  3IUT A;  1DEU A;  2NQG A;  1TL9 A;  3S3Q A;  4CDC B;  2XU1 A;  4DMY A;  3RVX A;  4Q8G A;  1BY8 A;  1AU2 A;  3E1Z B;  3PSE A;  5CVO B;  1ZIV A;  1SNK A;  3QT4 A;  1AIM A;  1UKF A;  2R9C A;  2E03 A;  2R6N A;  4N8W A;  2C0Y A;  4N4Z A;  3KKU A;  4XZX A;  2B1N A;  2OUL A;  4YYV A;  3PRM A;  1Y08 A;  1AU4 A;  3V6E A;  2NQI A;  3TRK A;  1VSN A;  1YK7 A;  1YT7 A;  3N4C A;  4XR7 A;  4FK5 A;  4WUR A;  2AU1 A;  4PAD A;  1PVJ A;  1QMY A;  3F5V A;  3S3R A;  3PT2 A;  2JQG R;  1CQD A;  2YJ8 A;  4A5U A;  3BPF A;  3F75 A;  3H7D A;  2PAD A;  4RNA A;  3M99 A;  3MJ5 A;  2FTD A;  5F02 A;  1QXP A;  4ZUX U;  1POP A;  2AS8 A;  1PXV A;  1CJL A;  2FYE A;  3E9S A;  3U8E A;  1MEM A;  1TU6 A;  3RVW A;  4R3D A;  4X6J A;  2HWK A;  2P7U A;  2ARY A;  1ICF A;  1VJV A;  2CB5 A;  1STF E;  3KW9 A;  1CV8 A;  4CZW A;  3C9E A;  1AEC A;  2BU3 A;  3IEJ A;  1YZB A;  5CHV A;  2DJF B;  4BSQ A;  1MEG A;  4RF0 A;  4GUA A;  1YK8 A;  1PAD A;  2PRE A;  5E6J A;  2AGA A;  2BDL A;  4X6I A;  3P5V A;  4P6G A;  3IMA A;  1ME3 A;  2B1M A;  3C0R A;  4AXM A;  1IWD A;  2DCC A;  2CIO A;  4PP2 E;  1AU3 A;  1SP4 B;  4PT5 A;  5EGW A;  4YVA A;  7PCK A;  2AUZ A;  1CPJ A;  2FE8 A;  2YJC A;  4IP3 A;  5KO3 A;  1YVB A;  2AVW A;  2G7Y A;  4PP1 A;  1DKI A;  4P6E A;  3PHW A;  2F1G A;  2NQD B;  3NHE A;  4M0W A;  1KHQ A;  1YAL A;  2FRQ A;  1F2B A;  4K7C A;  1MHW A;  4X6H A;  2DC8 A;  1K3B B;  4BOS A;  2DCD A;  1GCB A;  3USV A;  5FPW A;  3O65 A;  1EF7 A;  2BDZ A;  5A24 A;  3ZNH A;  3BY4 A;  5EZS A;  1MDW A;  4BOZ A;  4BPV A;  3BB7 A;  3N3K A;  4REZ A;  2J7Q A;  4OVZ A;  1XKG A;  4D8E A;  1PPO A;  5EF4 A;  2FRA A;  2DC6 A;  2XU4 A;  3P5U A;  1TLO A;  2Z84 A;  3K24 A;  1A6R A;  3H8B A;  3I3T A;  5K16 A;  1PPP A;  3IOQ A;  4I07 A;  3HHI A;  4HWY A;  3BCN A;  4BQV A;  3K8U A;  2DCA A;  2GFO A;  4Q8H A;  2FUD A;  1GEC E;  3N3G A;  4MM3 B;  5PAD A;  1CB5 A;  2Y5B A;  3OIS A;  3WXF A;  1MS6 A;  1PE6 A;  2YJ9 A;  3WXG A;  3H6S A;  1BGO A;  3CBK A;  1NQC A;  4MI7 A;  3LXS A;  1Q6K A;  4OEM A;  4BOU A;  4KLB A;  2DOS A;  2AYO A;  2XU5 A;  4YYU A;  2PBH A;  5CVN B;  3HD3 A;  1U9W A;  1PPD A;  1PIP A;  4YYS A;  4D8B A;  4QRV A;  1ME4 A;  3MOR A;  9PAP A;  2IPP B;  2OP3 A;  5J94 A;  3ZUA A;  4OVZ B;  2FQ9 A;  2DC9 A;  2JTC A;  1GLO A;  2ACT A;  1F2C A;  3P5X A;  2G6D A;  1KFU L;  1U5I A;  1CTE A;  1FH0 A;  3PW3 A;  5EZQ A;  4CDE B;  4OEL A;  4XUI A;  3MHH A;  2G8J A;  3B21 A;  2YJ2 A;  1PBH A;  3OVX A;  4BS6 A;  2AUX A;  2AYN A;  1ZCM A;  1PCI A;  3CH2 X;  3I06 A;  3OQC A;  2FT2 A;  1NB5 A;  1PPN A;  5JZE A;  3RNV A;  4YV8 A;  4P16 A;  3TNX A;  1KFX L;  1F2A A;  3W31 A;  3RVV A;  3IHP A;  4OW0 A;  1X9Y A;  4W5B A;  4MZO A;  4IUM A;  2JRI A;  1NB3 A;  1O0E A;  3PHX A;  1AYV A;  3PNR A;  4WA6 A;  1DF0 A;  3OF9 A;  2DZY A;  3MTN A;  3KWB X;  3KFQ A;  2F7D A;  2DZZ A;  2E00 A;  1NPZ A;  2HHN A;  3HWN A;  4G54 A;  3IFU A;  4MSX A;  4W5C A;  1CS8 A;  2OZ2 A;  1QDQ A;  2J7Q C;  2H7J A;  1AU0 A;  3BOW A;  3D6S A;  2DCB A;  3OVZ A;  3BWK A;  2R9M A;  2BTW B;  3QJ3 A;  1F29 A;  2IBI A;  1THE A;  4RF1 A;  4YYW A;  2P86 A;  3HHA A;  2NQA A;  2P0R A;  3O0U A;  6PAD A;  2O6X A;  3CH3 X;  4W4U A;  1QOL A;  2HXZ A;  1ITO A;  4AXL A;  3QSD A;  3CBJ A;  1HUC B;  3BC3 A;  4ZTB A;  2E01 A;  3KSE A;  4QH6 A;  2XU3 A;  2AIM A;  5CHT A;  1GMY A;  4FJC A;  1EWO A;  2UZJ A;  4QRX A;  4BOP A;  8PCH A;  3AI8 A;  2DJG B;  5JH3 A;  4RKX A;  1ATK A;  1NL6 A;  3PHU A;  2E02 A;  2R9F A;  1M6D A;  4I04 A;  3PRP A;  4MZS A;  2HD5 A; 
#chains in the Genus database with same CATH homology
 3OF8 A;  2DC7 A;  1JQP A;  3K9M A;  2FO5 A;  4DMX A;  3V6C A;  3WXE A;  2VFB A;  4YYQ A;  2ATO A;  1CSB B;  3H89 A;  2GHU A;  4QRG A;  4I05 A;  3O1G A;  1EWM A;  1AYU A;  3BPM A;  3B79 A;  3ERV A;  3KX1 A;  4CDF B;  5CVM A;  3GCB A;  2VHF A;  2R9O A;  1NLJ A;  1EWL A;  1S4V A;  1AYW A;  3IV2 A;  2R9N A;  4PI3 A;  4FIP A;  3MHS A;  3DF0 A;  1W5R A;  1BP4 A;  3LFY A;  4RY2 A;  1BQI A;  4YYR A;  3P5W A;  2YJB A;  1Y4H A;  1CVZ A;  1EWP A;  1U9V A;  4BS5 A;  2JQF R;  1U9Q X;  1KHP A;  3H8C A;  3PBH A;  4CDD B;  2G8E A;  4N79 A;  3KWZ A;  3PDF A;  1MIR A;  2Y6E A;  1U9X A;  1KXR A;  2VHS A;  2WBF X;  4QBB A;  5JA7 A;  2PNS A;  2HH5 A;  3IUT A;  1DEU A;  2NQG A;  1TL9 A;  3S3Q A;  4CDC B;  2XU1 A;  4DMY A;  3RVX A;  4Q8G A;  1BY8 A;  1AU2 A;  3E1Z B;  5CVO B;  1ZIV A;  1SNK A;  3QT4 A;  1AIM A;  2R9C A;  2E03 A;  2R6N A;  4N8W A;  2C0Y A;  4N4Z A;  3KKU A;  2B1N A;  2OUL A;  4YYV A;  1Y08 A;  1AU4 A;  3V6E A;  2NQI A;  1VSN A;  1YK7 A;  1YT7 A;  3N4C A;  4XR7 A;  4FK5 A;  2AU1 A;  4PAD A;  1QMY A;  3F5V A;  3S3R A;  2JQG R;  1CQD A;  2YJ8 A;  3BPF A;  3F75 A;  3H7D A;  2PAD A;  3M99 A;  2FTD A;  5F02 A;  1QXP A;  4ZUX U;  1POP A;  2AS8 A;  1PXV A;  1CJL A;  2FYE A;  3U8E A;  1MEM A;  1TU6 A;  3RVW A;  4X6J A;  2P7U A;  2ARY A;  1ICF A;  1VJV A;  2CB5 A;  1STF E;  3KW9 A;  1CV8 A;  4CZW A;  4NV7 A;  3C9E A;  1AEC A;  3IEJ A;  5CHV A;  2DJF B;  1E2T A;  4BSQ A;  1MEG A;  1YK8 A;  1PAD A;  2PRE A;  2BDL A;  4X6I A;  3P5V A;  4P6G A;  3IMA A;  1ME3 A;  2B1M A;  4AXM A;  1IWD A;  2DCC A;  2CIO A;  4PP2 E;  1AU3 A;  1SP4 B;  5EGW A;  4YVA A;  7PCK A;  2AUZ A;  1CPJ A;  2YJC A;  1YVB A;  2AVW A;  2G7Y A;  4PP1 A;  4P6E A;  2F1G A;  2NQD B;  3NHE A;  1KHQ A;  1YAL A;  2FRQ A;  1F2B A;  4K7C A;  1MHW A;  4X6H A;  2DC8 A;  1K3B B;  3D9W A;  2DCD A;  1GCB A;  3USV A;  4NV8 A;  5FPW A;  1EF7 A;  1W6F A;  2BDZ A;  5A24 A;  1MDW A;  4BPV A;  3N3K A;  1XKG A;  1PPO A;  5EF4 A;  2FRA A;  2DC6 A;  2XU4 A;  4BGF A;  3P5U A;  1TLO A;  3LTW A;  3K24 A;  1A6R A;  3H8B A;  3I3T A;  5K16 A;  1PPP A;  3IOQ A;  4I07 A;  3HHI A;  4HWY A;  3BCN A;  4BQV A;  3K8U A;  2DCA A;  2GFO A;  4Q8H A;  2FUD A;  1GEC E;  3N3G A;  5PAD A;  1CB5 A;  2Y5B A;  3OIS A;  3WXF A;  1MS6 A;  1PE6 A;  2YJ9 A;  3WXG A;  3H6S A;  1BGO A;  3CBK A;  1NQC A;  3LXS A;  1Q6K A;  4OEM A;  4KLB A;  2AYO A;  2XU5 A;  4YYU A;  2PBH A;  5CVN B;  3HD3 A;  1U9W A;  1PPD A;  1PIP A;  4YYS A;  4QRV A;  1ME4 A;  3MOR A;  9PAP A;  2IPP B;  2OP3 A;  5J94 A;  3ZUA A;  2FQ9 A;  2DC9 A;  1GLO A;  2BSZ A;  2ACT A;  1F2C A;  3P5X A;  2G6D A;  1KFU L;  1U5I A;  1CTE A;  1FH0 A;  3PW3 A;  4CDE B;  4OEL A;  4XUI A;  3MHH A;  2G8J A;  2YJ2 A;  1PBH A;  3OVX A;  4BS6 A;  2AUX A;  2AYN A;  1ZCM A;  1PCI A;  3CH2 X;  3I06 A;  2FT2 A;  1NB5 A;  1PPN A;  1GX3 A;  4YV8 A;  3TNX A;  1KFX L;  1F2A A;  3RVV A;  3IHP A;  1X9Y A;  4W5B A;  4MZO A;  1NB3 A;  1O0E A;  1AYV A;  3PNR A;  4WA6 A;  1DF0 A;  3OF9 A;  2DZY A;  3MTN A;  3KWB X;  4B55 A;  3KFQ A;  2F7D A;  2DZZ A;  2E00 A;  1NPZ A;  2HHN A;  3HWN A;  4G54 A;  4MSX A;  4W5C A;  1CS8 A;  2OZ2 A;  1W4T A;  1QDQ A;  2H7J A;  1AU0 A;  3BOW A;  3D6S A;  2DCB A;  3OVZ A;  3BWK A;  2R9M A;  3QJ3 A;  1F29 A;  2IBI A;  1THE A;  4YYW A;  2P86 A;  3HHA A;  2NQA A;  2P0R A;  3O0U A;  6PAD A;  2O6X A;  3CH3 X;  4W4U A;  1QOL A;  2HXZ A;  1ITO A;  4AXL A;  3QSD A;  3CBJ A;  1HUC B;  3BC3 A;  2E01 A;  3KSE A;  4QH6 A;  2XU3 A;  2AIM A;  5CHT A;  1GMY A;  4FJC A;  1EWO A;  2VFC A;  4QRX A;  8PCH A;  3AI8 A;  2DJG B;  5JH3 A;  4C5P A;  1ATK A;  1NL6 A;  2E02 A;  2R9F A;  1M6D A;  4I04 A;  4GUZ A;  4MZS A;  2HD5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...