2G6DA

Human cathepsin s mutant with vinyl sulfone inhibitor cra-14009
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
217
structure length
217
Chain Sequence
LPDSVDWREKGCVTEVKYQGSCGACWAFSAVGALEAQLKLKTGKLVSLSAQNLVDCSTEKYGNKGCNGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYDSKYRAATCRKYTELPYGREDVLKEAVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSWGHNFGEKGYIRMARNKGNHCGIASFPSYPEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Human cathepsin S mutant with vinyl sulfone inhibitor CRA-14009
rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords cathepsin S
total genus 67
structure length 217
sequence length 217
ec nomenclature ec 3.4.22.27: Cathepsin S.
pdb deposition date 2006-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2g6dA00
3V6EA 3MTNA 2NQAA 2DZYA 1QOLA 2Y6EA 1ZCMA 4PADA 4BS5A 4BS6A 2E02A 2DCCA 5CVOB 2DC6A 3I3TA 3V6CA 1CJLA 3OISA 4YYQA 1KFXL 4BPVA 1PIPA 1CS8A 3PNRA 2DC8A 1BY8A 1CV8A 9PAPA 1CSBB 4Q8GA 2CB5A 2BDZA 3CH3X 5CVMA 1Y4HA 1X9YA 1PE6A 2BDLA 1M6DA 1PCIA 2NQDB 1Q6KA 2C0YA 2YJ8A 3WXGA 1DF0A 3CBJA 4MZSA 2G8JA 3OF9A 3BPFA 5JH3A 2AS8A 4AXMA 3K24A 3D6SA 1MDWA 2OULA 3P5UA 1YK7A 3KW9A 1BGOA 2XU4A 5EF4A 3IEJA 1F29A 1PXVA 2B1MA 4YYWA 2R9OA 2DC9A 3WXEA 2R9MA 3AI8A 1MEGA 5K16A 3F75A 3U8EA 5F02A 1F2BA 3H89A 1IWDA 2HHNA 1THEA 4QRGA 1MIRA 1JQPA 2NQIA 3ERVA 4I05A 2P0RA 4OEMA 4I07A 3PW3A 4X6HA 3WXFA 1GMYA 3B79A 4YV8A 2YJCA 2AU1A 1F2CA 2ARYA 1DEUA 4G54A 2CIOA 3BWKA 2F7DA 3OVZA 4XUIA 4BSQA 3GCBA 1BQIA 1POPA 2B1NA 3HHIA 4FK5A 2PBHA 4N4ZA 2E03A 4PP2E 4FIPA 2PNSA 2IBIA 1TL9A 5JA7A 2O6XA 2FO5A 1U9QX 2AUXA 3USVA 4QBBA 1PBHA 1QMYA 4OELA 4I04A 2WBFX 1YK8A 4N79A 1FH0A 2E01A 1GECE 3QSDA 1KHPA 3QT4A 2HH5A 5FPWA 7PCKA 3P5VA 1CB5A 3PBHA 1ICFA 2FUDA 2PREA 2R9CA 1ME4A 2IPPB 3IHPA 4N8WA 1AU0A 8PCHA 3O0UA 4CDFB 3OF8A 4XR7A 3MHHA 2FRQA 4FJCA 2NQGA 1KXRA 3RVXA 1VSNA 2F1GA 2DJFB 2DCDA 4QH6A 1BP4A 2HXZA 2AIMA 1K3BB 3CH2X 5CHTA 1MS6A 3H7DA 3HHAA 3KX1A 1KFUL 1NPZA 2XU3A 3HD3A 1NQCA 2E00A 3KWZA 3H8CA 1NB5A 3H6SA 4YYRA 4KLBA 4HWYA 1YALA 3C9EA 4CDDB 3ZUAA 2H7JA 1YVBA 2G7YA 3KWBX 3CBKA 4ZUXU 4MZOA 1ATKA 3IUTA 1O0EA 2AUZA 3M99A 4W5CA 1NLJA 2OP3A 4RY2A 1AU4A 2PADA 5CHVA 3LFYA 3KSEA 1AIMA 1CTEA 3IMAA 1HUCB 2R6NA 3KKUA 1VJVA 5EGWA 3OVXA 4W4UA 3E1ZB 4YVAA 1PADA 4Q8HA 3MHSA 1SP4B 1EWLA 4DMYA 6PADA 3PDFA 1STFE 3I06A 1NL6A 4YYUA 2P7UA 1PPNA 3BC3A 1PPOA 1EF7A 2P86A 1CPJA 1U9VA 3TNXA 3IOQA 2ACTA 4X6JA 3QJ3A 1EWOA 2GHUA 3LXSA 3RVVA 1QDQA 2AYNA 2GFOA 4PI3A 4DMXA 2HD5A 2VHFA 3NHEA 2AYOA 4CZWA 2R9NA 3N3GA 1CVZA 1AYUA 3O1GA 3BCNA 4YYVA 1NB3A 2XU5A 2YJ9A 1S4VA 1ZIVA 1A6RA 1TLOA 1XKGA 5PADA 3H8BA 2AVWA 4P6GA 5J94A 4BQVA 1QXPA 2YJBA 2G6DA 5A24A 1U9WA 4QRVA 4P6EA 1EWPA 2Y5BA 3K9MA 4WA6A 1PPPA 5CVNB 3N3KA 2ATOA 4PP1A 1AU2A 2DC7A 3HWNA 1MHWA 1GCBA 2G8EA 3S3RA 1SNKA 1MEMA 3RVWA 3P5XA 1PPDA 2DCBA 1ME3A 1AYVA 1CQDA 1TU6A 2DCAA 1Y08A 3P5WA 4K7CA 3DF0A 1GLOA 2JQGR 1AECA 4W5BA 2FRAA 1YT7A 1U9XA 3K8UA 2FT2A 3BPMA 2JQFR 2XU1A 3MORA 3BOWA 3N4CA 3KFQA 4QRXA 4MSXA 2YJ2A 1ITOA 1KHQA 2DZZA 3S3QA 4AXLA 3F5VA 2DJGB 4CDCB 1F2AA 1EWMA 2VHSA 3IV2A 1AYWA 4YYSA 2R9FA 1AU3A 2FQ9A 4CDEB 2FYEA 1U5IA 2FTDA 4X6IA 2OZ2A
chains in the Genus database with same CATH superfamily
4IP3A 3V6EA 2BTWB 3MTNA 5E6JA 4ZTBA 2NQAA 2DZYA 3PSEA 1QOLA 2Y6EA 1ZCMA 4PADA 4BS5A 4BS6A 2E02A 2DCCA 5CVOB 2DC6A 3I3TA 3V6CA 1CJLA 4IUMA 3OISA 4YYQA 1KFXL 4BPVA 1PIPA 4OVZB 3BB7A 1CS8A 3PNRA 4OW0A 2DC8A 1BY8A 2BTWA 1CV8A 9PAPA 1CSBB 4Q8GA 2CB5A 2JRIA 2BDZA 3CH3X 5CVMA 1Y4HA 1X9YA 1PE6A 4BOZA 2BDLA 1M6DA 1PCIA 2NQDB 1Q6KA 2C0YA 2YJ8A 3WXGA 1DF0A 3CBJA 4MZSA 2G8JA 4P16A 3OF9A 3BPFA 4R3DA 5JH3A 2HWKA 2AS8A 4AXMA 3K24A 3D6SA 1MDWA 3MP2A 2OULA 3P5UA 1YK7A 3KW9A 1BGOA 2XU4A 5EF4A 3IEJA 1F29A 1PXVA 2B1MA 4YYWA 2R9OA 2DC9A 2JTCA 3WXEA 4D8BA 2R9MA 3AI8A 1MEGA 5K16A 3F75A 3U8EA 5F02A 1F2BA 3H89A 1IWDA 2HHNA 1THEA 4RNAA 4QRGA 1MIRA 1JQPA 2NQIA 4BOSA 3ERVA 4I05A 2P0RA 4OEMA 4I07A 3PW3A 4X6HA 3WXFA 1GMYA 3B79A 3BBAA 4YV8A 2YJCA 2AU1A 1F2CA 2ARYA 1DEUA 4G54A 2CIOA 3BWKA 2F7DA 3OVZA 4XUIA 4BSQA 3GCBA 1BQIA 1POPA 2B1NA 3B21A 3HHIA 1PVJA 4FK5A 3RNVA 2PBHA 4N4ZA 2E03A 4PP2E 4FIPA 2PNSA 2IBIA 1TL9A 2DOSA 3PHUA 5JA7A 4RKXA 2O6XA 2FO5A 1U9QX 2AUXA 3USVA 4QBBA 1PBHA 1QMYA 4OELA 4I04A 2WBFX 1YK8A 4N79A 4RF1A 1FH0A 3PHWA 2E01A 1GECE 3QSDA 1KHPA 3QT4A 2HH5A 4HXDB 5FPWA 7PCKA 3PRPA 3P5VA 1CB5A 3PBHA 1ICFA 2FUDA 2PREA 2R9CA 1ME4A 2IPPB 4A5UA 2Z84A 3IHPA 4N8WA 1AU0A 8PCHA 3O0UA 4CDFB 1DKIA 3OF8A 4XR7A 3MHHA 4XZXA 2FRQA 4FJCA 2NQGA 3TRKA 1KXRA 3IFUA 3RVXA 1VSNA 2F1GA 2DJFB 4MM3B 2DCDA 4QH6A 1BP4A 5EZSA 5KO3A 2HXZA 2AIMA 1K3BB 3OQCA 3CH2X 1MS6A 5CHTA 3H7DA 3HHAA 3KX1A 4BOUA 1KFUL 1UKFA 1NPZA 3W30A 4RF0A 2XU3A 3HD3A 1NQCA 2E00A 3KWZA 3H8CA 1NB5A 3H6SA 4GUAA 4YYRA 4KLBA 4HWYA 1YALA 3ZNHA 3C9EA 4CDDB 3ZUAA 2H7JA 3TMPA 1YVBA 2G7YA 3KWBX 3CBKA 4ZUXU 4MZOA 1ATKA 3IUTA 1O0EA 2AUZA 3M99A 4W5CA 1NLJA 2OP3A 4RY2A 1AU4A 2PADA 5CHVA 5EZQA 3LFYA 4MI7A 3KSEA 1AIMA 1CTEA 3IMAA 1HUCB 2R6NA 3KKUA 1VJVA 4BOQA 3BY4A 5EGWA 3PRMA 3OVXA 4W4UA 3O65A 3E1ZB 4YVAA 1PADA 4Q8HA 3MHSA 1SP4B 1EWLA 4DMYA 6PADA 3PDFA 1STFE 3I06A 1NL6A 4YYUA 2P7UA 1PPNA 3BC3A 1PPOA 1EF7A 2P86A 1CPJA 1U9VA 3TNXA 3IOQA 2ACTA 4X6JA 3QJ3A 2J7QC 1EWOA 2GHUA 3LXSA 3RVVA 1QDQA 2AYNA 2GFOA 4PI3A 4DMXA 2HD5A 2VHFA 3NHEA 2AYOA 4CZWA 2R9NA 3N3GA 1CVZA 1AYUA 3O1GA 3BCNA 3E9SA 4YYVA 2BU3A 4D8IA 1NB3A 2XU5A 3C0RA 2YJ9A 1S4VA 1ZIVA 1A6RA 1TLOA 1XKGA 5PADA 3H8BA 2AVWA 4P6GA 5J94A 4BQVA 1QXPA 2YJBA 4OVZA 2G6DA 4PT5A 5A24A 3MTVA 1U9WA 4QRVA 4P6EA 1EWPA 2Y5BA 3K9MA 4WA6A 1PPPA 5CVNB 1YZBA 3N3KA 2ATOA 4PP1A 3PHXA 2UZJA 1AU2A 2J7QA 2DC7A 3HWNA 1MHWA 1GCBA 2G8EA 3S3RA 1SNKA 1MEMA 3RVWA 3P5XA 1PPDA 2DCBA 1ME3A 1AYVA 1CQDA 1TU6A 2DCAA 1Y08A 3P5WA 4K7CA 3PT2A 3DF0A 1GLOA 2JQGR 1AECA 4W5BA 2FRAA 4M0WA 1YT7A 1U9XA 2AGAA 3MJ5A 3K8UA 2FT2A 3BPMA 2JQFR 2XU1A 3MORA 3BOWA 3N4CA 4BOPA 4REZA 3KFQA 4QRXA 4MSXA 2YJ2A 1ITOA 1KHQA 2DZZA 3S3QA 4AXLA 3F5VA 2DJGB 4CDCB 1F2AA 3W31A 4D8EA 1EWMA 2FE8A 2VHSA 3IV2A 1AYWA 4YYSA 4WURA 2R9FA 1AU3A 2FQ9A 4CDEB 2FYEA 5JZEA 1U5IA 2FTDA 4X6IA 2OZ2A
chains in the Genus database with same CATH topology
3V6EA 3MTNA 2NQAA 2DZYA 1QOLA 2Y6EA 1ZCMA 4PADA 4BS5A 4BS6A 2E02A 2DCCA 5CVOB 2DC6A 3I3TA 3V6CA 1CJLA 3OISA 4YYQA 1KFXL 4BPVA 1PIPA 1CS8A 3PNRA 2DC8A 1BY8A 1CV8A 9PAPA 1CSBB 4Q8GA 2CB5A 4NV8A 2BDZA 3CH3X 5CVMA 1Y4HA 1X9YA 1PE6A 2BDLA 1M6DA 1PCIA 2NQDB 1Q6KA 2C0YA 2YJ8A 3WXGA 1DF0A 3CBJA 4MZSA 2G8JA 3OF9A 3BPFA 5JH3A 2AS8A 4AXMA 3K24A 3D6SA 1MDWA 2OULA 3P5UA 1YK7A 3KW9A 1BGOA 2XU4A 5EF4A 3IEJA 1F29A 1PXVA 2B1MA 4YYWA 2R9OA 2DC9A 3WXEA 2R9MA 3AI8A 1MEGA 5K16A 3F75A 3U8EA 5F02A 1F2BA 3H89A 1IWDA 2HHNA 1THEA 4QRGA 1MIRA 1JQPA 2NQIA 3ERVA 4I05A 2P0RA 4OEMA 4I07A 3PW3A 4X6HA 3WXFA 1GMYA 2VFBA 3B79A 4B55A 4YV8A 2YJCA 2AU1A 1F2CA 2ARYA 1DEUA 4G54A 2CIOA 3BWKA 2F7DA 3OVZA 4XUIA 4BSQA 3GCBA 1BQIA 1POPA 2B1NA 3HHIA 4FK5A 2PBHA 4N4ZA 2E03A 4PP2E 4FIPA 2PNSA 2IBIA 1TL9A 5JA7A 2O6XA 2FO5A 1U9QX 2AUXA 3USVA 4QBBA 1PBHA 1QMYA 4OELA 4I04A 2WBFX 1YK8A 4N79A 1FH0A 2E01A 1GECE 3QSDA 1KHPA 3QT4A 2HH5A 5FPWA 7PCKA 3P5VA 1CB5A 3PBHA 1ICFA 2FUDA 2PREA 2R9CA 1ME4A 2IPPB 3IHPA 4N8WA 1AU0A 4C5PA 8PCHA 3O0UA 4CDFB 3OF8A 4XR7A 3MHHA 2FRQA 4FJCA 2NQGA 1KXRA 3RVXA 1VSNA 2F1GA 2DJFB 2DCDA 4QH6A 1BP4A 2HXZA 2AIMA 3D9WA 1K3BB 3CH2X 5CHTA 1MS6A 3H7DA 3HHAA 3KX1A 1KFUL 1NPZA 2XU3A 3HD3A 1NQCA 2E00A 3KWZA 3H8CA 1NB5A 3H6SA 4YYRA 4KLBA 4HWYA 1YALA 3C9EA 4CDDB 3ZUAA 2H7JA 1YVBA 2G7YA 3KWBX 3CBKA 4ZUXU 4MZOA 1ATKA 3IUTA 1O0EA 2AUZA 3M99A 4W5CA 1NLJA 2OP3A 4RY2A 1AU4A 2PADA 5CHVA 3LFYA 3KSEA 1AIMA 1CTEA 3IMAA 1HUCB 2R6NA 1W5RA 3KKUA 1VJVA 5EGWA 1W4TA 3OVXA 4W4UA 3E1ZB 4YVAA 1PADA 4Q8HA 3MHSA 1SP4B 1EWLA 4DMYA 6PADA 3PDFA 1STFE 3I06A 1NL6A 4YYUA 2P7UA 1PPNA 3BC3A 1PPOA 1EF7A 2P86A 1CPJA 1U9VA 3TNXA 3IOQA 2ACTA 4X6JA 4BGFA 1GX3A 3QJ3A 1EWOA 2GHUA 3LXSA 3RVVA 1QDQA 2AYNA 2GFOA 4PI3A 2VFCA 4DMXA 3LTWA 1W6FA 2HD5A 2VHFA 3NHEA 2AYOA 4CZWA 2R9NA 3N3GA 1CVZA 1AYUA 3O1GA 3BCNA 4YYVA 1NB3A 2XU5A 4NV7A 2YJ9A 1S4VA 1ZIVA 1A6RA 1TLOA 1XKGA 5PADA 3H8BA 2AVWA 4P6GA 5J94A 4BQVA 1QXPA 2YJBA 2G6DA 5A24A 1U9WA 4QRVA 4P6EA 1EWPA 2Y5BA 3K9MA 4GUZA 1E2TA 1PPPA 4WA6A 5CVNB 3N3KA 2ATOA 4PP1A 1AU2A 2DC7A 3HWNA 1MHWA 1GCBA 2G8EA 3S3RA 1SNKA 1MEMA 2BSZA 3RVWA 3P5XA 1PPDA 2DCBA 1ME3A 1AYVA 1CQDA 1TU6A 2DCAA 1Y08A 3P5WA 4K7CA 3DF0A 1GLOA 2JQGR 1AECA 4W5BA 2FRAA 1YT7A 1U9XA 3K8UA 2FT2A 3BPMA 2JQFR 2XU1A 3MORA 3BOWA 3N4CA 3KFQA 4QRXA 4MSXA 2YJ2A 1ITOA 1KHQA 2DZZA 3S3QA 4AXLA 3F5VA 2DJGB 4CDCB 1F2AA 1EWMA 2VHSA 3IV2A 1AYWA 4YYSA 2R9FA 1AU3A 2FQ9A 4CDEB 2FYEA 1U5IA 2FTDA 4X6IA 2OZ2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V6E A;  3MTN A;  2NQA A;  2DZY A;  1QOL A;  2Y6E A;  1ZCM A;  4PAD A;  4BS5 A;  4BS6 A;  2E02 A;  2DCC A;  5CVO B;  2DC6 A;  3I3T A;  3V6C A;  1CJL A;  3OIS A;  4YYQ A;  1KFX L;  4BPV A;  1PIP A;  1CS8 A;  3PNR A;  2DC8 A;  1BY8 A;  1CV8 A;  9PAP A;  1CSB B;  4Q8G A;  2CB5 A;  2BDZ A;  3CH3 X;  5CVM A;  1Y4H A;  1X9Y A;  1PE6 A;  2BDL A;  1M6D A;  1PCI A;  2NQD B;  1Q6K A;  2C0Y A;  2YJ8 A;  3WXG A;  1DF0 A;  3CBJ A;  4MZS A;  2G8J A;  3OF9 A;  3BPF A;  5JH3 A;  2AS8 A;  4AXM A;  3K24 A;  3D6S A;  1MDW A;  2OUL A;  3P5U A;  1YK7 A;  3KW9 A;  1BGO A;  2XU4 A;  5EF4 A;  3IEJ A;  1F29 A;  1PXV A;  2B1M A;  4YYW A;  2R9O A;  2DC9 A;  3WXE A;  2R9M A;  3AI8 A;  1MEG A;  5K16 A;  3F75 A;  3U8E A;  5F02 A;  1F2B A;  3H89 A;  1IWD A;  2HHN A;  1THE A;  4QRG A;  1MIR A;  1JQP A;  2NQI A;  3ERV A;  4I05 A;  2P0R A;  4OEM A;  4I07 A;  3PW3 A;  4X6H A;  3WXF A;  1GMY A;  3B79 A;  4YV8 A;  2YJC A;  2AU1 A;  1F2C A;  2ARY A;  1DEU A;  4G54 A;  2CIO A;  3BWK A;  2F7D A;  3OVZ A;  4XUI A;  4BSQ A;  3GCB A;  1BQI A;  1POP A;  2B1N A;  3HHI A;  4FK5 A;  2PBH A;  4N4Z A;  2E03 A;  4PP2 E;  4FIP A;  2PNS A;  2IBI A;  1TL9 A;  5JA7 A;  2O6X A;  2FO5 A;  1U9Q X;  2AUX A;  3USV A;  4QBB A;  1PBH A;  1QMY A;  4OEL A;  4I04 A;  2WBF X;  1YK8 A;  4N79 A;  1FH0 A;  2E01 A;  1GEC E;  3QSD A;  1KHP A;  3QT4 A;  2HH5 A;  5FPW A;  7PCK A;  3P5V A;  1CB5 A;  3PBH A;  1ICF A;  2FUD A;  2PRE A;  2R9C A;  1ME4 A;  2IPP B;  3IHP A;  4N8W A;  1AU0 A;  8PCH A;  3O0U A;  4CDF B;  3OF8 A;  4XR7 A;  3MHH A;  2FRQ A;  4FJC A;  2NQG A;  1KXR A;  3RVX A;  1VSN A;  2F1G A;  2DJF B;  2DCD A;  4QH6 A;  1BP4 A;  2HXZ A;  2AIM A;  1K3B B;  3CH2 X;  5CHT A;  1MS6 A;  3H7D A;  3HHA A;  3KX1 A;  1KFU L;  1NPZ A;  2XU3 A;  3HD3 A;  1NQC A;  2E00 A;  3KWZ A;  3H8C A;  1NB5 A;  3H6S A;  4YYR A;  4KLB A;  4HWY A;  1YAL A;  3C9E A;  4CDD B;  3ZUA A;  2H7J A;  1YVB A;  2G7Y A;  3KWB X;  3CBK A;  4ZUX U;  4MZO A;  1ATK A;  3IUT A;  1O0E A;  2AUZ A;  3M99 A;  4W5C A;  1NLJ A;  2OP3 A;  4RY2 A;  1AU4 A;  2PAD A;  5CHV A;  3LFY A;  3KSE A;  1AIM A;  1CTE A;  3IMA A;  1HUC B;  2R6N A;  3KKU A;  1VJV A;  5EGW A;  3OVX A;  4W4U A;  3E1Z B;  4YVA A;  1PAD A;  4Q8H A;  3MHS A;  1SP4 B;  1EWL A;  4DMY A;  6PAD A;  3PDF A;  1STF E;  3I06 A;  1NL6 A;  4YYU A;  2P7U A;  1PPN A;  3BC3 A;  1PPO A;  1EF7 A;  2P86 A;  1CPJ A;  1U9V A;  3TNX A;  3IOQ A;  2ACT A;  4X6J A;  3QJ3 A;  1EWO A;  2GHU A;  3LXS A;  3RVV A;  1QDQ A;  2AYN A;  2GFO A;  4PI3 A;  4DMX A;  2HD5 A;  2VHF A;  3NHE A;  2AYO A;  4CZW A;  2R9N A;  3N3G A;  1CVZ A;  1AYU A;  3O1G A;  3BCN A;  4YYV A;  1NB3 A;  2XU5 A;  2YJ9 A;  1S4V A;  1ZIV A;  1A6R A;  1TLO A;  1XKG A;  5PAD A;  3H8B A;  2AVW A;  4P6G A;  5J94 A;  4BQV A;  1QXP A;  2YJB A;  2G6D A;  5A24 A;  1U9W A;  4QRV A;  4P6E A;  1EWP A;  2Y5B A;  3K9M A;  4WA6 A;  1PPP A;  5CVN B;  3N3K A;  2ATO A;  4PP1 A;  1AU2 A;  2DC7 A;  3HWN A;  1MHW A;  1GCB A;  2G8E A;  3S3R A;  1SNK A;  1MEM A;  3RVW A;  3P5X A;  1PPD A;  2DCB A;  1ME3 A;  1AYV A;  1CQD A;  1TU6 A;  2DCA A;  1Y08 A;  3P5W A;  4K7C A;  3DF0 A;  1GLO A;  2JQG R;  1AEC A;  4W5B A;  2FRA A;  1YT7 A;  1U9X A;  3K8U A;  2FT2 A;  3BPM A;  2JQF R;  2XU1 A;  3MOR A;  3BOW A;  3N4C A;  3KFQ A;  4QRX A;  4MSX A;  2YJ2 A;  1ITO A;  1KHQ A;  2DZZ A;  3S3Q A;  4AXL A;  3F5V A;  2DJG B;  4CDC B;  1F2A A;  1EWM A;  2VHS A;  3IV2 A;  1AYW A;  4YYS A;  2R9F A;  1AU3 A;  2FQ9 A;  4CDE B;  2FYE A;  1U5I A;  2FTD A;  4X6I A;  2OZ2 A; 
#chains in the Genus database with same CATH topology
 4IP3 A;  3V6E A;  2BTW B;  3MTN A;  5E6J A;  4ZTB A;  2NQA A;  2DZY A;  3PSE A;  1QOL A;  2Y6E A;  1ZCM A;  4PAD A;  4BS5 A;  4BS6 A;  2E02 A;  2DCC A;  5CVO B;  2DC6 A;  3I3T A;  3V6C A;  1CJL A;  4IUM A;  3OIS A;  4YYQ A;  1KFX L;  4BPV A;  1PIP A;  4OVZ B;  3BB7 A;  1CS8 A;  3PNR A;  4OW0 A;  2DC8 A;  1BY8 A;  2BTW A;  1CV8 A;  9PAP A;  1CSB B;  4Q8G A;  2CB5 A;  2JRI A;  2BDZ A;  3CH3 X;  5CVM A;  1Y4H A;  1X9Y A;  1PE6 A;  4BOZ A;  2BDL A;  1M6D A;  1PCI A;  2NQD B;  1Q6K A;  2C0Y A;  2YJ8 A;  3WXG A;  1DF0 A;  3CBJ A;  4MZS A;  2G8J A;  4P16 A;  3OF9 A;  3BPF A;  4R3D A;  5JH3 A;  2HWK A;  2AS8 A;  4AXM A;  3K24 A;  3D6S A;  1MDW A;  3MP2 A;  2OUL A;  3P5U A;  1YK7 A;  3KW9 A;  1BGO A;  2XU4 A;  5EF4 A;  3IEJ A;  1F29 A;  1PXV A;  2B1M A;  4YYW A;  2R9O A;  2DC9 A;  2JTC A;  3WXE A;  4D8B A;  2R9M A;  3AI8 A;  1MEG A;  5K16 A;  3F75 A;  3U8E A;  5F02 A;  1F2B A;  3H89 A;  1IWD A;  2HHN A;  1THE A;  4RNA A;  4QRG A;  1MIR A;  1JQP A;  2NQI A;  4BOS A;  3ERV A;  4I05 A;  2P0R A;  4OEM A;  4I07 A;  3PW3 A;  4X6H A;  3WXF A;  1GMY A;  3B79 A;  3BBA A;  4YV8 A;  2YJC A;  2AU1 A;  1F2C A;  2ARY A;  1DEU A;  4G54 A;  2CIO A;  3BWK A;  2F7D A;  3OVZ A;  4XUI A;  4BSQ A;  3GCB A;  1BQI A;  1POP A;  2B1N A;  3B21 A;  3HHI A;  1PVJ A;  4FK5 A;  3RNV A;  2PBH A;  4N4Z A;  2E03 A;  4PP2 E;  4FIP A;  2PNS A;  2IBI A;  1TL9 A;  2DOS A;  3PHU A;  5JA7 A;  4RKX A;  2O6X A;  2FO5 A;  1U9Q X;  2AUX A;  3USV A;  4QBB A;  1PBH A;  1QMY A;  4OEL A;  4I04 A;  2WBF X;  1YK8 A;  4N79 A;  4RF1 A;  1FH0 A;  3PHW A;  2E01 A;  1GEC E;  3QSD A;  1KHP A;  3QT4 A;  2HH5 A;  4HXD B;  5FPW A;  7PCK A;  3PRP A;  3P5V A;  1CB5 A;  3PBH A;  1ICF A;  2FUD A;  2PRE A;  2R9C A;  1ME4 A;  2IPP B;  4A5U A;  2Z84 A;  3IHP A;  4N8W A;  1AU0 A;  8PCH A;  3O0U A;  4CDF B;  1DKI A;  3OF8 A;  4XR7 A;  3MHH A;  4XZX A;  2FRQ A;  4FJC A;  2NQG A;  3TRK A;  1KXR A;  3IFU A;  3RVX A;  1VSN A;  2F1G A;  2DJF B;  4MM3 B;  2DCD A;  4QH6 A;  1BP4 A;  5EZS A;  5KO3 A;  2HXZ A;  2AIM A;  1K3B B;  3OQC A;  3CH2 X;  1MS6 A;  5CHT A;  3H7D A;  3HHA A;  3KX1 A;  4BOU A;  1KFU L;  1UKF A;  1NPZ A;  3W30 A;  4RF0 A;  2XU3 A;  3HD3 A;  1NQC A;  2E00 A;  3KWZ A;  3H8C A;  1NB5 A;  3H6S A;  4GUA A;  4YYR A;  4KLB A;  4HWY A;  1YAL A;  3ZNH A;  3C9E A;  4CDD B;  3ZUA A;  2H7J A;  3TMP A;  1YVB A;  2G7Y A;  3KWB X;  3CBK A;  4ZUX U;  4MZO A;  1ATK A;  3IUT A;  1O0E A;  2AUZ A;  3M99 A;  4W5C A;  1NLJ A;  2OP3 A;  4RY2 A;  1AU4 A;  2PAD A;  5CHV A;  5EZQ A;  3LFY A;  4MI7 A;  3KSE A;  1AIM A;  1CTE A;  3IMA A;  1HUC B;  2R6N A;  3KKU A;  1VJV A;  4BOQ A;  3BY4 A;  5EGW A;  3PRM A;  3OVX A;  4W4U A;  3O65 A;  3E1Z B;  4YVA A;  1PAD A;  4Q8H A;  3MHS A;  1SP4 B;  1EWL A;  4DMY A;  6PAD A;  3PDF A;  1STF E;  3I06 A;  1NL6 A;  4YYU A;  2P7U A;  1PPN A;  3BC3 A;  1PPO A;  1EF7 A;  2P86 A;  1CPJ A;  1U9V A;  3TNX A;  3IOQ A;  2ACT A;  4X6J A;  3QJ3 A;  2J7Q C;  1EWO A;  2GHU A;  3LXS A;  3RVV A;  1QDQ A;  2AYN A;  2GFO A;  4PI3 A;  4DMX A;  2HD5 A;  2VHF A;  3NHE A;  2AYO A;  4CZW A;  2R9N A;  3N3G A;  1CVZ A;  1AYU A;  3O1G A;  3BCN A;  3E9S A;  4YYV A;  2BU3 A;  4D8I A;  1NB3 A;  2XU5 A;  3C0R A;  2YJ9 A;  1S4V A;  1ZIV A;  1A6R A;  1TLO A;  1XKG A;  5PAD A;  3H8B A;  2AVW A;  4P6G A;  5J94 A;  4BQV A;  1QXP A;  2YJB A;  4OVZ A;  2G6D A;  4PT5 A;  5A24 A;  3MTV A;  1U9W A;  4QRV A;  4P6E A;  1EWP A;  2Y5B A;  3K9M A;  4WA6 A;  1PPP A;  5CVN B;  1YZB A;  3N3K A;  2ATO A;  4PP1 A;  3PHX A;  2UZJ A;  1AU2 A;  2J7Q A;  2DC7 A;  3HWN A;  1MHW A;  1GCB A;  2G8E A;  3S3R A;  1SNK A;  1MEM A;  3RVW A;  3P5X A;  1PPD A;  2DCB A;  1ME3 A;  1AYV A;  1CQD A;  1TU6 A;  2DCA A;  1Y08 A;  3P5W A;  4K7C A;  3PT2 A;  3DF0 A;  1GLO A;  2JQG R;  1AEC A;  4W5B A;  2FRA A;  4M0W A;  1YT7 A;  1U9X A;  2AGA A;  3MJ5 A;  3K8U A;  2FT2 A;  3BPM A;  2JQF R;  2XU1 A;  3MOR A;  3BOW A;  3N4C A;  4BOP A;  4REZ A;  3KFQ A;  4QRX A;  4MSX A;  2YJ2 A;  1ITO A;  1KHQ A;  2DZZ A;  3S3Q A;  4AXL A;  3F5V A;  2DJG B;  4CDC B;  1F2A A;  3W31 A;  4D8E A;  1EWM A;  2FE8 A;  2VHS A;  3IV2 A;  1AYW A;  4YYS A;  4WUR A;  2R9F A;  1AU3 A;  2FQ9 A;  4CDE B;  2FYE A;  5JZE A;  1U5I A;  2FTD A;  4X6I A;  2OZ2 A; 
#chains in the Genus database with same CATH homology
 3V6E A;  3MTN A;  2NQA A;  2DZY A;  1QOL A;  2Y6E A;  1ZCM A;  4PAD A;  4BS5 A;  4BS6 A;  2E02 A;  2DCC A;  5CVO B;  2DC6 A;  3I3T A;  3V6C A;  1CJL A;  3OIS A;  4YYQ A;  1KFX L;  4BPV A;  1PIP A;  1CS8 A;  3PNR A;  2DC8 A;  1BY8 A;  1CV8 A;  9PAP A;  1CSB B;  4Q8G A;  2CB5 A;  4NV8 A;  2BDZ A;  3CH3 X;  5CVM A;  1Y4H A;  1X9Y A;  1PE6 A;  2BDL A;  1M6D A;  1PCI A;  2NQD B;  1Q6K A;  2C0Y A;  2YJ8 A;  3WXG A;  1DF0 A;  3CBJ A;  4MZS A;  2G8J A;  3OF9 A;  3BPF A;  5JH3 A;  2AS8 A;  4AXM A;  3K24 A;  3D6S A;  1MDW A;  2OUL A;  3P5U A;  1YK7 A;  3KW9 A;  1BGO A;  2XU4 A;  5EF4 A;  3IEJ A;  1F29 A;  1PXV A;  2B1M A;  4YYW A;  2R9O A;  2DC9 A;  3WXE A;  2R9M A;  3AI8 A;  1MEG A;  5K16 A;  3F75 A;  3U8E A;  5F02 A;  1F2B A;  3H89 A;  1IWD A;  2HHN A;  1THE A;  4QRG A;  1MIR A;  1JQP A;  2NQI A;  3ERV A;  4I05 A;  2P0R A;  4OEM A;  4I07 A;  3PW3 A;  4X6H A;  3WXF A;  1GMY A;  2VFB A;  3B79 A;  4B55 A;  4YV8 A;  2YJC A;  2AU1 A;  1F2C A;  2ARY A;  1DEU A;  4G54 A;  2CIO A;  3BWK A;  2F7D A;  3OVZ A;  4XUI A;  4BSQ A;  3GCB A;  1BQI A;  1POP A;  2B1N A;  3HHI A;  4FK5 A;  2PBH A;  4N4Z A;  2E03 A;  4PP2 E;  4FIP A;  2PNS A;  2IBI A;  1TL9 A;  5JA7 A;  2O6X A;  2FO5 A;  1U9Q X;  2AUX A;  3USV A;  4QBB A;  1PBH A;  1QMY A;  4OEL A;  4I04 A;  2WBF X;  1YK8 A;  4N79 A;  1FH0 A;  2E01 A;  1GEC E;  3QSD A;  1KHP A;  3QT4 A;  2HH5 A;  5FPW A;  7PCK A;  3P5V A;  1CB5 A;  3PBH A;  1ICF A;  2FUD A;  2PRE A;  2R9C A;  1ME4 A;  2IPP B;  3IHP A;  4N8W A;  1AU0 A;  4C5P A;  8PCH A;  3O0U A;  4CDF B;  3OF8 A;  4XR7 A;  3MHH A;  2FRQ A;  4FJC A;  2NQG A;  1KXR A;  3RVX A;  1VSN A;  2F1G A;  2DJF B;  2DCD A;  4QH6 A;  1BP4 A;  2HXZ A;  2AIM A;  3D9W A;  1K3B B;  3CH2 X;  5CHT A;  1MS6 A;  3H7D A;  3HHA A;  3KX1 A;  1KFU L;  1NPZ A;  2XU3 A;  3HD3 A;  1NQC A;  2E00 A;  3KWZ A;  3H8C A;  1NB5 A;  3H6S A;  4YYR A;  4KLB A;  4HWY A;  1YAL A;  3C9E A;  4CDD B;  3ZUA A;  2H7J A;  1YVB A;  2G7Y A;  3KWB X;  3CBK A;  4ZUX U;  4MZO A;  1ATK A;  3IUT A;  1O0E A;  2AUZ A;  3M99 A;  4W5C A;  1NLJ A;  2OP3 A;  4RY2 A;  1AU4 A;  2PAD A;  5CHV A;  3LFY A;  3KSE A;  1AIM A;  1CTE A;  3IMA A;  1HUC B;  2R6N A;  1W5R A;  3KKU A;  1VJV A;  5EGW A;  1W4T A;  3OVX A;  4W4U A;  3E1Z B;  4YVA A;  1PAD A;  4Q8H A;  3MHS A;  1SP4 B;  1EWL A;  4DMY A;  6PAD A;  3PDF A;  1STF E;  3I06 A;  1NL6 A;  4YYU A;  2P7U A;  1PPN A;  3BC3 A;  1PPO A;  1EF7 A;  2P86 A;  1CPJ A;  1U9V A;  3TNX A;  3IOQ A;  2ACT A;  4X6J A;  4BGF A;  1GX3 A;  3QJ3 A;  1EWO A;  2GHU A;  3LXS A;  3RVV A;  1QDQ A;  2AYN A;  2GFO A;  4PI3 A;  2VFC A;  4DMX A;  3LTW A;  1W6F A;  2HD5 A;  2VHF A;  3NHE A;  2AYO A;  4CZW A;  2R9N A;  3N3G A;  1CVZ A;  1AYU A;  3O1G A;  3BCN A;  4YYV A;  1NB3 A;  2XU5 A;  4NV7 A;  2YJ9 A;  1S4V A;  1ZIV A;  1A6R A;  1TLO A;  1XKG A;  5PAD A;  3H8B A;  2AVW A;  4P6G A;  5J94 A;  4BQV A;  1QXP A;  2YJB A;  2G6D A;  5A24 A;  1U9W A;  4QRV A;  4P6E A;  1EWP A;  2Y5B A;  3K9M A;  4GUZ A;  1E2T A;  1PPP A;  4WA6 A;  5CVN B;  3N3K A;  2ATO A;  4PP1 A;  1AU2 A;  2DC7 A;  3HWN A;  1MHW A;  1GCB A;  2G8E A;  3S3R A;  1SNK A;  1MEM A;  2BSZ A;  3RVW A;  3P5X A;  1PPD A;  2DCB A;  1ME3 A;  1AYV A;  1CQD A;  1TU6 A;  2DCA A;  1Y08 A;  3P5W A;  4K7C A;  3DF0 A;  1GLO A;  2JQG R;  1AEC A;  4W5B A;  2FRA A;  1YT7 A;  1U9X A;  3K8U A;  2FT2 A;  3BPM A;  2JQF R;  2XU1 A;  3MOR A;  3BOW A;  3N4C A;  3KFQ A;  4QRX A;  4MSX A;  2YJ2 A;  1ITO A;  1KHQ A;  2DZZ A;  3S3Q A;  4AXL A;  3F5V A;  2DJG B;  4CDC B;  1F2A A;  1EWM A;  2VHS A;  3IV2 A;  1AYW A;  4YYS A;  2R9F A;  1AU3 A;  2FQ9 A;  4CDE B;  2FYE A;  1U5I A;  2FTD A;  4X6I A;  2OZ2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...