2G6DA

Human cathepsin s mutant with vinyl sulfone inhibitor cra-14009
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
217
structure length
217
Chain Sequence
LPDSVDWREKGCVTEVKYQGSCGACWAFSAVGALEAQLKLKTGKLVSLSAQNLVDCSTEKYGNKGCNGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYDSKYRAATCRKYTELPYGREDVLKEAVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSWGHNFGEKGYIRMARNKGNHCGIASFPSYPEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Human cathepsin S mutant with vinyl sulfone inhibitor CRA-14009
rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords cathepsin S
total genus 67
structure length 217
sequence length 217
ec nomenclature ec 3.4.22.27: Cathepsin S.
pdb deposition date 2006-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2g6dA00
3QSDA 2DC7A 1GCBA 3OVXA 3N3KA 1AECA 1Y4HA 1KXRA 4YYVA 9PAPA 1EWLA 1TLOA 2DCAA 1AYUA 2FRQA 4FJCA 2PNSA 6PADA 1AU4A 1ME4A 1DEUA 4CDFB 1QDQA 1CPJA 4DMYA 4HWYA 3RVXA 3WXFA 1KFXL 3KWBX 3NHEA 2YJ8A 3IHPA 4N4ZA 2BDZA 3ZUAA 1PPDA 3BCNA 3OF8A 1YK8A 1MHWA 4W4UA 8PCHA 3IEJA 2R9MA 4I04A 4N79A 1MEMA 5CHTA 4PP1A 1PADA 1IWDA 3I06A 2E02A 5CVNB 3IV2A 3RVWA 1GLOA 1CV8A 1EWMA 1XKGA 2DJGB 1CSBB 2G8EA 2VHFA 3S3QA 3P5WA 3P5UA 2FRAA 1A6RA 1F2BA 2AVWA 3RVVA 2G7YA 3MHSA 3P5XA 1NLJA 1DF0A 2WBFX 3PNRA 1NB5A 4QRXA 1PPPA 4X6IA 2IPPB 2YJBA 2HD5A 2PREA 4YYRA 4BPVA 1CB5A 2F7DA 1BQIA 3K24A 1U5IA 5JH3A 3AI8A 3U8EA 3D6SA 4P6GA 4YYUA 4QRVA 1YK7A 3K9MA 2CIOA 4BS6A 2OZ2A 1MIRA 3K8UA 3C9EA 1O0EA 2OP3A 2R9FA 1CVZA 1BY8A 1AU0A 2JQGR 4AXLA 3P5VA 2JQFR 1K3BB 2ARYA 2Y6EA 1QMYA 2F1GA 3MHHA 1ATKA 1GMYA 1NPZA 1FH0A 2AU1A 3BC3A 2H7JA 1ME3A 4FK5A 5CHVA 4KLBA 1U9WA 3BPMA 1BGOA 4N8WA 2CB5A 2DC8A 2R9CA 2P7UA 2BDLA 2DZZA 2B1MA 4I05A 1STFE 1F2CA 1U9VA 4DMXA 3BWKA 2DCDA 2DCCA 3LXSA 1POPA 3CH3X 4P6EA 4QRGA 1KHPA 1ICFA 1KFUL 3N3GA 1EWOA 1PXVA 2R9NA 1TU6A 3F5VA 3HHIA 4OEMA 4X6HA 1NB3A 3DF0A 3IOQA 1F2AA 1ZCMA 3H8BA 1PE6A 1BP4A 2HH5A 1AU3A 4MZOA 4MSXA 2OULA 1MS6A 4YYQA 1MDWA 4CDDB 2HHNA 1AYVA 1PPNA 2AYNA 2FYEA 1ZIVA 5F02A 1ITOA 1KHQA 2HXZA 2ACTA 1PBHA 1S4VA 3WXEA 4QH6A 3USVA 1CJLA 3HWNA 3E1ZB 3MTNA 1PIPA 2YJCA 1SNKA 3IMAA 1U9QX 1AIMA 2ATOA 3IUTA 3ERVA 3I3TA 3TNXA 5JA7A 2E00A 1EWPA 2FT2A 2E03A 2DC9A 3H6SA 3N4CA 1EF7A 1M6DA 1HUCB 4YYSA 4PI3A 3CBKA 4WA6A 2FQ9A 3OISA 2G8JA 4QBBA 3HD3A 1AYWA 3PDFA 3HHAA 3H8CA 2XU1A 4YVAA 4OELA 3PW3A 4BS5A 2R6NA 1U9XA 2Y5BA 5FPWA 4BQVA 4W5CA 3PBHA 3KX1A 2FTDA 1Y08A 1QOLA 1TL9A 4PP2E 3CBJA 5CVOB 3GCBA 4PADA 5EF4A 3S3RA 3O1GA 3QT4A 4G54A 3M99A 3H89A 2XU3A 2R9OA 2AUXA 2E01A 2PADA 1PCIA 4K7CA 3O0UA 2FO5A 1CTEA 3WXGA 5K16A 1NL6A 2NQDB 5J94A 2NQAA 2NQIA 3BOWA 3OF9A 3KW9A 1YALA 1GECE 3B79A 4CDEB 1CQDA 2DCBA 1JQPA 4XUIA 5EGWA 1VJVA 3V6EA 2GFOA 2P0RA 3LFYA 2P86A 4CDCB 1F29A 2G6DA 3BPFA 4YV8A 1Q6KA 1SP4B 2FUDA 2VHSA 2YJ9A 3F75A 3V6CA 4FIPA 3H7DA 2O6XA 4Q8GA 2B1NA 2DJFB 4MZSA 2AS8A 2C0YA 2AYOA 2YJ2A 2AUZA 4Q8HA 3QJ3A 5PADA 5CVMA 1PPOA 2DC6A 2IBIA 1YVBA 1THEA 4BSQA 3KWZA 3KKUA 2AIMA 7PCKA 2DZYA 4X6JA 1MEGA 3MORA 4I07A 4CZWA 4AXMA 1VSNA 2PBHA 3KSEA 4YYWA 4W5BA 5A24A 1NQCA 2GHUA 3CH2X 2XU5A 4XR7A 1YT7A 3OVZA 1CS8A 3KFQA 1AU2A 1QXPA 4ZUXU 2XU4A 1X9YA 4RY2A 2NQGA
chains in the Genus database with same CATH superfamily
3W30A 3QSDA 2DC7A 1GCBA 3OVXA 3N3KA 1AECA 1Y4HA 1KXRA 4YYVA 9PAPA 3IFUA 1EWLA 1TLOA 3W31A 2DCAA 4BOZA 1AYUA 2FRQA 4FJCA 2PNSA 6PADA 3MTVA 4D8BA 1AU4A 1ME4A 1DEUA 1YZBA 4CDFB 2Z84A 1QDQA 1CPJA 4DMYA 4HWYA 3RVXA 3WXFA 1KFXL 3KWBX 3NHEA 2YJ8A 3IHPA 4N4ZA 2BDZA 3ZUAA 1PPDA 3BCNA 3OF8A 1YK8A 1MHWA 4W4UA 8PCHA 3MJ5A 2BTWA 4MI7A 3IEJA 2R9MA 4I04A 4N79A 1MEMA 5CHTA 4PP1A 1PADA 1IWDA 4HXDB 3I06A 2E02A 5CVNB 3IV2A 3RVWA 1GLOA 3MP2A 1CV8A 1EWMA 1XKGA 2DJGB 1CSBB 2G8EA 2JRIA 2VHFA 3S3QA 3P5WA 1UKFA 3P5UA 2FRAA 1A6RA 3PHUA 5JZEA 1F2BA 2AVWA 5EZQA 3RVVA 2G7YA 3MHSA 2FE8A 3P5XA 1NLJA 1DF0A 2WBFX 3PNRA 1NB5A 2HWKA 4QRXA 1PPPA 4X6IA 2IPPB 2YJBA 2HD5A 3BY4A 3B21A 2PREA 4YYRA 4BPVA 1CB5A 2F7DA 1BQIA 3K24A 4BOQA 1U5IA 5JH3A 3AI8A 3U8EA 3D6SA 4BOUA 4P6GA 4YYUA 4QRVA 1YK7A 3K9MA 2CIOA 4BS6A 1PVJA 4RF0A 2OZ2A 1MIRA 3K8UA 3C9EA 1O0EA 2OP3A 2R9FA 3TMPA 1CVZA 1BY8A 1AU0A 2JQGR 4AXLA 3P5VA 2JQFR 1K3BB 5KO3A 4XZXA 2ARYA 2Y6EA 1QMYA 2F1GA 3MHHA 1ATKA 4RF1A 4IUMA 1GMYA 1NPZA 1FH0A 2AU1A 3BC3A 2H7JA 1ME3A 4FK5A 2JTCA 5CHVA 4KLBA 3PRPA 1U9WA 2UZJA 3BPMA 1BGOA 4N8WA 2CB5A 2DC8A 2R9CA 2P7UA 2BDLA 2DZZA 4M0WA 2B1MA 4I05A 1STFE 1F2CA 1U9VA 4DMXA 3BWKA 2DCDA 2DCCA 3LXSA 1POPA 5E6JA 4OW0A 3CH3X 4P6EA 4QRGA 1KHPA 1ICFA 1KFUL 3N3GA 1EWOA 1PXVA 2R9NA 1TU6A 3F5VA 3HHIA 4OEMA 4X6HA 4RNAA 1NB3A 3DF0A 3IOQA 3PT2A 1F2AA 1ZCMA 3H8BA 1PE6A 1BP4A 2HH5A 1AU3A 4MZOA 4MSXA 2OULA 3PHXA 1MS6A 4YYQA 1MDWA 4CDDB 2HHNA 1AYVA 1PPNA 2AYNA 2FYEA 1ZIVA 5F02A 1ITOA 1KHQA 2HXZA 2ACTA 1PBHA 1S4VA 3WXEA 4QH6A 3USVA 1CJLA 3HWNA 3E1ZB 3MTNA 1PIPA 2YJCA 1SNKA 4WURA 3IMAA 1U9QX 1AIMA 2ATOA 3IUTA 3ERVA 3I3TA 3TNXA 4PT5A 3BBAA 5JA7A 2E00A 1EWPA 2FT2A 2E03A 2DC9A 3H6SA 3N4CA 1EF7A 1M6DA 1HUCB 4P16A 4YYSA 4PI3A 3CBKA 3RNVA 4WA6A 2FQ9A 3OISA 2G8JA 4QBBA 3HD3A 1AYWA 3PDFA 3HHAA 3H8CA 2XU1A 3PHWA 4YVAA 4OELA 3PW3A 4BS5A 2R6NA 1U9XA 2Y5BA 5FPWA 4BQVA 4W5CA 3PBHA 4D8EA 3KX1A 2FTDA 1Y08A 4A5UA 1QOLA 1TL9A 4PP2E 3CBJA 4BOPA 5CVOB 3GCBA 4PADA 5EF4A 2DOSA 3S3RA 3O1GA 3QT4A 4G54A 3M99A 3H89A 2XU3A 2R9OA 2AUXA 2E01A 2PADA 1PCIA 4K7CA 3O0UA 2J7QA 2FO5A 1CTEA 3E9SA 3WXGA 4OVZA 5K16A 2BU3A 1NL6A 2NQDB 5J94A 2NQAA 2NQIA 3BOWA 3OF9A 3KW9A 1YALA 1GECE 3B79A 4CDEB 1CQDA 2DCBA 3BB7A 1JQPA 4XUIA 5EGWA 1VJVA 3C0RA 4IP3A 3V6EA 4GUAA 2GFOA 2P0RA 3LFYA 2P86A 3O65A 1F29A 4CDCB 2G6DA 3BPFA 4YV8A 1Q6KA 1SP4B 2FUDA 2VHSA 2YJ9A 3F75A 3PRMA 4FIPA 3V6CA 3H7DA 2O6XA 4Q8GA 2B1NA 4RKXA 2DJFB 4MZSA 4D8IA 2AS8A 2C0YA 2AYOA 4OVZB 2AGAA 2YJ2A 2AUZA 4Q8HA 3QJ3A 5PADA 5CVMA 1PPOA 2J7QC 2DC6A 2IBIA 1YVBA 1THEA 4ZTBA 4BSQA 3KWZA 3KKUA 4REZA 4BOSA 2AIMA 7PCKA 3ZNHA 2DZYA 4X6JA 4R3DA 1MEGA 1DKIA 3MORA 4I07A 4CZWA 4AXMA 1VSNA 3OQCA 2PBHA 5EZSA 3PSEA 3KSEA 4YYWA 4W5BA 5A24A 1NQCA 2GHUA 3CH2X 2XU5A 4XR7A 1YT7A 3OVZA 1CS8A 4MM3B 2BTWB 3KFQA 1AU2A 1QXPA 3TRKA 4ZUXU 2XU4A 1X9YA 4RY2A 2NQGA
chains in the Genus database with same CATH topology
3QSDA 2DC7A 1GCBA 2BSZA 3OVXA 3N3KA 1AECA 1Y4HA 1KXRA 4YYVA 9PAPA 1W5RA 1EWLA 1TLOA 2DCAA 1AYUA 2FRQA 4FJCA 2PNSA 6PADA 1AU4A 1ME4A 1DEUA 4CDFB 1QDQA 1CPJA 4DMYA 4HWYA 3RVXA 3WXFA 1KFXL 1E2TA 3KWBX 3NHEA 2YJ8A 3IHPA 4N4ZA 2BDZA 3ZUAA 1PPDA 3BCNA 3OF8A 1YK8A 1MHWA 4W4UA 8PCHA 3IEJA 2R9MA 4I04A 4N79A 1MEMA 5CHTA 4PP1A 1PADA 1IWDA 3I06A 2E02A 5CVNB 3IV2A 3RVWA 1GLOA 1CV8A 1EWMA 1XKGA 2DJGB 1CSBB 2G8EA 2VHFA 3S3QA 1W4TA 3P5WA 3P5UA 2FRAA 1A6RA 1F2BA 2AVWA 3RVVA 2G7YA 3MHSA 3P5XA 1NLJA 1DF0A 2WBFX 3PNRA 1NB5A 4QRXA 1PPPA 4X6IA 2IPPB 2YJBA 2HD5A 2PREA 4YYRA 3LTWA 4BPVA 1CB5A 2F7DA 1BQIA 3K24A 1U5IA 5JH3A 3AI8A 3U8EA 3D6SA 4P6GA 4YYUA 4QRVA 1YK7A 3K9MA 2CIOA 4BS6A 2OZ2A 1MIRA 3K8UA 3C9EA 1O0EA 2OP3A 2R9FA 1CVZA 1BY8A 1AU0A 2JQGR 4AXLA 3P5VA 2JQFR 1K3BB 4B55A 2ARYA 2Y6EA 1QMYA 2F1GA 3MHHA 1ATKA 1GMYA 1NPZA 1FH0A 2AU1A 3BC3A 2H7JA 1ME3A 4FK5A 5CHVA 3D9WA 4KLBA 1U9WA 3BPMA 1BGOA 4N8WA 2CB5A 2DC8A 2R9CA 2P7UA 2BDLA 2DZZA 2B1MA 1W6FA 4I05A 1STFE 1F2CA 1U9VA 4DMXA 3BWKA 2DCDA 2DCCA 3LXSA 4GUZA 1POPA 2VFCA 3CH3X 4P6EA 4QRGA 1KHPA 1ICFA 1KFUL 3N3GA 1EWOA 1PXVA 2R9NA 1TU6A 3F5VA 3HHIA 1GX3A 4OEMA 4X6HA 1NB3A 3DF0A 3IOQA 4C5PA 1F2AA 1ZCMA 3H8BA 1PE6A 1BP4A 2HH5A 1AU3A 4MZOA 4MSXA 2OULA 1MS6A 4YYQA 1MDWA 4CDDB 2HHNA 1AYVA 1PPNA 2AYNA 2FYEA 1ZIVA 5F02A 1ITOA 1KHQA 2HXZA 2ACTA 1PBHA 1S4VA 3WXEA 4QH6A 3USVA 1CJLA 3HWNA 3E1ZB 3MTNA 1PIPA 2YJCA 1SNKA 3IMAA 1U9QX 1AIMA 2ATOA 3IUTA 3ERVA 3I3TA 3TNXA 4NV8A 5JA7A 2E00A 1EWPA 2FT2A 2E03A 2DC9A 3H6SA 3N4CA 1EF7A 1M6DA 1HUCB 4YYSA 4PI3A 3CBKA 4WA6A 2FQ9A 3OISA 2G8JA 4QBBA 3HD3A 1AYWA 2VFBA 3PDFA 3HHAA 3H8CA 2XU1A 4YVAA 4OELA 3PW3A 4BS5A 2R6NA 1U9XA 2Y5BA 5FPWA 4BQVA 4W5CA 3PBHA 3KX1A 2FTDA 1Y08A 1QOLA 1TL9A 4PP2E 3CBJA 5CVOB 3GCBA 4PADA 5EF4A 3S3RA 3O1GA 3QT4A 4G54A 3M99A 3H89A 2XU3A 2R9OA 2AUXA 2E01A 2PADA 1PCIA 4K7CA 3O0UA 2FO5A 1CTEA 3WXGA 5K16A 1NL6A 2NQDB 5J94A 2NQAA 2NQIA 3BOWA 3OF9A 3KW9A 1YALA 1GECE 3B79A 4CDEB 1CQDA 2DCBA 1JQPA 4XUIA 5EGWA 1VJVA 3V6EA 2GFOA 2P0RA 3LFYA 2P86A 4CDCB 1F29A 2G6DA 3BPFA 4YV8A 1Q6KA 1SP4B 2FUDA 2VHSA 2YJ9A 3F75A 3V6CA 4FIPA 3H7DA 4BGFA 2O6XA 4Q8GA 2B1NA 2DJFB 4MZSA 2AS8A 2C0YA 2AYOA 2YJ2A 2AUZA 4Q8HA 3QJ3A 5PADA 5CVMA 1PPOA 2DC6A 2IBIA 1YVBA 1THEA 4BSQA 3KWZA 3KKUA 2AIMA 7PCKA 2DZYA 4X6JA 1MEGA 4NV7A 3MORA 4I07A 4CZWA 4AXMA 1VSNA 2PBHA 3KSEA 4YYWA 4W5BA 5A24A 1NQCA 2GHUA 3CH2X 2XU5A 4XR7A 1YT7A 3OVZA 1CS8A 3KFQA 1AU2A 1QXPA 4ZUXU 2XU4A 1X9YA 4RY2A 2NQGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QSD A;  2DC7 A;  1GCB A;  3OVX A;  3N3K A;  1AEC A;  1Y4H A;  1KXR A;  4YYV A;  9PAP A;  1EWL A;  1TLO A;  2DCA A;  1AYU A;  2FRQ A;  4FJC A;  2PNS A;  6PAD A;  1AU4 A;  1ME4 A;  1DEU A;  4CDF B;  1QDQ A;  1CPJ A;  4DMY A;  4HWY A;  3RVX A;  3WXF A;  1KFX L;  3KWB X;  3NHE A;  2YJ8 A;  3IHP A;  4N4Z A;  2BDZ A;  3ZUA A;  1PPD A;  3BCN A;  3OF8 A;  1YK8 A;  1MHW A;  4W4U A;  8PCH A;  3IEJ A;  2R9M A;  4I04 A;  4N79 A;  1MEM A;  5CHT A;  4PP1 A;  1PAD A;  1IWD A;  3I06 A;  2E02 A;  5CVN B;  3IV2 A;  3RVW A;  1GLO A;  1CV8 A;  1EWM A;  1XKG A;  2DJG B;  1CSB B;  2G8E A;  2VHF A;  3S3Q A;  3P5W A;  3P5U A;  2FRA A;  1A6R A;  1F2B A;  2AVW A;  3RVV A;  2G7Y A;  3MHS A;  3P5X A;  1NLJ A;  1DF0 A;  2WBF X;  3PNR A;  1NB5 A;  4QRX A;  1PPP A;  4X6I A;  2IPP B;  2YJB A;  2HD5 A;  2PRE A;  4YYR A;  4BPV A;  1CB5 A;  2F7D A;  1BQI A;  3K24 A;  1U5I A;  5JH3 A;  3AI8 A;  3U8E A;  3D6S A;  4P6G A;  4YYU A;  4QRV A;  1YK7 A;  3K9M A;  2CIO A;  4BS6 A;  2OZ2 A;  1MIR A;  3K8U A;  3C9E A;  1O0E A;  2OP3 A;  2R9F A;  1CVZ A;  1BY8 A;  1AU0 A;  2JQG R;  4AXL A;  3P5V A;  2JQF R;  1K3B B;  2ARY A;  2Y6E A;  1QMY A;  2F1G A;  3MHH A;  1ATK A;  1GMY A;  1NPZ A;  1FH0 A;  2AU1 A;  3BC3 A;  2H7J A;  1ME3 A;  4FK5 A;  5CHV A;  4KLB A;  1U9W A;  3BPM A;  1BGO A;  4N8W A;  2CB5 A;  2DC8 A;  2R9C A;  2P7U A;  2BDL A;  2DZZ A;  2B1M A;  4I05 A;  1STF E;  1F2C A;  1U9V A;  4DMX A;  3BWK A;  2DCD A;  2DCC A;  3LXS A;  1POP A;  3CH3 X;  4P6E A;  4QRG A;  1KHP A;  1ICF A;  1KFU L;  3N3G A;  1EWO A;  1PXV A;  2R9N A;  1TU6 A;  3F5V A;  3HHI A;  4OEM A;  4X6H A;  1NB3 A;  3DF0 A;  3IOQ A;  1F2A A;  1ZCM A;  3H8B A;  1PE6 A;  1BP4 A;  2HH5 A;  1AU3 A;  4MZO A;  4MSX A;  2OUL A;  1MS6 A;  4YYQ A;  1MDW A;  4CDD B;  2HHN A;  1AYV A;  1PPN A;  2AYN A;  2FYE A;  1ZIV A;  5F02 A;  1ITO A;  1KHQ A;  2HXZ A;  2ACT A;  1PBH A;  1S4V A;  3WXE A;  4QH6 A;  3USV A;  1CJL A;  3HWN A;  3E1Z B;  3MTN A;  1PIP A;  2YJC A;  1SNK A;  3IMA A;  1U9Q X;  1AIM A;  2ATO A;  3IUT A;  3ERV A;  3I3T A;  3TNX A;  5JA7 A;  2E00 A;  1EWP A;  2FT2 A;  2E03 A;  2DC9 A;  3H6S A;  3N4C A;  1EF7 A;  1M6D A;  1HUC B;  4YYS A;  4PI3 A;  3CBK A;  4WA6 A;  2FQ9 A;  3OIS A;  2G8J A;  4QBB A;  3HD3 A;  1AYW A;  3PDF A;  3HHA A;  3H8C A;  2XU1 A;  4YVA A;  4OEL A;  3PW3 A;  4BS5 A;  2R6N A;  1U9X A;  2Y5B A;  5FPW A;  4BQV A;  4W5C A;  3PBH A;  3KX1 A;  2FTD A;  1Y08 A;  1QOL A;  1TL9 A;  4PP2 E;  3CBJ A;  5CVO B;  3GCB A;  4PAD A;  5EF4 A;  3S3R A;  3O1G A;  3QT4 A;  4G54 A;  3M99 A;  3H89 A;  2XU3 A;  2R9O A;  2AUX A;  2E01 A;  2PAD A;  1PCI A;  4K7C A;  3O0U A;  2FO5 A;  1CTE A;  3WXG A;  5K16 A;  1NL6 A;  2NQD B;  5J94 A;  2NQA A;  2NQI A;  3BOW A;  3OF9 A;  3KW9 A;  1YAL A;  1GEC E;  3B79 A;  4CDE B;  1CQD A;  2DCB A;  1JQP A;  4XUI A;  5EGW A;  1VJV A;  3V6E A;  2GFO A;  2P0R A;  3LFY A;  2P86 A;  4CDC B;  1F29 A;  2G6D A;  3BPF A;  4YV8 A;  1Q6K A;  1SP4 B;  2FUD A;  2VHS A;  2YJ9 A;  3F75 A;  3V6C A;  4FIP A;  3H7D A;  2O6X A;  4Q8G A;  2B1N A;  2DJF B;  4MZS A;  2AS8 A;  2C0Y A;  2AYO A;  2YJ2 A;  2AUZ A;  4Q8H A;  3QJ3 A;  5PAD A;  5CVM A;  1PPO A;  2DC6 A;  2IBI A;  1YVB A;  1THE A;  4BSQ A;  3KWZ A;  3KKU A;  2AIM A;  7PCK A;  2DZY A;  4X6J A;  1MEG A;  3MOR A;  4I07 A;  4CZW A;  4AXM A;  1VSN A;  2PBH A;  3KSE A;  4YYW A;  4W5B A;  5A24 A;  1NQC A;  2GHU A;  3CH2 X;  2XU5 A;  4XR7 A;  1YT7 A;  3OVZ A;  1CS8 A;  3KFQ A;  1AU2 A;  1QXP A;  4ZUX U;  2XU4 A;  1X9Y A;  4RY2 A;  2NQG A; 
#chains in the Genus database with same CATH topology
 3W30 A;  3QSD A;  2DC7 A;  1GCB A;  3OVX A;  3N3K A;  1AEC A;  1Y4H A;  1KXR A;  4YYV A;  9PAP A;  3IFU A;  1EWL A;  1TLO A;  3W31 A;  2DCA A;  4BOZ A;  1AYU A;  2FRQ A;  4FJC A;  2PNS A;  6PAD A;  3MTV A;  4D8B A;  1AU4 A;  1ME4 A;  1DEU A;  1YZB A;  4CDF B;  2Z84 A;  1QDQ A;  1CPJ A;  4DMY A;  4HWY A;  3RVX A;  3WXF A;  1KFX L;  3KWB X;  3NHE A;  2YJ8 A;  3IHP A;  4N4Z A;  2BDZ A;  3ZUA A;  1PPD A;  3BCN A;  3OF8 A;  1YK8 A;  1MHW A;  4W4U A;  8PCH A;  3MJ5 A;  2BTW A;  4MI7 A;  3IEJ A;  2R9M A;  4I04 A;  4N79 A;  1MEM A;  5CHT A;  4PP1 A;  1PAD A;  1IWD A;  4HXD B;  3I06 A;  2E02 A;  5CVN B;  3IV2 A;  3RVW A;  1GLO A;  3MP2 A;  1CV8 A;  1EWM A;  1XKG A;  2DJG B;  1CSB B;  2G8E A;  2JRI A;  2VHF A;  3S3Q A;  3P5W A;  1UKF A;  3P5U A;  2FRA A;  1A6R A;  3PHU A;  5JZE A;  1F2B A;  2AVW A;  5EZQ A;  3RVV A;  2G7Y A;  3MHS A;  2FE8 A;  3P5X A;  1NLJ A;  1DF0 A;  2WBF X;  3PNR A;  1NB5 A;  2HWK A;  4QRX A;  1PPP A;  4X6I A;  2IPP B;  2YJB A;  2HD5 A;  3BY4 A;  3B21 A;  2PRE A;  4YYR A;  4BPV A;  1CB5 A;  2F7D A;  1BQI A;  3K24 A;  4BOQ A;  1U5I A;  5JH3 A;  3AI8 A;  3U8E A;  3D6S A;  4BOU A;  4P6G A;  4YYU A;  4QRV A;  1YK7 A;  3K9M A;  2CIO A;  4BS6 A;  1PVJ A;  4RF0 A;  2OZ2 A;  1MIR A;  3K8U A;  3C9E A;  1O0E A;  2OP3 A;  2R9F A;  3TMP A;  1CVZ A;  1BY8 A;  1AU0 A;  2JQG R;  4AXL A;  3P5V A;  2JQF R;  1K3B B;  5KO3 A;  4XZX A;  2ARY A;  2Y6E A;  1QMY A;  2F1G A;  3MHH A;  1ATK A;  4RF1 A;  4IUM A;  1GMY A;  1NPZ A;  1FH0 A;  2AU1 A;  3BC3 A;  2H7J A;  1ME3 A;  4FK5 A;  2JTC A;  5CHV A;  4KLB A;  3PRP A;  1U9W A;  2UZJ A;  3BPM A;  1BGO A;  4N8W A;  2CB5 A;  2DC8 A;  2R9C A;  2P7U A;  2BDL A;  2DZZ A;  4M0W A;  2B1M A;  4I05 A;  1STF E;  1F2C A;  1U9V A;  4DMX A;  3BWK A;  2DCD A;  2DCC A;  3LXS A;  1POP A;  5E6J A;  4OW0 A;  3CH3 X;  4P6E A;  4QRG A;  1KHP A;  1ICF A;  1KFU L;  3N3G A;  1EWO A;  1PXV A;  2R9N A;  1TU6 A;  3F5V A;  3HHI A;  4OEM A;  4X6H A;  4RNA A;  1NB3 A;  3DF0 A;  3IOQ A;  3PT2 A;  1F2A A;  1ZCM A;  3H8B A;  1PE6 A;  1BP4 A;  2HH5 A;  1AU3 A;  4MZO A;  4MSX A;  2OUL A;  3PHX A;  1MS6 A;  4YYQ A;  1MDW A;  4CDD B;  2HHN A;  1AYV A;  1PPN A;  2AYN A;  2FYE A;  1ZIV A;  5F02 A;  1ITO A;  1KHQ A;  2HXZ A;  2ACT A;  1PBH A;  1S4V A;  3WXE A;  4QH6 A;  3USV A;  1CJL A;  3HWN A;  3E1Z B;  3MTN A;  1PIP A;  2YJC A;  1SNK A;  4WUR A;  3IMA A;  1U9Q X;  1AIM A;  2ATO A;  3IUT A;  3ERV A;  3I3T A;  3TNX A;  4PT5 A;  3BBA A;  5JA7 A;  2E00 A;  1EWP A;  2FT2 A;  2E03 A;  2DC9 A;  3H6S A;  3N4C A;  1EF7 A;  1M6D A;  1HUC B;  4P16 A;  4YYS A;  4PI3 A;  3CBK A;  3RNV A;  4WA6 A;  2FQ9 A;  3OIS A;  2G8J A;  4QBB A;  3HD3 A;  1AYW A;  3PDF A;  3HHA A;  3H8C A;  2XU1 A;  3PHW A;  4YVA A;  4OEL A;  3PW3 A;  4BS5 A;  2R6N A;  1U9X A;  2Y5B A;  5FPW A;  4BQV A;  4W5C A;  3PBH A;  4D8E A;  3KX1 A;  2FTD A;  1Y08 A;  4A5U A;  1QOL A;  1TL9 A;  4PP2 E;  3CBJ A;  4BOP A;  5CVO B;  3GCB A;  4PAD A;  5EF4 A;  2DOS A;  3S3R A;  3O1G A;  3QT4 A;  4G54 A;  3M99 A;  3H89 A;  2XU3 A;  2R9O A;  2AUX A;  2E01 A;  2PAD A;  1PCI A;  4K7C A;  3O0U A;  2J7Q A;  2FO5 A;  1CTE A;  3E9S A;  3WXG A;  4OVZ A;  5K16 A;  2BU3 A;  1NL6 A;  2NQD B;  5J94 A;  2NQA A;  2NQI A;  3BOW A;  3OF9 A;  3KW9 A;  1YAL A;  1GEC E;  3B79 A;  4CDE B;  1CQD A;  2DCB A;  3BB7 A;  1JQP A;  4XUI A;  5EGW A;  1VJV A;  3C0R A;  4IP3 A;  3V6E A;  4GUA A;  2GFO A;  2P0R A;  3LFY A;  2P86 A;  3O65 A;  1F29 A;  4CDC B;  2G6D A;  3BPF A;  4YV8 A;  1Q6K A;  1SP4 B;  2FUD A;  2VHS A;  2YJ9 A;  3F75 A;  3PRM A;  4FIP A;  3V6C A;  3H7D A;  2O6X A;  4Q8G A;  2B1N A;  4RKX A;  2DJF B;  4MZS A;  4D8I A;  2AS8 A;  2C0Y A;  2AYO A;  4OVZ B;  2AGA A;  2YJ2 A;  2AUZ A;  4Q8H A;  3QJ3 A;  5PAD A;  5CVM A;  1PPO A;  2J7Q C;  2DC6 A;  2IBI A;  1YVB A;  1THE A;  4ZTB A;  4BSQ A;  3KWZ A;  3KKU A;  4REZ A;  4BOS A;  2AIM A;  7PCK A;  3ZNH A;  2DZY A;  4X6J A;  4R3D A;  1MEG A;  1DKI A;  3MOR A;  4I07 A;  4CZW A;  4AXM A;  1VSN A;  3OQC A;  2PBH A;  5EZS A;  3PSE A;  3KSE A;  4YYW A;  4W5B A;  5A24 A;  1NQC A;  2GHU A;  3CH2 X;  2XU5 A;  4XR7 A;  1YT7 A;  3OVZ A;  1CS8 A;  4MM3 B;  2BTW B;  3KFQ A;  1AU2 A;  1QXP A;  3TRK A;  4ZUX U;  2XU4 A;  1X9Y A;  4RY2 A;  2NQG A; 
#chains in the Genus database with same CATH homology
 3QSD A;  2DC7 A;  1GCB A;  2BSZ A;  3OVX A;  3N3K A;  1AEC A;  1Y4H A;  1KXR A;  4YYV A;  9PAP A;  1W5R A;  1EWL A;  1TLO A;  2DCA A;  1AYU A;  2FRQ A;  4FJC A;  2PNS A;  6PAD A;  1AU4 A;  1ME4 A;  1DEU A;  4CDF B;  1QDQ A;  1CPJ A;  4DMY A;  4HWY A;  3RVX A;  3WXF A;  1KFX L;  1E2T A;  3KWB X;  3NHE A;  2YJ8 A;  3IHP A;  4N4Z A;  2BDZ A;  3ZUA A;  1PPD A;  3BCN A;  3OF8 A;  1YK8 A;  1MHW A;  4W4U A;  8PCH A;  3IEJ A;  2R9M A;  4I04 A;  4N79 A;  1MEM A;  5CHT A;  4PP1 A;  1PAD A;  1IWD A;  3I06 A;  2E02 A;  5CVN B;  3IV2 A;  3RVW A;  1GLO A;  1CV8 A;  1EWM A;  1XKG A;  2DJG B;  1CSB B;  2G8E A;  2VHF A;  3S3Q A;  1W4T A;  3P5W A;  3P5U A;  2FRA A;  1A6R A;  1F2B A;  2AVW A;  3RVV A;  2G7Y A;  3MHS A;  3P5X A;  1NLJ A;  1DF0 A;  2WBF X;  3PNR A;  1NB5 A;  4QRX A;  1PPP A;  4X6I A;  2IPP B;  2YJB A;  2HD5 A;  2PRE A;  4YYR A;  3LTW A;  4BPV A;  1CB5 A;  2F7D A;  1BQI A;  3K24 A;  1U5I A;  5JH3 A;  3AI8 A;  3U8E A;  3D6S A;  4P6G A;  4YYU A;  4QRV A;  1YK7 A;  3K9M A;  2CIO A;  4BS6 A;  2OZ2 A;  1MIR A;  3K8U A;  3C9E A;  1O0E A;  2OP3 A;  2R9F A;  1CVZ A;  1BY8 A;  1AU0 A;  2JQG R;  4AXL A;  3P5V A;  2JQF R;  1K3B B;  4B55 A;  2ARY A;  2Y6E A;  1QMY A;  2F1G A;  3MHH A;  1ATK A;  1GMY A;  1NPZ A;  1FH0 A;  2AU1 A;  3BC3 A;  2H7J A;  1ME3 A;  4FK5 A;  5CHV A;  3D9W A;  4KLB A;  1U9W A;  3BPM A;  1BGO A;  4N8W A;  2CB5 A;  2DC8 A;  2R9C A;  2P7U A;  2BDL A;  2DZZ A;  2B1M A;  1W6F A;  4I05 A;  1STF E;  1F2C A;  1U9V A;  4DMX A;  3BWK A;  2DCD A;  2DCC A;  3LXS A;  4GUZ A;  1POP A;  2VFC A;  3CH3 X;  4P6E A;  4QRG A;  1KHP A;  1ICF A;  1KFU L;  3N3G A;  1EWO A;  1PXV A;  2R9N A;  1TU6 A;  3F5V A;  3HHI A;  1GX3 A;  4OEM A;  4X6H A;  1NB3 A;  3DF0 A;  3IOQ A;  4C5P A;  1F2A A;  1ZCM A;  3H8B A;  1PE6 A;  1BP4 A;  2HH5 A;  1AU3 A;  4MZO A;  4MSX A;  2OUL A;  1MS6 A;  4YYQ A;  1MDW A;  4CDD B;  2HHN A;  1AYV A;  1PPN A;  2AYN A;  2FYE A;  1ZIV A;  5F02 A;  1ITO A;  1KHQ A;  2HXZ A;  2ACT A;  1PBH A;  1S4V A;  3WXE A;  4QH6 A;  3USV A;  1CJL A;  3HWN A;  3E1Z B;  3MTN A;  1PIP A;  2YJC A;  1SNK A;  3IMA A;  1U9Q X;  1AIM A;  2ATO A;  3IUT A;  3ERV A;  3I3T A;  3TNX A;  4NV8 A;  5JA7 A;  2E00 A;  1EWP A;  2FT2 A;  2E03 A;  2DC9 A;  3H6S A;  3N4C A;  1EF7 A;  1M6D A;  1HUC B;  4YYS A;  4PI3 A;  3CBK A;  4WA6 A;  2FQ9 A;  3OIS A;  2G8J A;  4QBB A;  3HD3 A;  1AYW A;  2VFB A;  3PDF A;  3HHA A;  3H8C A;  2XU1 A;  4YVA A;  4OEL A;  3PW3 A;  4BS5 A;  2R6N A;  1U9X A;  2Y5B A;  5FPW A;  4BQV A;  4W5C A;  3PBH A;  3KX1 A;  2FTD A;  1Y08 A;  1QOL A;  1TL9 A;  4PP2 E;  3CBJ A;  5CVO B;  3GCB A;  4PAD A;  5EF4 A;  3S3R A;  3O1G A;  3QT4 A;  4G54 A;  3M99 A;  3H89 A;  2XU3 A;  2R9O A;  2AUX A;  2E01 A;  2PAD A;  1PCI A;  4K7C A;  3O0U A;  2FO5 A;  1CTE A;  3WXG A;  5K16 A;  1NL6 A;  2NQD B;  5J94 A;  2NQA A;  2NQI A;  3BOW A;  3OF9 A;  3KW9 A;  1YAL A;  1GEC E;  3B79 A;  4CDE B;  1CQD A;  2DCB A;  1JQP A;  4XUI A;  5EGW A;  1VJV A;  3V6E A;  2GFO A;  2P0R A;  3LFY A;  2P86 A;  4CDC B;  1F29 A;  2G6D A;  3BPF A;  4YV8 A;  1Q6K A;  1SP4 B;  2FUD A;  2VHS A;  2YJ9 A;  3F75 A;  3V6C A;  4FIP A;  3H7D A;  4BGF A;  2O6X A;  4Q8G A;  2B1N A;  2DJF B;  4MZS A;  2AS8 A;  2C0Y A;  2AYO A;  2YJ2 A;  2AUZ A;  4Q8H A;  3QJ3 A;  5PAD A;  5CVM A;  1PPO A;  2DC6 A;  2IBI A;  1YVB A;  1THE A;  4BSQ A;  3KWZ A;  3KKU A;  2AIM A;  7PCK A;  2DZY A;  4X6J A;  1MEG A;  4NV7 A;  3MOR A;  4I07 A;  4CZW A;  4AXM A;  1VSN A;  2PBH A;  3KSE A;  4YYW A;  4W5B A;  5A24 A;  1NQC A;  2GHU A;  3CH2 X;  2XU5 A;  4XR7 A;  1YT7 A;  3OVZ A;  1CS8 A;  3KFQ A;  1AU2 A;  1QXP A;  4ZUX U;  2XU4 A;  1X9Y A;  4RY2 A;  2NQG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...