2G7YA

Human cathepsin s with inhibitor cra-16981
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
217
structure length
217
Chain Sequence
LPDSVDWREKGCVTEVKYQGSCGACWAFSAVGALEAQLKLKTGKLVSLSAQNLVDCSTEKYGNKGCNGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYDSKYRAATCSKYTELPYGREDVLKEAVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSWGHNFGEEGYIRMARNKGNHCGIASFPSYPEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Human Cathepsin S with inhibitor CRA-16981
rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Cathepsin S
total genus 52
structure length 217
sequence length 217
chains with identical sequence B
ec nomenclature ec 3.4.22.27: Cathepsin S.
pdb deposition date 2006-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2g7yA00
4YYVA 1PIPA 1AYWA 2R9OA 3O0UA 1CJLA 2FT2A 1X9YA 2YJCA 2WBFX 3BC3A 1TLOA 1QMYA 3I06A 2PNSA 3MHHA 1KHPA 3P5UA 2OULA 4WA6A 2DJFB 4G54A 2VHFA 1JQPA 3BOWA 3KX1A 3S3QA 1GMYA 3BPFA 5F02A 2JQFR 4N79A 1MDWA 1EWMA 1Y4HA 3O1GA 2DZYA 3F75A 2G6DA 2AUZA 5JH3A 1GLOA 3CBKA 1NL6A 4AXLA 3KKUA 3IV2A 1ME4A 1M6DA 1XKGA 4I04A 2R9MA 3N3GA 2E03A 3WXEA 1AU0A 4X6HA 1AU3A 1CSBB 3KW9A 8PCHA 1PPPA 3IEJA 3BPMA 1U9WA 4N8WA 1ICFA 4PI3A 1ZIVA 4XR7A 3OVZA 3K24A 1PPOA 4PADA 2B1MA 2ATOA 2GFOA 3WXGA 2Y5BA 1S4VA 1PCIA 1AECA 2OZ2A 2DCCA 3CBJA 3F5VA 3CH2X 2AYOA 2G8JA 3MHSA 2AUXA 2O6XA 3MORA 9PAPA 1BY8A 2FRAA 5CHVA 2FO5A 4X6JA 5PADA 2ACTA 2XU4A 4CZWA 2XU5A 4QBBA 4CDDB 1AYUA 2NQGA 1YT7A 3P5XA 2CB5A 3V6CA 1PXVA 2DC6A 2H7JA 3D6SA 1DF0A 3U8EA 4QRXA 3H6SA 3N4CA 3M99A 4W5BA 3PW3A 1CTEA 2E02A 7PCKA 3USVA 1BP4A 5EGWA 3HHIA 3RVWA 3QSDA 1AYVA 2DJGB 2G8EA 1K3BB 1KFUL 2NQDB 1KHQA 5CVOB 1U9XA 1Q6KA 1U9QX 2E00A 5J94A 4DMXA 1ZCMA 3H89A 1F2BA 3TNXA 4BS6A 2AVWA 2P7UA 5JA7A 4Q8HA 3OF9A 4P6GA 2DZZA 1QXPA 1PADA 2R9CA 1POPA 3OVXA 2R9NA 2FYEA 3AI8A 2OP3A 4PP2E 3NHEA 1A6RA 1EF7A 3QJ3A 1YK8A 1DEUA 3C9EA 1F2CA 4CDEB 3WXFA 3KWBX 4W5CA 2FRQA 5FPWA 2F7DA 4ZUXU 1EWLA 2YJ8A 3KFQA 4BQVA 1CB5A 3PBHA 1HUCB 1O0EA 2GHUA 2IPPB 3MTNA 1CV8A 1TL9A 3LFYA 4FJCA 2DCDA 3ZUAA 1NPZA 3CH3X 4CDFB 2NQAA 4YYRA 1GECE 4MZOA 2NQIA 4MSXA 2YJBA 1STFE 2XU1A 1GCBA 4P6EA 1KXRA 3P5WA 1CVZA 1BQIA 2DC9A 4N4ZA 1F29A 4KLBA 1SP4B 2AIMA 2DCAA 4YVAA 1CQDA 3IHPA 1MHWA 1U9VA 4I05A 2P0RA 1ITOA 3HD3A 1THEA 3GCBA 3H8BA 4OELA 3I3TA 1EWPA 2PREA 1U5IA 2ARYA 2BDLA 4K7CA 1BGOA 3HHAA 4I07A 1MEMA 3N3KA 2C0YA 3RVVA 3S3RA 5K16A 1ATKA 3BCNA 2CIOA 4DMYA 1EWOA 1PE6A 4FIPA 5CHTA 2JQGR 2E01A 2BDZA 3IOQA 4QRGA 1PPDA 4BSQA 3OISA 2AS8A 1YALA 4YYSA 3RVXA 4AXMA 4YYUA 2YJ2A 4YYWA 2VHSA 3K9MA 2R9FA 1NB5A 1AIMA 4CDCB 4YV8A 2YJ9A 1NQCA 3KWZA 3QT4A 4Q8GA 4W4UA 2XU3A 3HWNA 2DC8A 2PADA 2DC7A 2AU1A 1MEGA 6PADA 3B79A 4QH6A 4HWYA 4OEMA 3H7DA 1MIRA 4BS5A 1IWDA 1CPJA 1KFXL 2HHNA 2F1GA 4PP1A 2PBHA 3P5VA 3KSEA 2IBIA 5CVNB 4BPVA 3K8UA 1YVBA 2R6NA 2P86A 3PNRA 1TU6A 4MZSA 5CVMA 2HD5A 1FH0A 3PDFA 1AU2A 1F2AA 3ERVA 4RY2A 5EF4A 2B1NA 2HH5A 3IMAA 1AU4A 1MS6A 1NB3A 1QDQA 3IUTA 2FUDA 2DCBA 3OF8A 3BWKA 4YYQA 3LXSA 1CS8A 3E1ZB 1NLJA 1VJVA 2FQ9A 3DF0A 1Y08A 5A24A 4XUIA 3V6EA 4FK5A 4QRVA 1ME3A 1YK7A 2G7YA 3H8CA 1VSNA 2HXZA 1QOLA 1PBHA 1PPNA 1SNKA 2FTDA 2AYNA 4X6IA 2Y6EA
chains in the Genus database with same CATH superfamily
4YYVA 2JTCA 1PIPA 1AYWA 2R9OA 3O0UA 1CJLA 2FT2A 1X9YA 2YJCA 2WBFX 3BC3A 1TLOA 1QMYA 3I06A 2PNSA 4OVZA 3MHHA 1KHPA 3P5UA 3MP2A 2OULA 4WA6A 2DJFB 4G54A 3RNVA 2VHFA 1JQPA 3BOWA 3KX1A 3S3QA 1GMYA 3BPFA 5F02A 2JQFR 4N79A 1MDWA 2HWKA 1EWMA 1Y4HA 3O1GA 3E9SA 2DZYA 4RF1A 4BOQA 3F75A 2G6DA 2AUZA 5JH3A 1GLOA 3CBKA 1NL6A 3W30A 3KKUA 4AXLA 3IV2A 4MM3B 3PHUA 1ME4A 1M6DA 1XKGA 4I04A 2R9MA 3N3GA 2E03A 3WXEA 1AU0A 4X6HA 1AU3A 1CSBB 3KW9A 5E6JA 8PCHA 1PPPA 3IEJA 4HXDB 4GUAA 3BPMA 4BOZA 1DKIA 1U9WA 4N8WA 1ICFA 4PI3A 1ZIVA 4XR7A 1YZBA 3OVZA 3K24A 2UZJA 1PPOA 4PADA 3MJ5A 2B1MA 2ATOA 2GFOA 3WXGA 4M0WA 2Y5BA 1S4VA 1PCIA 1AECA 2OZ2A 2DCCA 3CBJA 3F5VA 3CH2X 2AYOA 2G8JA 3MHSA 2AUXA 3B21A 2O6XA 3MORA 9PAPA 1BY8A 2FRAA 3PSEA 4A5UA 5CHVA 5JZEA 2FO5A 3PRPA 4X6JA 2Z84A 5PADA 2ACTA 5EZSA 2XU4A 4CZWA 2XU5A 4QBBA 4CDDB 1AYUA 2NQGA 1YT7A 3P5XA 2CB5A 3V6CA 1PXVA 2DC6A 2H7JA 3D6SA 1DF0A 3U8EA 4QRXA 3H6SA 3N4CA 3M99A 4W5BA 3PW3A 1CTEA 2E02A 2BTWA 7PCKA 3USVA 2J7QC 3TMPA 1BP4A 5EGWA 3HHIA 3RVWA 3QSDA 1AYVA 2DJGB 2G8EA 1K3BB 3OQCA 1KFUL 2NQDB 1KHQA 5CVOB 1U9XA 1Q6KA 1U9QX 2E00A 5J94A 4DMXA 1ZCMA 3PRMA 4IP3A 3H89A 1F2BA 3TNXA 4BS6A 2AVWA 2P7UA 5JA7A 4Q8HA 3OF9A 2DOSA 4P6GA 4REZA 2DZZA 2FE8A 1QXPA 1PADA 2R9CA 4IUMA 1POPA 3OVXA 4RNAA 2R9NA 2FYEA 3AI8A 2BU3A 2J7QA 2OP3A 4PP2E 3NHEA 1A6RA 1EF7A 3QJ3A 1YK8A 1DEUA 3C9EA 1F2CA 4CDEB 3WXFA 3KWBX 3BBAA 4W5CA 2FRQA 5FPWA 2F7DA 4ZUXU 1EWLA 2YJ8A 3BB7A 3KFQA 4BQVA 1CB5A 3PBHA 1HUCB 1O0EA 2GHUA 2IPPB 4MI7A 3MTNA 3ZNHA 1CV8A 1TL9A 3LFYA 4BOPA 4FJCA 2DCDA 3ZUAA 5EZQA 1NPZA 3CH3X 4CDFB 2NQAA 3BY4A 4YYRA 1GECE 4MZOA 2NQIA 4MSXA 3O65A 3W31A 2YJBA 1STFE 2XU1A 1GCBA 4P6EA 1KXRA 3P5WA 1CVZA 1BQIA 2DC9A 4N4ZA 1F29A 4KLBA 1SP4B 2AIMA 2DCAA 4YVAA 1CQDA 3C0RA 3IHPA 4RF0A 1MHWA 5KO3A 1U9VA 4I05A 2P0RA 1ITOA 3HD3A 4D8EA 1THEA 3GCBA 3H8BA 4OELA 3PHWA 3I3TA 1EWPA 2PREA 1UKFA 1U5IA 2ARYA 2BDLA 4K7CA 1BGOA 3HHAA 4I07A 1MEMA 3N3KA 2C0YA 3RVVA 4D8IA 5K16A 3BCNA 1ATKA 3S3RA 2CIOA 4DMYA 1EWOA 1PE6A 4RKXA 4FIPA 5CHTA 4BOUA 2JQGR 2E01A 2BDZA 3IOQA 4QRGA 1PPDA 4BSQA 3OISA 2AS8A 1YALA 3TRKA 4YYSA 3RVXA 4AXMA 4YYUA 2YJ2A 4OW0A 4YYWA 2VHSA 3K9MA 2R9FA 1NB5A 1AIMA 4OVZB 4CDCB 4YV8A 2YJ9A 4XZXA 1PVJA 1NQCA 3KWZA 3QT4A 4Q8GA 4W4UA 4ZTBA 2XU3A 3HWNA 2DC8A 2PADA 2DC7A 2AU1A 1MEGA 6PADA 3B79A 4QH6A 4HWYA 4OEMA 3H7DA 1MIRA 4P16A 4BOSA 4BS5A 1IWDA 4PT5A 1CPJA 1KFXL 2HHNA 2F1GA 4PP1A 2PBHA 3P5VA 3KSEA 2IBIA 3PHXA 5CVNB 4BPVA 3K8UA 1YVBA 2BTWB 2R6NA 2P86A 3PNRA 1TU6A 4WURA 4MZSA 5CVMA 2HD5A 1FH0A 3PT2A 3PDFA 1AU2A 1F2AA 2AGAA 3MTVA 3ERVA 4RY2A 5EF4A 2JRIA 2B1NA 4D8BA 2HH5A 3IMAA 1AU4A 1MS6A 1NB3A 1QDQA 3IUTA 2FUDA 3IFUA 2DCBA 3OF8A 3BWKA 4YYQA 3LXSA 1CS8A 3E1ZB 1NLJA 1VJVA 2FQ9A 3DF0A 1Y08A 5A24A 4XUIA 3V6EA 4FK5A 4R3DA 4QRVA 1ME3A 1YK7A 2G7YA 3H8CA 1VSNA 2HXZA 1QOLA 1PBHA 1PPNA 1SNKA 2FTDA 2AYNA 4X6IA 2Y6EA
chains in the Genus database with same CATH topology
4YYVA 1PIPA 1AYWA 2R9OA 3O0UA 1CJLA 2FT2A 1X9YA 2YJCA 2WBFX 3BC3A 1TLOA 1QMYA 3I06A 2PNSA 3MHHA 1KHPA 3P5UA 2OULA 4WA6A 1W6FA 2DJFB 4G54A 4NV7A 2VHFA 1JQPA 3BOWA 3KX1A 3S3QA 1GMYA 3BPFA 5F02A 2JQFR 4N79A 1MDWA 1EWMA 1Y4HA 3O1GA 2DZYA 3F75A 2G6DA 2AUZA 5JH3A 1GLOA 3CBKA 1NL6A 4AXLA 3KKUA 3IV2A 1ME4A 1M6DA 1XKGA 4I04A 1E2TA 2R9MA 3N3GA 2E03A 3WXEA 1AU0A 4X6HA 1AU3A 1CSBB 3KW9A 8PCHA 1PPPA 3IEJA 3BPMA 1U9WA 4N8WA 1ICFA 4PI3A 1ZIVA 4XR7A 3OVZA 3K24A 1PPOA 4PADA 2B1MA 2ATOA 2GFOA 3WXGA 2Y5BA 1S4VA 1PCIA 1AECA 2OZ2A 2DCCA 3CBJA 3F5VA 3CH2X 2AYOA 2G8JA 3MHSA 2AUXA 2O6XA 3MORA 9PAPA 1BY8A 2FRAA 5CHVA 2FO5A 4X6JA 5PADA 2ACTA 2XU4A 4CZWA 2XU5A 4QBBA 4BGFA 4CDDB 1AYUA 2NQGA 1YT7A 3P5XA 2CB5A 3V6CA 1PXVA 2DC6A 2H7JA 3D6SA 1DF0A 3U8EA 4QRXA 3H6SA 2BSZA 3N4CA 3M99A 4W5BA 3PW3A 1CTEA 2E02A 7PCKA 3USVA 1BP4A 5EGWA 3HHIA 3RVWA 3QSDA 1AYVA 2DJGB 3D9WA 2G8EA 1K3BB 1W5RA 1KFUL 2NQDB 1KHQA 5CVOB 1U9XA 1Q6KA 1U9QX 2E00A 5J94A 4DMXA 1ZCMA 3H89A 1F2BA 3TNXA 4BS6A 2AVWA 2P7UA 5JA7A 4Q8HA 3OF9A 4P6GA 2DZZA 1QXPA 1PADA 2R9CA 1POPA 3OVXA 2R9NA 2FYEA 3AI8A 2OP3A 4PP2E 3NHEA 1A6RA 1EF7A 3QJ3A 1YK8A 1DEUA 3C9EA 1F2CA 4CDEB 3WXFA 3KWBX 4W5CA 2FRQA 4C5PA 5FPWA 2F7DA 4ZUXU 1EWLA 2YJ8A 3KFQA 4BQVA 1CB5A 3PBHA 1HUCB 1O0EA 2GHUA 2IPPB 3MTNA 1CV8A 1TL9A 3LFYA 4FJCA 2DCDA 3ZUAA 1NPZA 3CH3X 4CDFB 2NQAA 4YYRA 1GECE 1GX3A 4MZOA 2NQIA 4MSXA 2YJBA 1STFE 2XU1A 1GCBA 4P6EA 1KXRA 3P5WA 3LTWA 1CVZA 1BQIA 2DC9A 4N4ZA 1F29A 4KLBA 1SP4B 2AIMA 2DCAA 4YVAA 1CQDA 3IHPA 1MHWA 1U9VA 4I05A 2P0RA 1ITOA 3HD3A 1THEA 3GCBA 3H8BA 4OELA 3I3TA 1EWPA 2PREA 1U5IA 2ARYA 2BDLA 4K7CA 1BGOA 3HHAA 4I07A 1MEMA 3N3KA 2C0YA 2VFBA 3RVVA 5K16A 3BCNA 1ATKA 3S3RA 2CIOA 4DMYA 1EWOA 1PE6A 4FIPA 5CHTA 2JQGR 2E01A 2BDZA 3IOQA 4QRGA 1PPDA 4BSQA 3OISA 2AS8A 1YALA 4YYSA 3RVXA 4AXMA 4YYUA 2YJ2A 4YYWA 2VHSA 3K9MA 2VFCA 2R9FA 1NB5A 1AIMA 4CDCB 4YV8A 2YJ9A 1NQCA 4B55A 3KWZA 3QT4A 4Q8GA 4W4UA 2XU3A 3HWNA 2DC8A 2PADA 2DC7A 2AU1A 1MEGA 6PADA 3B79A 4NV8A 4QH6A 4HWYA 4OEMA 3H7DA 1MIRA 4BS5A 1IWDA 1W4TA 1CPJA 1KFXL 2HHNA 2F1GA 4PP1A 2PBHA 3P5VA 3KSEA 2IBIA 5CVNB 4BPVA 3K8UA 1YVBA 4GUZA 2R6NA 2P86A 3PNRA 1TU6A 4MZSA 5CVMA 2HD5A 1FH0A 3PDFA 1AU2A 1F2AA 3ERVA 4RY2A 5EF4A 2B1NA 2HH5A 3IMAA 1AU4A 1MS6A 1NB3A 1QDQA 3IUTA 2FUDA 2DCBA 3OF8A 3BWKA 4YYQA 3LXSA 1CS8A 3E1ZB 1NLJA 1VJVA 2FQ9A 3DF0A 1Y08A 5A24A 4XUIA 3V6EA 4FK5A 4QRVA 1ME3A 1YK7A 2G7YA 3H8CA 1VSNA 2HXZA 1QOLA 1PBHA 1PPNA 1SNKA 2FTDA 2AYNA 4X6IA 2Y6EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YYV A;  1PIP A;  1AYW A;  2R9O A;  3O0U A;  1CJL A;  2FT2 A;  1X9Y A;  2YJC A;  2WBF X;  3BC3 A;  1TLO A;  1QMY A;  3I06 A;  2PNS A;  3MHH A;  1KHP A;  3P5U A;  2OUL A;  4WA6 A;  2DJF B;  4G54 A;  2VHF A;  1JQP A;  3BOW A;  3KX1 A;  3S3Q A;  1GMY A;  3BPF A;  5F02 A;  2JQF R;  4N79 A;  1MDW A;  1EWM A;  1Y4H A;  3O1G A;  2DZY A;  3F75 A;  2G6D A;  2AUZ A;  5JH3 A;  1GLO A;  3CBK A;  1NL6 A;  4AXL A;  3KKU A;  3IV2 A;  1ME4 A;  1M6D A;  1XKG A;  4I04 A;  2R9M A;  3N3G A;  2E03 A;  3WXE A;  1AU0 A;  4X6H A;  1AU3 A;  1CSB B;  3KW9 A;  8PCH A;  1PPP A;  3IEJ A;  3BPM A;  1U9W A;  4N8W A;  1ICF A;  4PI3 A;  1ZIV A;  4XR7 A;  3OVZ A;  3K24 A;  1PPO A;  4PAD A;  2B1M A;  2ATO A;  2GFO A;  3WXG A;  2Y5B A;  1S4V A;  1PCI A;  1AEC A;  2OZ2 A;  2DCC A;  3CBJ A;  3F5V A;  3CH2 X;  2AYO A;  2G8J A;  3MHS A;  2AUX A;  2O6X A;  3MOR A;  9PAP A;  1BY8 A;  2FRA A;  5CHV A;  2FO5 A;  4X6J A;  5PAD A;  2ACT A;  2XU4 A;  4CZW A;  2XU5 A;  4QBB A;  4CDD B;  1AYU A;  2NQG A;  1YT7 A;  3P5X A;  2CB5 A;  3V6C A;  1PXV A;  2DC6 A;  2H7J A;  3D6S A;  1DF0 A;  3U8E A;  4QRX A;  3H6S A;  3N4C A;  3M99 A;  4W5B A;  3PW3 A;  1CTE A;  2E02 A;  7PCK A;  3USV A;  1BP4 A;  5EGW A;  3HHI A;  3RVW A;  3QSD A;  1AYV A;  2DJG B;  2G8E A;  1K3B B;  1KFU L;  2NQD B;  1KHQ A;  5CVO B;  1U9X A;  1Q6K A;  1U9Q X;  2E00 A;  5J94 A;  4DMX A;  1ZCM A;  3H89 A;  1F2B A;  3TNX A;  4BS6 A;  2AVW A;  2P7U A;  5JA7 A;  4Q8H A;  3OF9 A;  4P6G A;  2DZZ A;  1QXP A;  1PAD A;  2R9C A;  1POP A;  3OVX A;  2R9N A;  2FYE A;  3AI8 A;  2OP3 A;  4PP2 E;  3NHE A;  1A6R A;  1EF7 A;  3QJ3 A;  1YK8 A;  1DEU A;  3C9E A;  1F2C A;  4CDE B;  3WXF A;  3KWB X;  4W5C A;  2FRQ A;  5FPW A;  2F7D A;  4ZUX U;  1EWL A;  2YJ8 A;  3KFQ A;  4BQV A;  1CB5 A;  3PBH A;  1HUC B;  1O0E A;  2GHU A;  2IPP B;  3MTN A;  1CV8 A;  1TL9 A;  3LFY A;  4FJC A;  2DCD A;  3ZUA A;  1NPZ A;  3CH3 X;  4CDF B;  2NQA A;  4YYR A;  1GEC E;  4MZO A;  2NQI A;  4MSX A;  2YJB A;  1STF E;  2XU1 A;  1GCB A;  4P6E A;  1KXR A;  3P5W A;  1CVZ A;  1BQI A;  2DC9 A;  4N4Z A;  1F29 A;  4KLB A;  1SP4 B;  2AIM A;  2DCA A;  4YVA A;  1CQD A;  3IHP A;  1MHW A;  1U9V A;  4I05 A;  2P0R A;  1ITO A;  3HD3 A;  1THE A;  3GCB A;  3H8B A;  4OEL A;  3I3T A;  1EWP A;  2PRE A;  1U5I A;  2ARY A;  2BDL A;  4K7C A;  1BGO A;  3HHA A;  4I07 A;  1MEM A;  3N3K A;  2C0Y A;  3RVV A;  3S3R A;  5K16 A;  1ATK A;  3BCN A;  2CIO A;  4DMY A;  1EWO A;  1PE6 A;  4FIP A;  5CHT A;  2JQG R;  2E01 A;  2BDZ A;  3IOQ A;  4QRG A;  1PPD A;  4BSQ A;  3OIS A;  2AS8 A;  1YAL A;  4YYS A;  3RVX A;  4AXM A;  4YYU A;  2YJ2 A;  4YYW A;  2VHS A;  3K9M A;  2R9F A;  1NB5 A;  1AIM A;  4CDC B;  4YV8 A;  2YJ9 A;  1NQC A;  3KWZ A;  3QT4 A;  4Q8G A;  4W4U A;  2XU3 A;  3HWN A;  2DC8 A;  2PAD A;  2DC7 A;  2AU1 A;  1MEG A;  6PAD A;  3B79 A;  4QH6 A;  4HWY A;  4OEM A;  3H7D A;  1MIR A;  4BS5 A;  1IWD A;  1CPJ A;  1KFX L;  2HHN A;  2F1G A;  4PP1 A;  2PBH A;  3P5V A;  3KSE A;  2IBI A;  5CVN B;  4BPV A;  3K8U A;  1YVB A;  2R6N A;  2P86 A;  3PNR A;  1TU6 A;  4MZS A;  5CVM A;  2HD5 A;  1FH0 A;  3PDF A;  1AU2 A;  1F2A A;  3ERV A;  4RY2 A;  5EF4 A;  2B1N A;  2HH5 A;  3IMA A;  1AU4 A;  1MS6 A;  1NB3 A;  1QDQ A;  3IUT A;  2FUD A;  2DCB A;  3OF8 A;  3BWK A;  4YYQ A;  3LXS A;  1CS8 A;  3E1Z B;  1NLJ A;  1VJV A;  2FQ9 A;  3DF0 A;  1Y08 A;  5A24 A;  4XUI A;  3V6E A;  4FK5 A;  4QRV A;  1ME3 A;  1YK7 A;  2G7Y A;  3H8C A;  1VSN A;  2HXZ A;  1QOL A;  1PBH A;  1PPN A;  1SNK A;  2FTD A;  2AYN A;  4X6I A;  2Y6E A; 
#chains in the Genus database with same CATH topology
 4YYV A;  2JTC A;  1PIP A;  1AYW A;  2R9O A;  3O0U A;  1CJL A;  2FT2 A;  1X9Y A;  2YJC A;  2WBF X;  3BC3 A;  1TLO A;  1QMY A;  3I06 A;  2PNS A;  4OVZ A;  3MHH A;  1KHP A;  3P5U A;  3MP2 A;  2OUL A;  4WA6 A;  2DJF B;  4G54 A;  3RNV A;  2VHF A;  1JQP A;  3BOW A;  3KX1 A;  3S3Q A;  1GMY A;  3BPF A;  5F02 A;  2JQF R;  4N79 A;  1MDW A;  2HWK A;  1EWM A;  1Y4H A;  3O1G A;  3E9S A;  2DZY A;  4RF1 A;  4BOQ A;  3F75 A;  2G6D A;  2AUZ A;  5JH3 A;  1GLO A;  3CBK A;  1NL6 A;  3W30 A;  3KKU A;  4AXL A;  3IV2 A;  4MM3 B;  3PHU A;  1ME4 A;  1M6D A;  1XKG A;  4I04 A;  2R9M A;  3N3G A;  2E03 A;  3WXE A;  1AU0 A;  4X6H A;  1AU3 A;  1CSB B;  3KW9 A;  5E6J A;  8PCH A;  1PPP A;  3IEJ A;  4HXD B;  4GUA A;  3BPM A;  4BOZ A;  1DKI A;  1U9W A;  4N8W A;  1ICF A;  4PI3 A;  1ZIV A;  4XR7 A;  1YZB A;  3OVZ A;  3K24 A;  2UZJ A;  1PPO A;  4PAD A;  3MJ5 A;  2B1M A;  2ATO A;  2GFO A;  3WXG A;  4M0W A;  2Y5B A;  1S4V A;  1PCI A;  1AEC A;  2OZ2 A;  2DCC A;  3CBJ A;  3F5V A;  3CH2 X;  2AYO A;  2G8J A;  3MHS A;  2AUX A;  3B21 A;  2O6X A;  3MOR A;  9PAP A;  1BY8 A;  2FRA A;  3PSE A;  4A5U A;  5CHV A;  5JZE A;  2FO5 A;  3PRP A;  4X6J A;  2Z84 A;  5PAD A;  2ACT A;  5EZS A;  2XU4 A;  4CZW A;  2XU5 A;  4QBB A;  4CDD B;  1AYU A;  2NQG A;  1YT7 A;  3P5X A;  2CB5 A;  3V6C A;  1PXV A;  2DC6 A;  2H7J A;  3D6S A;  1DF0 A;  3U8E A;  4QRX A;  3H6S A;  3N4C A;  3M99 A;  4W5B A;  3PW3 A;  1CTE A;  2E02 A;  2BTW A;  7PCK A;  3USV A;  2J7Q C;  3TMP A;  1BP4 A;  5EGW A;  3HHI A;  3RVW A;  3QSD A;  1AYV A;  2DJG B;  2G8E A;  1K3B B;  3OQC A;  1KFU L;  2NQD B;  1KHQ A;  5CVO B;  1U9X A;  1Q6K A;  1U9Q X;  2E00 A;  5J94 A;  4DMX A;  1ZCM A;  3PRM A;  4IP3 A;  3H89 A;  1F2B A;  3TNX A;  4BS6 A;  2AVW A;  2P7U A;  5JA7 A;  4Q8H A;  3OF9 A;  2DOS A;  4P6G A;  4REZ A;  2DZZ A;  2FE8 A;  1QXP A;  1PAD A;  2R9C A;  4IUM A;  1POP A;  3OVX A;  4RNA A;  2R9N A;  2FYE A;  3AI8 A;  2BU3 A;  2J7Q A;  2OP3 A;  4PP2 E;  3NHE A;  1A6R A;  1EF7 A;  3QJ3 A;  1YK8 A;  1DEU A;  3C9E A;  1F2C A;  4CDE B;  3WXF A;  3KWB X;  3BBA A;  4W5C A;  2FRQ A;  5FPW A;  2F7D A;  4ZUX U;  1EWL A;  2YJ8 A;  3BB7 A;  3KFQ A;  4BQV A;  1CB5 A;  3PBH A;  1HUC B;  1O0E A;  2GHU A;  2IPP B;  4MI7 A;  3MTN A;  3ZNH A;  1CV8 A;  1TL9 A;  3LFY A;  4BOP A;  4FJC A;  2DCD A;  3ZUA A;  5EZQ A;  1NPZ A;  3CH3 X;  4CDF B;  2NQA A;  3BY4 A;  4YYR A;  1GEC E;  4MZO A;  2NQI A;  4MSX A;  3O65 A;  3W31 A;  2YJB A;  1STF E;  2XU1 A;  1GCB A;  4P6E A;  1KXR A;  3P5W A;  1CVZ A;  1BQI A;  2DC9 A;  4N4Z A;  1F29 A;  4KLB A;  1SP4 B;  2AIM A;  2DCA A;  4YVA A;  1CQD A;  3C0R A;  3IHP A;  4RF0 A;  1MHW A;  5KO3 A;  1U9V A;  4I05 A;  2P0R A;  1ITO A;  3HD3 A;  4D8E A;  1THE A;  3GCB A;  3H8B A;  4OEL A;  3PHW A;  3I3T A;  1EWP A;  2PRE A;  1UKF A;  1U5I A;  2ARY A;  2BDL A;  4K7C A;  1BGO A;  3HHA A;  4I07 A;  1MEM A;  3N3K A;  2C0Y A;  3RVV A;  4D8I A;  5K16 A;  3BCN A;  1ATK A;  3S3R A;  2CIO A;  4DMY A;  1EWO A;  1PE6 A;  4RKX A;  4FIP A;  5CHT A;  4BOU A;  2JQG R;  2E01 A;  2BDZ A;  3IOQ A;  4QRG A;  1PPD A;  4BSQ A;  3OIS A;  2AS8 A;  1YAL A;  3TRK A;  4YYS A;  3RVX A;  4AXM A;  4YYU A;  2YJ2 A;  4OW0 A;  4YYW A;  2VHS A;  3K9M A;  2R9F A;  1NB5 A;  1AIM A;  4OVZ B;  4CDC B;  4YV8 A;  2YJ9 A;  4XZX A;  1PVJ A;  1NQC A;  3KWZ A;  3QT4 A;  4Q8G A;  4W4U A;  4ZTB A;  2XU3 A;  3HWN A;  2DC8 A;  2PAD A;  2DC7 A;  2AU1 A;  1MEG A;  6PAD A;  3B79 A;  4QH6 A;  4HWY A;  4OEM A;  3H7D A;  1MIR A;  4P16 A;  4BOS A;  4BS5 A;  1IWD A;  4PT5 A;  1CPJ A;  1KFX L;  2HHN A;  2F1G A;  4PP1 A;  2PBH A;  3P5V A;  3KSE A;  2IBI A;  3PHX A;  5CVN B;  4BPV A;  3K8U A;  1YVB A;  2BTW B;  2R6N A;  2P86 A;  3PNR A;  1TU6 A;  4WUR A;  4MZS A;  5CVM A;  2HD5 A;  1FH0 A;  3PT2 A;  3PDF A;  1AU2 A;  1F2A A;  2AGA A;  3MTV A;  3ERV A;  4RY2 A;  5EF4 A;  2JRI A;  2B1N A;  4D8B A;  2HH5 A;  3IMA A;  1AU4 A;  1MS6 A;  1NB3 A;  1QDQ A;  3IUT A;  2FUD A;  3IFU A;  2DCB A;  3OF8 A;  3BWK A;  4YYQ A;  3LXS A;  1CS8 A;  3E1Z B;  1NLJ A;  1VJV A;  2FQ9 A;  3DF0 A;  1Y08 A;  5A24 A;  4XUI A;  3V6E A;  4FK5 A;  4R3D A;  4QRV A;  1ME3 A;  1YK7 A;  2G7Y A;  3H8C A;  1VSN A;  2HXZ A;  1QOL A;  1PBH A;  1PPN A;  1SNK A;  2FTD A;  2AYN A;  4X6I A;  2Y6E A; 
#chains in the Genus database with same CATH homology
 4YYV A;  1PIP A;  1AYW A;  2R9O A;  3O0U A;  1CJL A;  2FT2 A;  1X9Y A;  2YJC A;  2WBF X;  3BC3 A;  1TLO A;  1QMY A;  3I06 A;  2PNS A;  3MHH A;  1KHP A;  3P5U A;  2OUL A;  4WA6 A;  1W6F A;  2DJF B;  4G54 A;  4NV7 A;  2VHF A;  1JQP A;  3BOW A;  3KX1 A;  3S3Q A;  1GMY A;  3BPF A;  5F02 A;  2JQF R;  4N79 A;  1MDW A;  1EWM A;  1Y4H A;  3O1G A;  2DZY A;  3F75 A;  2G6D A;  2AUZ A;  5JH3 A;  1GLO A;  3CBK A;  1NL6 A;  4AXL A;  3KKU A;  3IV2 A;  1ME4 A;  1M6D A;  1XKG A;  4I04 A;  1E2T A;  2R9M A;  3N3G A;  2E03 A;  3WXE A;  1AU0 A;  4X6H A;  1AU3 A;  1CSB B;  3KW9 A;  8PCH A;  1PPP A;  3IEJ A;  3BPM A;  1U9W A;  4N8W A;  1ICF A;  4PI3 A;  1ZIV A;  4XR7 A;  3OVZ A;  3K24 A;  1PPO A;  4PAD A;  2B1M A;  2ATO A;  2GFO A;  3WXG A;  2Y5B A;  1S4V A;  1PCI A;  1AEC A;  2OZ2 A;  2DCC A;  3CBJ A;  3F5V A;  3CH2 X;  2AYO A;  2G8J A;  3MHS A;  2AUX A;  2O6X A;  3MOR A;  9PAP A;  1BY8 A;  2FRA A;  5CHV A;  2FO5 A;  4X6J A;  5PAD A;  2ACT A;  2XU4 A;  4CZW A;  2XU5 A;  4QBB A;  4BGF A;  4CDD B;  1AYU A;  2NQG A;  1YT7 A;  3P5X A;  2CB5 A;  3V6C A;  1PXV A;  2DC6 A;  2H7J A;  3D6S A;  1DF0 A;  3U8E A;  4QRX A;  3H6S A;  2BSZ A;  3N4C A;  3M99 A;  4W5B A;  3PW3 A;  1CTE A;  2E02 A;  7PCK A;  3USV A;  1BP4 A;  5EGW A;  3HHI A;  3RVW A;  3QSD A;  1AYV A;  2DJG B;  3D9W A;  2G8E A;  1K3B B;  1W5R A;  1KFU L;  2NQD B;  1KHQ A;  5CVO B;  1U9X A;  1Q6K A;  1U9Q X;  2E00 A;  5J94 A;  4DMX A;  1ZCM A;  3H89 A;  1F2B A;  3TNX A;  4BS6 A;  2AVW A;  2P7U A;  5JA7 A;  4Q8H A;  3OF9 A;  4P6G A;  2DZZ A;  1QXP A;  1PAD A;  2R9C A;  1POP A;  3OVX A;  2R9N A;  2FYE A;  3AI8 A;  2OP3 A;  4PP2 E;  3NHE A;  1A6R A;  1EF7 A;  3QJ3 A;  1YK8 A;  1DEU A;  3C9E A;  1F2C A;  4CDE B;  3WXF A;  3KWB X;  4W5C A;  2FRQ A;  4C5P A;  5FPW A;  2F7D A;  4ZUX U;  1EWL A;  2YJ8 A;  3KFQ A;  4BQV A;  1CB5 A;  3PBH A;  1HUC B;  1O0E A;  2GHU A;  2IPP B;  3MTN A;  1CV8 A;  1TL9 A;  3LFY A;  4FJC A;  2DCD A;  3ZUA A;  1NPZ A;  3CH3 X;  4CDF B;  2NQA A;  4YYR A;  1GEC E;  1GX3 A;  4MZO A;  2NQI A;  4MSX A;  2YJB A;  1STF E;  2XU1 A;  1GCB A;  4P6E A;  1KXR A;  3P5W A;  3LTW A;  1CVZ A;  1BQI A;  2DC9 A;  4N4Z A;  1F29 A;  4KLB A;  1SP4 B;  2AIM A;  2DCA A;  4YVA A;  1CQD A;  3IHP A;  1MHW A;  1U9V A;  4I05 A;  2P0R A;  1ITO A;  3HD3 A;  1THE A;  3GCB A;  3H8B A;  4OEL A;  3I3T A;  1EWP A;  2PRE A;  1U5I A;  2ARY A;  2BDL A;  4K7C A;  1BGO A;  3HHA A;  4I07 A;  1MEM A;  3N3K A;  2C0Y A;  2VFB A;  3RVV A;  5K16 A;  3BCN A;  1ATK A;  3S3R A;  2CIO A;  4DMY A;  1EWO A;  1PE6 A;  4FIP A;  5CHT A;  2JQG R;  2E01 A;  2BDZ A;  3IOQ A;  4QRG A;  1PPD A;  4BSQ A;  3OIS A;  2AS8 A;  1YAL A;  4YYS A;  3RVX A;  4AXM A;  4YYU A;  2YJ2 A;  4YYW A;  2VHS A;  3K9M A;  2VFC A;  2R9F A;  1NB5 A;  1AIM A;  4CDC B;  4YV8 A;  2YJ9 A;  1NQC A;  4B55 A;  3KWZ A;  3QT4 A;  4Q8G A;  4W4U A;  2XU3 A;  3HWN A;  2DC8 A;  2PAD A;  2DC7 A;  2AU1 A;  1MEG A;  6PAD A;  3B79 A;  4NV8 A;  4QH6 A;  4HWY A;  4OEM A;  3H7D A;  1MIR A;  4BS5 A;  1IWD A;  1W4T A;  1CPJ A;  1KFX L;  2HHN A;  2F1G A;  4PP1 A;  2PBH A;  3P5V A;  3KSE A;  2IBI A;  5CVN B;  4BPV A;  3K8U A;  1YVB A;  4GUZ A;  2R6N A;  2P86 A;  3PNR A;  1TU6 A;  4MZS A;  5CVM A;  2HD5 A;  1FH0 A;  3PDF A;  1AU2 A;  1F2A A;  3ERV A;  4RY2 A;  5EF4 A;  2B1N A;  2HH5 A;  3IMA A;  1AU4 A;  1MS6 A;  1NB3 A;  1QDQ A;  3IUT A;  2FUD A;  2DCB A;  3OF8 A;  3BWK A;  4YYQ A;  3LXS A;  1CS8 A;  3E1Z B;  1NLJ A;  1VJV A;  2FQ9 A;  3DF0 A;  1Y08 A;  5A24 A;  4XUI A;  3V6E A;  4FK5 A;  4QRV A;  1ME3 A;  1YK7 A;  2G7Y A;  3H8C A;  1VSN A;  2HXZ A;  1QOL A;  1PBH A;  1PPN A;  1SNK A;  2FTD A;  2AYN A;  4X6I A;  2Y6E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...