4XZXA

Shigella flexneri effector ospi c62s mutant
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
192
structure length
192
Chain Sequence
b'NVNVKKLLESLNSKSLGDMDKDSELAATLQKMINPSGGDGNSSGCALHACMAMLGYGVREAPVPNEISEYMTGFFHRHLEQIDSEGIVSHPNETYSKFRERIAENILQNTSKGSVVMISIEQATHWIAGFNDGEKIMFLDVQTGKGFNLYDPVEKSPDAFVDENSSVQVIHVSDQEFDHYANSSSWKSKRLC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ORF169b
publication title New insights into the active site structure of Shigella effecter OspI
rcsb
source organism Shigella flexneri
molecule tags Immune system
total genus 59
structure length 192
sequence length 192
ec nomenclature
pdb deposition date 2015-02-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.140 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 4xzxA00
3B21A 3W30A 4XZXA 3W31A 4IP3A
chains in the Genus database with same CATH superfamily
4PP1A 5A24A 3IMAA 3S3RA 4RY2A 3CH2X 3NHEA 4OVZA 2BTWB 4M0WA 2R9MA 2B1NA 2G7YA 4YYSA 4I04A 2R9FA 4MZOA 1AYVA 1BP4A 1VSNA 4IP3A 3OVXA 1MEGA 5E6JA 4HWYA 4YYQA 4W4UA 2ARYA 1PPOA 2DCBA 3C9EA 1MIRA 3GCBA 2G8JA 2Z84A 4P16A 1AIMA 5K16A 2UZJA 1CB5A 1QMYA 1ME3A 5CHTA 1KFUL 3MTNA 3F5VA 3ERVA 1NQCA 2JQFR 3BWKA 1PPDA 5PADA 3KSEA 3WXFA 2HH5A 2AYOA 4XR7A 1U5IA 4IUMA 1U9XA 1YVBA 1GCBA 1ITOA 4QRGA 4OVZB 3O1GA 3N4CA 4X6IA 3TNXA 2XU3A 1DKIA 2HD5A 4BPVA 1AYWA 1HUCB 2IBIA 2Y6EA 1PIPA 1BQIA 3MP2A 1CS8A 1YZBA 2NQDB 4D8BA 2WBFX 1PADA 4BS5A 4FIPA 5EZSA 2AUZA 4REZA 2FQ9A 2BDZA 4YYVA 2GHUA 1UKFA 2P0RA 1PVJA 3USVA 3W31A 2AUXA 1KHPA 3KWZA 2YJ9A 4BOUA 3ZUAA 5JH3A 1DF0A 1PXVA 3KWBX 3IEJA 4YYUA 1TU6A 1MEMA 1SNKA 1AYUA 1PBHA 3H6SA 1AU3A 1CQDA 2IPPB 1CPJA 1S4VA 4PP2E 3OVZA 4BQVA 1CVZA 3W30A 1ZIVA 3KKUA 3K24A 2YJ2A 3BPMA 2VHFA 3B21A 3P5WA 1CTEA 4PI3A 2AYNA 4P6GA 1STFE 2PREA 1ZCMA 3IOQA 2P7UA 1NL6A 2P86A 4N79A 1U9WA 3V6EA 3I06A 3QJ3A 3H8BA 1CSBB 3LFYA 4KLBA 4MZSA 4QRXA 2BDLA 3K9MA 4CDFB 1SP4B 1KFXL 5JZEA 3BY4A 4XUIA 4BOZA 4YYRA 4FJCA 4BOQA 4PT5A 3TRKA 5CVOB 2PNSA 2OULA 2OZ2A 4ZUXU 5CHVA 3IFUA 2JRIA 3PNRA 5CVNB 2JQGR 2DCAA 6PADA 2FRQA 3I3TA 2FT2A 2Y5BA 4A5UA 2HWKA 2XU1A 3IHPA 2DJGB 1AU4A 2FO5A 3LXSA 4QH6A 4OW0A 7PCKA 3PT2A 4QBBA 1F2BA 4MI7A 3PDFA 4QRVA 2DOSA 1THEA 3H8CA 3BBAA 1NB5A 1ME4A 2E02A 2FYEA 3P5VA 1TL9A 4FK5A 2CIOA 4R3DA 5EF4A 1O0EA 5JA7A 3CH3X 3E1ZB 4BSQA 1K3BB 1YK7A 3BPFA 2G8EA 1AECA 3OQCA 1ATKA 1Y08A 2AU1A 2DJFB 3B79A 4D8IA 4YYWA 3BCNA 2DCDA 4AXMA 4X6HA 1MS6A 5F02A 3AI8A 4OELA 2H7JA 2C0YA 2ACTA 3WXGA 4YV8A 2PBHA 3OF8A 4N8WA 2G6DA 2HXZA 2R6NA 1DEUA 1F29A 2DC8A 4RF1A 3N3KA 2PADA 4BOSA 3BC3A 3CBKA 5EGWA 3RVXA 4W5BA 2OP3A 4D8EA 2NQIA 3IUTA 1QXPA 3U8EA 4Q8HA 1PE6A 3P5UA 4GUAA 3RVVA 1A6RA 1Y4HA 2FRAA 3HHAA 1U9QX 4MSXA 1MHWA 1Q6KA 4K7CA 2DC7A 3OISA 3MHSA 2NQAA 2J7QC 4I05A 1VJVA 2AVWA 3E9SA 4CDCB 3BB7A 2NQGA 4CDDB 3N3GA 1M6DA 3KX1A 1TLOA 8PCHA 1PPPA 2E03A 4WA6A 3PBHA 3ZNHA 2E01A 3D6SA 1KXRA 1AU2A 1PCIA 3BOWA 1FH0A 3PHUA 1NB3A 5KO3A 4MM3B 3C0RA 1EWPA 3MHHA 2ATOA 3P5XA 2YJCA 3O65A 3MTVA 3F75A 4ZTBA 3WXEA 2DZYA 3PW3A 4W5CA 4YVAA 2FUDA 4X6JA 3H89A 3PSEA 3RNVA 2O6XA 1BGOA 4RNAA 1EF7A 3QT4A 1QDQA 2DCCA 3K8UA 2YJ8A 2DC6A 3S3QA 1MDWA 2VHSA 3DF0A 2GFOA 9PAPA 3KW9A 5FPWA 4RKXA 3RVWA 3V6CA 1X9YA 4N4ZA 1BY8A 4XZXA 2R9CA 2B1MA 1AU0A 1PPNA 3CBJA 3PRMA 1CJLA 5CVMA 2F1GA 1EWOA 4DMXA 3IV2A 1NPZA 2F7DA 1F2CA 2FE8A 4BOPA 2XU4A 3MJ5A 4CZWA 1EWMA 2E00A 3PRPA 4WURA 1GECE 5J94A 4BS6A 1XKGA 2R9NA 4AXLA 2CB5A 4RF0A 3MORA 1NLJA 1F2AA 1U9VA 1CV8A 2HHNA 3TMPA 2AS8A 3KFQA 1YK8A 3OF9A 2DC9A 2BU3A 3H7DA 2YJBA 2AGAA 2BTWA 4OEMA 1YALA 1GMYA 2FTDA 3HD3A 3O0UA 2JTCA 4CDEB 1KHQA 1QOLA 4PADA 3QSDA 3PHXA 4G54A 4I07A 4P6EA 3M99A 2R9OA 1POPA 3HWNA 5EZQA 1YT7A 3HHIA 1ICFA 2AIMA 1EWLA 4HXDB 4DMYA 1IWDA 2DZZA 4Q8GA 1JQPA 1GLOA 2XU5A 2J7QA 3PHWA
chains in the Genus database with same CATH topology
4RNAA 4BOUA 4R3DA 3OQCA 4OVZA 2BTWB 4M0WA 4D8IA 4RKXA 3W30A 4IP3A 3BBAA 3B21A 5E6JA 4XZXA 3PRMA 2Z84A 4P16A 2UZJA 4RF1A 4BOSA 2FE8A 4BOPA 3MJ5A 4D8EA 3PRPA 4WURA 4IUMA 4OVZB 5JZEA 3BY4A 4BOZA 4GUAA 4RF0A 1DKIA 4BOQA 4PT5A 3TRKA 3TMPA 2BU3A 2AGAA 2BTWA 3IFUA 2J7QC 2JRIA 3E9SA 3BB7A 3MP2A 1YZBA 4D8BA 2JTCA 4A5UA 2HWKA 3ZNHA 3PHXA 3PHUA 5KO3A 4MM3B 5EZSA 3C0RA 4REZA 3O65A 3MTVA 4OW0A 3PT2A 4ZTBA 5EZQA 4MI7A 1UKFA 4HXDB 2DOSA 3PSEA 1PVJA 3RNVA 3W31A 2J7QA 3PHWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B21 A;  3W30 A;  4XZX A;  3W31 A;  4IP3 A; 
#chains in the Genus database with same CATH topology
 4PP1 A;  5A24 A;  3IMA A;  3S3R A;  4RY2 A;  3CH2 X;  3NHE A;  4OVZ A;  2BTW B;  4M0W A;  2R9M A;  2B1N A;  2G7Y A;  4YYS A;  4I04 A;  2R9F A;  4MZO A;  1AYV A;  1BP4 A;  1VSN A;  4IP3 A;  3OVX A;  1MEG A;  5E6J A;  4HWY A;  4YYQ A;  4W4U A;  2ARY A;  1PPO A;  2DCB A;  3C9E A;  1MIR A;  3GCB A;  2G8J A;  2Z84 A;  4P16 A;  1AIM A;  5K16 A;  2UZJ A;  1CB5 A;  1QMY A;  1ME3 A;  5CHT A;  1KFU L;  3MTN A;  3F5V A;  3ERV A;  1NQC A;  2JQF R;  3BWK A;  1PPD A;  5PAD A;  3KSE A;  3WXF A;  2HH5 A;  2AYO A;  4XR7 A;  1U5I A;  4IUM A;  1U9X A;  1YVB A;  1GCB A;  1ITO A;  4QRG A;  4OVZ B;  3O1G A;  3N4C A;  4X6I A;  3TNX A;  2XU3 A;  1DKI A;  2HD5 A;  4BPV A;  1AYW A;  1HUC B;  2IBI A;  2Y6E A;  1PIP A;  1BQI A;  3MP2 A;  1CS8 A;  1YZB A;  2NQD B;  4D8B A;  2WBF X;  1PAD A;  4BS5 A;  4FIP A;  5EZS A;  2AUZ A;  4REZ A;  2FQ9 A;  2BDZ A;  4YYV A;  2GHU A;  1UKF A;  2P0R A;  1PVJ A;  3USV A;  3W31 A;  2AUX A;  1KHP A;  3KWZ A;  2YJ9 A;  4BOU A;  3ZUA A;  5JH3 A;  1DF0 A;  1PXV A;  3KWB X;  3IEJ A;  4YYU A;  1TU6 A;  1MEM A;  1SNK A;  1AYU A;  1PBH A;  3H6S A;  1AU3 A;  1CQD A;  2IPP B;  1CPJ A;  1S4V A;  4PP2 E;  3OVZ A;  4BQV A;  1CVZ A;  3W30 A;  1ZIV A;  3KKU A;  3K24 A;  2YJ2 A;  3BPM A;  2VHF A;  3B21 A;  3P5W A;  1CTE A;  4PI3 A;  2AYN A;  4P6G A;  1STF E;  2PRE A;  1ZCM A;  3IOQ A;  2P7U A;  1NL6 A;  2P86 A;  4N79 A;  1U9W A;  3V6E A;  3I06 A;  3QJ3 A;  3H8B A;  1CSB B;  3LFY A;  4KLB A;  4MZS A;  4QRX A;  2BDL A;  3K9M A;  4CDF B;  1SP4 B;  1KFX L;  5JZE A;  3BY4 A;  4XUI A;  4BOZ A;  4YYR A;  4FJC A;  4BOQ A;  4PT5 A;  3TRK A;  5CVO B;  2PNS A;  2OUL A;  2OZ2 A;  4ZUX U;  5CHV A;  3IFU A;  2JRI A;  3PNR A;  5CVN B;  2JQG R;  2DCA A;  6PAD A;  2FRQ A;  3I3T A;  2FT2 A;  2Y5B A;  4A5U A;  2HWK A;  2XU1 A;  3IHP A;  2DJG B;  1AU4 A;  2FO5 A;  3LXS A;  4QH6 A;  4OW0 A;  7PCK A;  3PT2 A;  4QBB A;  1F2B A;  4MI7 A;  3PDF A;  4QRV A;  2DOS A;  1THE A;  3H8C A;  3BBA A;  1NB5 A;  1ME4 A;  2E02 A;  2FYE A;  3P5V A;  1TL9 A;  4FK5 A;  2CIO A;  4R3D A;  5EF4 A;  1O0E A;  5JA7 A;  3CH3 X;  3E1Z B;  4BSQ A;  1K3B B;  1YK7 A;  3BPF A;  2G8E A;  1AEC A;  3OQC A;  1ATK A;  1Y08 A;  2AU1 A;  2DJF B;  3B79 A;  4D8I A;  4YYW A;  3BCN A;  2DCD A;  4AXM A;  4X6H A;  1MS6 A;  5F02 A;  3AI8 A;  4OEL A;  2H7J A;  2C0Y A;  2ACT A;  3WXG A;  4YV8 A;  2PBH A;  3OF8 A;  4N8W A;  2G6D A;  2HXZ A;  2R6N A;  1DEU A;  1F29 A;  2DC8 A;  4RF1 A;  3N3K A;  2PAD A;  4BOS A;  3BC3 A;  3CBK A;  5EGW A;  3RVX A;  4W5B A;  2OP3 A;  4D8E A;  2NQI A;  3IUT A;  1QXP A;  3U8E A;  4Q8H A;  1PE6 A;  3P5U A;  4GUA A;  3RVV A;  1A6R A;  1Y4H A;  2FRA A;  3HHA A;  1U9Q X;  4MSX A;  1MHW A;  1Q6K A;  4K7C A;  2DC7 A;  3OIS A;  3MHS A;  2NQA A;  2J7Q C;  4I05 A;  1VJV A;  2AVW A;  3E9S A;  4CDC B;  3BB7 A;  2NQG A;  4CDD B;  3N3G A;  1M6D A;  3KX1 A;  1TLO A;  8PCH A;  1PPP A;  2E03 A;  4WA6 A;  3PBH A;  3ZNH A;  2E01 A;  3D6S A;  1KXR A;  1AU2 A;  1PCI A;  3BOW A;  1FH0 A;  3PHU A;  1NB3 A;  5KO3 A;  4MM3 B;  3C0R A;  1EWP A;  3MHH A;  2ATO A;  3P5X A;  2YJC A;  3O65 A;  3MTV A;  3F75 A;  4ZTB A;  3WXE A;  2DZY A;  3PW3 A;  4W5C A;  4YVA A;  2FUD A;  4X6J A;  3H89 A;  3PSE A;  3RNV A;  2O6X A;  1BGO A;  4RNA A;  1EF7 A;  3QT4 A;  1QDQ A;  2DCC A;  3K8U A;  2YJ8 A;  2DC6 A;  3S3Q A;  1MDW A;  2VHS A;  3DF0 A;  2GFO A;  9PAP A;  3KW9 A;  5FPW A;  4RKX A;  3RVW A;  3V6C A;  1X9Y A;  4N4Z A;  1BY8 A;  4XZX A;  2R9C A;  2B1M A;  1AU0 A;  1PPN A;  3CBJ A;  3PRM A;  1CJL A;  5CVM A;  2F1G A;  1EWO A;  4DMX A;  3IV2 A;  1NPZ A;  2F7D A;  1F2C A;  2FE8 A;  4BOP A;  2XU4 A;  3MJ5 A;  4CZW A;  1EWM A;  2E00 A;  3PRP A;  4WUR A;  1GEC E;  5J94 A;  4BS6 A;  1XKG A;  2R9N A;  4AXL A;  2CB5 A;  4RF0 A;  3MOR A;  1NLJ A;  1F2A A;  1U9V A;  1CV8 A;  2HHN A;  3TMP A;  2AS8 A;  3KFQ A;  1YK8 A;  3OF9 A;  2DC9 A;  2BU3 A;  3H7D A;  2YJB A;  2AGA A;  2BTW A;  4OEM A;  1YAL A;  1GMY A;  2FTD A;  3HD3 A;  3O0U A;  2JTC A;  4CDE B;  1KHQ A;  1QOL A;  4PAD A;  3QSD A;  3PHX A;  4G54 A;  4I07 A;  4P6E A;  3M99 A;  2R9O A;  1POP A;  3HWN A;  5EZQ A;  1YT7 A;  3HHI A;  1ICF A;  2AIM A;  1EWL A;  4HXD B;  4DMY A;  1IWD A;  2DZZ A;  4Q8G A;  1JQP A;  1GLO A;  2XU5 A;  2J7Q A;  3PHW A; 
#chains in the Genus database with same CATH homology
 4RNA A;  4BOU A;  4R3D A;  3OQC A;  4OVZ A;  2BTW B;  4M0W A;  4D8I A;  4RKX A;  3W30 A;  4IP3 A;  3BBA A;  3B21 A;  5E6J A;  4XZX A;  3PRM A;  2Z84 A;  4P16 A;  2UZJ A;  4RF1 A;  4BOS A;  2FE8 A;  4BOP A;  3MJ5 A;  4D8E A;  3PRP A;  4WUR A;  4IUM A;  4OVZ B;  5JZE A;  3BY4 A;  4BOZ A;  4GUA A;  4RF0 A;  1DKI A;  4BOQ A;  4PT5 A;  3TRK A;  3TMP A;  2BU3 A;  2AGA A;  2BTW A;  3IFU A;  2J7Q C;  2JRI A;  3E9S A;  3BB7 A;  3MP2 A;  1YZB A;  4D8B A;  2JTC A;  4A5U A;  2HWK A;  3ZNH A;  3PHX A;  3PHU A;  5KO3 A;  4MM3 B;  5EZS A;  3C0R A;  4REZ A;  3O65 A;  3MTV A;  4OW0 A;  3PT2 A;  4ZTB A;  5EZQ A;  4MI7 A;  1UKF A;  4HXD B;  2DOS A;  3PSE A;  1PVJ A;  3RNV A;  3W31 A;  2J7Q A;  3PHW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...