4XZXA

Shigella flexneri effector ospi c62s mutant
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
192
structure length
192
Chain Sequence
NVNVKKLLESLNSKSLGDMDKDSELAATLQKMINPSGGDGNSSGCALHACMAMLGYGVREAPVPNEISEYMTGFFHRHLEQIDSEGIVSHPNETYSKFRERIAENILQNTSKGSVVMISIEQATHWIAGFNDGEKIMFLDVQTGKGFNLYDPVEKSPDAFVDENSSVQVIHVSDQEFDHYANSSSWKSKRLC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ORF169b
publication title New insights into the active site structure of Shigella effecter OspI
rcsb
source organism Shigella flexneri
molecule tags Immune system
total genus 59
structure length 192
sequence length 192
ec nomenclature
pdb deposition date 2015-02-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.140 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 4xzxA00
3W30A 4IP3A 3W31A 4XZXA 3B21A
chains in the Genus database with same CATH superfamily
3F5VA 5A24A 2E02A 1THEA 4BOSA 4BOPA 4ZTBA 1BY8A 3MHHA 4YYUA 1PCIA 2DZZA 2YJBA 4MZSA 4YYWA 1PPPA 2FYEA 4IUMA 5JH3A 1TU6A 4BQVA 5CHTA 3M99A 1ICFA 1ATKA 3BWKA 1AYVA 2HXZA 1SNKA 3USVA 2GFOA 3E1ZB 3KW9A 4PP1A 3B21A 4QRXA 1AYWA 4W5BA 1EWMA 2AIMA 1Y4HA 4YYSA 2HD5A 2OULA 1MIRA 2XU3A 3KSEA 2DCBA 1PVJA 3IOQA 2DC8A 2DJFB 4P6EA 4BPVA 2FTDA 4X6HA 2DCAA 3N3GA 2R6NA 4XR7A 4QH6A 4RF0A 4PP2E 4RY2A 5KO3A 1PE6A 4CDFB 3NHEA 2XU5A 4MZOA 3LXSA 3P5WA 2G8EA 1QDQA 2DCCA 2JRIA 1VSNA 1JQPA 2NQGA 1Q6KA 2PNSA 3KWZA 3PDFA 4CDEB 1QOLA 3QSDA 3KFQA 2AYNA 3BOWA 4RNAA 3H89A 5FPWA 2P7UA 2J7QA 2P0RA 1YK7A 5CVOB 3RVXA 1M6DA 3ERVA 2YJCA 1ZCMA 1AYUA 2FRQA 4W5CA 2ATOA 4G54A 3IHPA 2E03A 2HWKA 1POPA 3OQCA 1YZBA 1YALA 2BU3A 1PIPA 3CBJA 1YK8A 2FRAA 2NQAA 3P5VA 3KKUA 1AU2A 2JQGR 2CIOA 3PBHA 4M0WA 2JTCA 4YYQA 1PPDA 4OVZA 4R3DA 1U9XA 3KWBX 2AVWA 3MHSA 4XUIA 1CV8A 1KHPA 5CVMA 1NB3A 4RF1A 3CH3X 1QMYA 2HH5A 3B79A 1NPZA 3C9EA 3GCBA 4FIPA 4X6IA 3TNXA 2YJ2A 1ITOA 1KFXL 4P6GA 3WXEA 1BGOA 1ME3A 1A6RA 1PADA 2B1NA 4I05A 5CHVA 1STFE 2FO5A 1DKIA 5F02A 2NQDB 4D8IA 4I04A 3V6CA 1NB5A 1PPOA 1XKGA 4REZA 3KX1A 1NLJA 4BOUA 1CPJA 3O1GA 1MDWA 1PPNA 1IWDA 2OZ2A 3IV2A 4W4UA 5K16A 4MSXA 2PBHA 1MS6A 1GCBA 5EF4A 1NQCA 2BDZA 2G8JA 3BY4A 2BTWA 3I06A 4A5UA 2R9NA 3IFUA 1AU3A 2Y6EA 1HUCB 1NL6A 2E00A 1PXVA 3IMAA 1BQIA 2FQ9A 1K3BB 2DC9A 3K24A 2XU1A 3OF9A 3P5XA 4PI3A 2FE8A 3BCNA 5PADA 3HHAA 2VHFA 3BB7A 4GUAA 3O65A 4OEMA 1FH0A 1CSBB 2FT2A 2UZJA 3H7DA 3MP2A 2B1MA 4PADA 1U9QX 1AU0A 2DC6A 3ZUAA 2JQFR 4QBBA 1MHWA 3U8EA 3MORA 4AXLA 2FUDA 2AUXA 3WXFA 1CS8A 2F7DA 2AS8A 3BBAA 3BC3A 3ZNHA 1ZIVA 4OVZB 4BS5A 1YVBA 3I3TA 2GHUA 3RVWA 1CTEA 3IUTA 4DMYA 3PNRA 1EWLA 4D8BA 1EWPA 1AECA 2YJ8A 3IEJA 8PCHA 2Y5BA 5EZSA 1DEUA 1DF0A 1F2BA 9PAPA 4K7CA 2WBFX 1GMYA 3P5UA 2R9OA 1CJLA 2ARYA 1X9YA 3PHWA 4IP3A 5JZEA 2ACTA 3S3RA 5JA7A 2CB5A 1KXRA 1YT7A 1MEMA 3O0UA 4KLBA 2YJ9A 3MTVA 2R9CA 3DF0A 2P86A 2IBIA 2DOSA 2DZYA 3BPFA 4D8EA 2J7QC 1U5IA 4BOQA 3MJ5A 4Q8GA 5E6JA 2XU4A 4XZXA 4I07A 1Y08A 2VHSA 1PBHA 4CDDB 2IPPB 4HWYA 4MM3B 3K9MA 3PRPA 3PRMA 2BTWB 1O0EA 2R9FA 1VJVA 3HHIA 1MEGA 3CBKA 1U9WA 3N3KA 2AUZA 2PADA 4PT5A 3W31A 3PHXA 2AU1A 1F2CA 3LFYA 2OP3A 3D6SA 1F29A 3OF8A 4HXDB 1KHQA 5EGWA 1S4VA 3TRKA 1QXPA 4YYRA 3TMPA 2F1GA 2H7JA 2BDLA 3PW3A 2O6XA 3BPMA 5J94A 3HWNA 3HD3A 3AI8A 3PHUA 2DJGB 3RVVA 1U9VA 3WXGA 4P16A 2Z84A 3W30A 3OVZA 1CQDA 4OW0A 4ZUXU 3CH2X 3MTNA 5EZQA 1TL9A 4Q8HA 4BSQA 4YYVA 5CVNB 1EWOA 1CB5A 3F75A 4N4ZA 3S3QA 2HHNA 4QRGA 1CVZA 7PCKA 4BOZA 4BS6A 3H8BA 2DC7A 2C0YA 1AIMA 3PT2A 1F2AA 4WURA 4YV8A 2AGAA 1BP4A 2E01A 3C0RA 6PADA 3H8CA 4DMXA 3RNVA 4OELA 2G7YA 1ME4A 4RKXA 3OISA 3QJ3A 2NQIA 3E9SA 4AXMA 1GLOA 2AYOA 1UKFA 2G6DA 4FJCA 4CZWA 4MI7A 2PREA 2DCDA 3OVXA 3H6SA 4X6JA 1KFUL 4FK5A 3V6EA 3N4CA 2R9MA 3QT4A 4N8WA 4CDCB 3K8UA 4N79A 1GECE 3PSEA 4YVAA 1AU4A 1TLOA 4QRVA 4WA6A 1EF7A 1SP4B
chains in the Genus database with same CATH topology
4PT5A 2FE8A 3W31A 3PHXA 4BOSA 2HWKA 4BOPA 4ZTBA 4GUAA 3BB7A 4HXDB 3OQCA 3O65A 1YZBA 2BU3A 3TRKA 4IUMA 3TMPA 2UZJA 3MP2A 4M0WA 3PHUA 2JTCA 3B21A 4OVZA 3BBAA 4P16A 4R3DA 2Z84A 3ZNHA 3W30A 4OVZB 4OW0A 5EZQA 4D8BA 4RF1A 1PVJA 5EZSA 4BOZA 3PT2A 3PHWA 4IP3A 5JZEA 4WURA 2AGAA 4RF0A 3C0RA 1DKIA 4D8IA 5KO3A 3RNVA 3MTVA 4REZA 2DOSA 4BOUA 4RKXA 4D8EA 2J7QC 3E9SA 2JRIA 4BOQA 3MJ5A 5E6JA 4XZXA 1UKFA 3BY4A 4MM3B 3PRPA 4MI7A 2BTWA 3PRMA 4A5UA 4RNAA 3IFUA 2BTWB 2J7QA 3PSEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3W30 A;  4IP3 A;  3W31 A;  4XZX A;  3B21 A; 
#chains in the Genus database with same CATH topology
 3F5V A;  5A24 A;  2E02 A;  1THE A;  4BOS A;  4BOP A;  4ZTB A;  1BY8 A;  3MHH A;  4YYU A;  1PCI A;  2DZZ A;  2YJB A;  4MZS A;  4YYW A;  1PPP A;  2FYE A;  4IUM A;  5JH3 A;  1TU6 A;  4BQV A;  5CHT A;  3M99 A;  1ICF A;  1ATK A;  3BWK A;  1AYV A;  2HXZ A;  1SNK A;  3USV A;  2GFO A;  3E1Z B;  3KW9 A;  4PP1 A;  3B21 A;  4QRX A;  1AYW A;  4W5B A;  1EWM A;  2AIM A;  1Y4H A;  4YYS A;  2HD5 A;  2OUL A;  1MIR A;  2XU3 A;  3KSE A;  2DCB A;  1PVJ A;  3IOQ A;  2DC8 A;  2DJF B;  4P6E A;  4BPV A;  2FTD A;  4X6H A;  2DCA A;  3N3G A;  2R6N A;  4XR7 A;  4QH6 A;  4RF0 A;  4PP2 E;  4RY2 A;  5KO3 A;  1PE6 A;  4CDF B;  3NHE A;  2XU5 A;  4MZO A;  3LXS A;  3P5W A;  2G8E A;  1QDQ A;  2DCC A;  2JRI A;  1VSN A;  1JQP A;  2NQG A;  1Q6K A;  2PNS A;  3KWZ A;  3PDF A;  4CDE B;  1QOL A;  3QSD A;  3KFQ A;  2AYN A;  3BOW A;  4RNA A;  3H89 A;  5FPW A;  2P7U A;  2J7Q A;  2P0R A;  1YK7 A;  5CVO B;  3RVX A;  1M6D A;  3ERV A;  2YJC A;  1ZCM A;  1AYU A;  2FRQ A;  4W5C A;  2ATO A;  4G54 A;  3IHP A;  2E03 A;  2HWK A;  1POP A;  3OQC A;  1YZB A;  1YAL A;  2BU3 A;  1PIP A;  3CBJ A;  1YK8 A;  2FRA A;  2NQA A;  3P5V A;  3KKU A;  1AU2 A;  2JQG R;  2CIO A;  3PBH A;  4M0W A;  2JTC A;  4YYQ A;  1PPD A;  4OVZ A;  4R3D A;  1U9X A;  3KWB X;  2AVW A;  3MHS A;  4XUI A;  1CV8 A;  1KHP A;  5CVM A;  1NB3 A;  4RF1 A;  3CH3 X;  1QMY A;  2HH5 A;  3B79 A;  1NPZ A;  3C9E A;  3GCB A;  4FIP A;  4X6I A;  3TNX A;  2YJ2 A;  1ITO A;  1KFX L;  4P6G A;  3WXE A;  1BGO A;  1ME3 A;  1A6R A;  1PAD A;  2B1N A;  4I05 A;  5CHV A;  1STF E;  2FO5 A;  1DKI A;  5F02 A;  2NQD B;  4D8I A;  4I04 A;  3V6C A;  1NB5 A;  1PPO A;  1XKG A;  4REZ A;  3KX1 A;  1NLJ A;  4BOU A;  1CPJ A;  3O1G A;  1MDW A;  1PPN A;  1IWD A;  2OZ2 A;  3IV2 A;  4W4U A;  5K16 A;  4MSX A;  2PBH A;  1MS6 A;  1GCB A;  5EF4 A;  1NQC A;  2BDZ A;  2G8J A;  3BY4 A;  2BTW A;  3I06 A;  4A5U A;  2R9N A;  3IFU A;  1AU3 A;  2Y6E A;  1HUC B;  1NL6 A;  2E00 A;  1PXV A;  3IMA A;  1BQI A;  2FQ9 A;  1K3B B;  2DC9 A;  3K24 A;  2XU1 A;  3OF9 A;  3P5X A;  4PI3 A;  2FE8 A;  3BCN A;  5PAD A;  3HHA A;  2VHF A;  3BB7 A;  4GUA A;  3O65 A;  4OEM A;  1FH0 A;  1CSB B;  2FT2 A;  2UZJ A;  3H7D A;  3MP2 A;  2B1M A;  4PAD A;  1U9Q X;  1AU0 A;  2DC6 A;  3ZUA A;  2JQF R;  4QBB A;  1MHW A;  3U8E A;  3MOR A;  4AXL A;  2FUD A;  2AUX A;  3WXF A;  1CS8 A;  2F7D A;  2AS8 A;  3BBA A;  3BC3 A;  3ZNH A;  1ZIV A;  4OVZ B;  4BS5 A;  1YVB A;  3I3T A;  2GHU A;  3RVW A;  1CTE A;  3IUT A;  4DMY A;  3PNR A;  1EWL A;  4D8B A;  1EWP A;  1AEC A;  2YJ8 A;  3IEJ A;  8PCH A;  2Y5B A;  5EZS A;  1DEU A;  1DF0 A;  1F2B A;  9PAP A;  4K7C A;  2WBF X;  1GMY A;  3P5U A;  2R9O A;  1CJL A;  2ARY A;  1X9Y A;  3PHW A;  4IP3 A;  5JZE A;  2ACT A;  3S3R A;  5JA7 A;  2CB5 A;  1KXR A;  1YT7 A;  1MEM A;  3O0U A;  4KLB A;  2YJ9 A;  3MTV A;  2R9C A;  3DF0 A;  2P86 A;  2IBI A;  2DOS A;  2DZY A;  3BPF A;  4D8E A;  2J7Q C;  1U5I A;  4BOQ A;  3MJ5 A;  4Q8G A;  5E6J A;  2XU4 A;  4XZX A;  4I07 A;  1Y08 A;  2VHS A;  1PBH A;  4CDD B;  2IPP B;  4HWY A;  4MM3 B;  3K9M A;  3PRP A;  3PRM A;  2BTW B;  1O0E A;  2R9F A;  1VJV A;  3HHI A;  1MEG A;  3CBK A;  1U9W A;  3N3K A;  2AUZ A;  2PAD A;  4PT5 A;  3W31 A;  3PHX A;  2AU1 A;  1F2C A;  3LFY A;  2OP3 A;  3D6S A;  1F29 A;  3OF8 A;  4HXD B;  1KHQ A;  5EGW A;  1S4V A;  3TRK A;  1QXP A;  4YYR A;  3TMP A;  2F1G A;  2H7J A;  2BDL A;  3PW3 A;  2O6X A;  3BPM A;  5J94 A;  3HWN A;  3HD3 A;  3AI8 A;  3PHU A;  2DJG B;  3RVV A;  1U9V A;  3WXG A;  4P16 A;  2Z84 A;  3W30 A;  3OVZ A;  1CQD A;  4OW0 A;  4ZUX U;  3CH2 X;  3MTN A;  5EZQ A;  1TL9 A;  4Q8H A;  4BSQ A;  4YYV A;  5CVN B;  1EWO A;  1CB5 A;  3F75 A;  4N4Z A;  3S3Q A;  2HHN A;  4QRG A;  1CVZ A;  7PCK A;  4BOZ A;  4BS6 A;  3H8B A;  2DC7 A;  2C0Y A;  1AIM A;  3PT2 A;  1F2A A;  4WUR A;  4YV8 A;  2AGA A;  1BP4 A;  2E01 A;  3C0R A;  6PAD A;  3H8C A;  4DMX A;  3RNV A;  4OEL A;  2G7Y A;  1ME4 A;  4RKX A;  3OIS A;  3QJ3 A;  2NQI A;  3E9S A;  4AXM A;  1GLO A;  2AYO A;  1UKF A;  2G6D A;  4FJC A;  4CZW A;  4MI7 A;  2PRE A;  2DCD A;  3OVX A;  3H6S A;  4X6J A;  1KFU L;  4FK5 A;  3V6E A;  3N4C A;  2R9M A;  3QT4 A;  4N8W A;  4CDC B;  3K8U A;  4N79 A;  1GEC E;  3PSE A;  4YVA A;  1AU4 A;  1TLO A;  4QRV A;  4WA6 A;  1EF7 A;  1SP4 B; 
#chains in the Genus database with same CATH homology
 4PT5 A;  2FE8 A;  3W31 A;  3PHX A;  4BOS A;  2HWK A;  4BOP A;  4ZTB A;  4GUA A;  3BB7 A;  4HXD B;  3OQC A;  3O65 A;  1YZB A;  2BU3 A;  3TRK A;  4IUM A;  3TMP A;  2UZJ A;  3MP2 A;  4M0W A;  3PHU A;  2JTC A;  3B21 A;  4OVZ A;  3BBA A;  4P16 A;  4R3D A;  2Z84 A;  3ZNH A;  3W30 A;  4OVZ B;  4OW0 A;  5EZQ A;  4D8B A;  4RF1 A;  1PVJ A;  5EZS A;  4BOZ A;  3PT2 A;  3PHW A;  4IP3 A;  5JZE A;  4WUR A;  2AGA A;  4RF0 A;  3C0R A;  1DKI A;  4D8I A;  5KO3 A;  3RNV A;  3MTV A;  4REZ A;  2DOS A;  4BOU A;  4RKX A;  4D8E A;  2J7Q C;  3E9S A;  2JRI A;  4BOQ A;  3MJ5 A;  5E6J A;  4XZX A;  1UKF A;  3BY4 A;  4MM3 B;  3PRP A;  4MI7 A;  2BTW A;  3PRM A;  4A5U A;  4RNA A;  3IFU A;  2BTW B;  2J7Q A;  3PSE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...