2XU5A

Cathepsin l with a nitrile inhibitor
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
220
structure length
216
Chain Sequence
APRSVDWREKGYVTPVKNQGQCGSCWAFSATGALEGQMFRKTGRLISLSEQNLVDCSGPQGNEGCNGGLMDYAFQYVQDNGGLDSEESYPYEATEESCKYNPKYSVANDTGFVDIPKQEKALMKAVATVGPISVAIDAGHESFLFYKEGIYFEPDCSSEDMDHGVLVVGYGFEDNNKYWLVKNSWGEEWGMGGYVKMAKDRRNHCGIASAASYPTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CATHEPSIN L1
publication title Systematic Investigation of Halogen Bonding in Protein-Ligand Interactions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 67
structure length 216
sequence length 220
ec nomenclature ec 3.4.22.15: Cathepsin L.
pdb deposition date 2010-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2xu5A00
1NB5A 4AXLA 1MDWA 1AECA 2FT2A 3BCNA 2ACTA 4W4UA 3WXGA 3MORA 4X6HA 1PPOA 4I04A 3V6EA 1CS8A 3P5WA 4PADA 1TLOA 1TL9A 4X6IA 2DCBA 4KLBA 4YYQA 2P86A 2FRQA 1Y08A 4HWYA 4G54A 1PPPA 3P5VA 4RY2A 2YJBA 2PBHA 4BS6A 2DCAA 1U5IA 1ITOA 2ARYA 1F2BA 3LXSA 5CVOB 3KSEA 3OF8A 1Y4HA 2AIMA 5FPWA 2PREA 2F1GA 1GECE 2DCCA 4PP1A 2Y5BA 4BPVA 4MZOA 3PW3A 3KFQA 3RVXA 3IV2A 1PXVA 1YALA 3QT4A 1KXRA 4YV8A 3QSDA 2CIOA 2E00A 3E1ZB 2HHNA 4CDCB 2G7YA 3QJ3A 1ME4A 4FIPA 3BWKA 1AU2A 1NPZA 4CDFB 1PBHA 3D6SA 2C0YA 2DZYA 2OULA 1ZIVA 5A24A 2WBFX 1YVBA 3IEJA 2AVWA 2DC8A 3CBKA 1QOLA 4YYSA 4P6EA 1NLJA 2DC7A 1CB5A 2XU3A 3KWBX 3N4CA 7PCKA 1U9WA 3OVXA 2HD5A 2DJFB 4N4ZA 1PPDA 6PADA 2FRAA 3K8UA 2XU1A 1BY8A 3B79A 3M99A 4Q8HA 3LFYA 1A6RA 3V6CA 2FUDA 3HHAA 2E01A 5K16A 3BC3A 1MIRA 3MTNA 2HXZA 1QMYA 2R9FA 2NQIA 3IMAA 1PCIA 3NHEA 3OVZA 3CH3X 1PE6A 2F7DA 1MEMA 3KX1A 1NQCA 1EWPA 3USVA 4K7CA 4BS5A 2XU5A 1AU3A 2AUZA 1THEA 1U9VA 4XUIA 4QRVA 3ZUAA 2NQGA 2AS8A 1ZCMA 1BQIA 1YK8A 2R9NA 3MHHA 2FQ9A 1KFXL 2IBIA 4PI3A 2IPPB 3N3KA 2G8EA 3KKUA 1GMYA 1CSBB 3PBHA 1X9YA 5CHTA 2G8JA 4N8WA 1YK7A 2GFOA 2DJGB 1PPNA 2DCDA 3S3RA 1ICFA 8PCHA 3HHIA 3TNXA 2FYEA 2AYOA 2FTDA 3CBJA 1NL6A 1AYUA 2DC6A 2O6XA 1S4VA 1BP4A 3DF0A 1CTEA 1POPA 2Y6EA 3HWNA 4DMXA 4YYUA 3H89A 1NB3A 3ERVA 3MHSA 1SP4B 1CJLA 4QBBA 1PADA 4XR7A 2R6NA 3K9MA 3S3QA 2YJCA 1GLOA 3C9EA 1M6DA 4I07A 1EWOA 2FO5A 2P7UA 3P5XA 3O0UA 4OELA 3IOQA 4YYWA 2YJ2A 1VSNA 2H7JA 2PADA 4W5CA 2DC9A 3P5UA 3WXEA 3IHPA 4PP2E 1O0EA 5PADA 4YYVA 2OP3A 3F5VA 1DF0A 2JQFR 1QDQA 1AYWA 2VHFA 4QH6A 1TU6A 2B1NA 2E02A 1FH0A 1QXPA 1DEUA 1AYVA 3F75A 5EGWA 2AUXA 3KWZA 5JA7A 2BDLA 2E03A 3U8EA 1KHQA 5JH3A 3H8BA 1PIPA 4N79A 2AU1A 3K24A 1KFUL 1K3BB 4WA6A 3WXFA 2YJ9A 1MS6A 3I06A 2R9OA 1EWLA 4MSXA 3BPFA 2CB5A 2R9MA 3I3TA 3H8CA 1JQPA 4I05A 1AU4A 2AYNA 4YVAA 1MEGA 2DZZA 1AIMA 9PAPA 3N3GA 3IUTA 3KW9A 4OEMA 1VJVA 3BPMA 5CVNB 3PDFA 3O1GA 4W5BA 5J94A 3H7DA 3HD3A 1YT7A 4X6JA 1IWDA 4QRGA 1SNKA 3OF9A 2R9CA 2NQAA 1STFE 3RVWA 2OZ2A 2B1MA 4BSQA 2XU4A 1ME3A 4MZSA 2HH5A 1MHWA 1CVZA 1BGOA 4CDEB 2VHSA 1HUCB 5EF4A 4Q8GA 2BDZA 1F29A 1CQDA 3CH2X 4FJCA 1CV8A 1F2CA 4ZUXU 4P6GA 4DMYA 1EWMA 2PNSA 2GHUA 2JQGR 4CDDB 5F02A 3AI8A 4AXMA 1KHPA 2ATOA 5CVMA 3RVVA 3H6SA 3OISA 1U9QX 2G6DA 2NQDB 4FK5A 1CPJA 1Q6KA 4YYRA 5CHVA 2P0RA 1XKGA 3PNRA 4QRXA 1EF7A 4CZWA 1U9XA 1GCBA 2YJ8A 3GCBA 4BQVA 1ATKA 1AU0A 3BOWA 1F2AA
chains in the Genus database with same CATH superfamily
1NB5A 4AXLA 4XZXA 1MDWA 4HXDB 1AECA 2FT2A 3BCNA 2ACTA 4W4UA 4RNAA 3WXGA 3MORA 4X6HA 1PPOA 4I04A 3V6EA 3TMPA 1CS8A 3P5WA 4PADA 1TLOA 1TL9A 4X6IA 3MP2A 2DCBA 4KLBA 4YYQA 4ZTBA 2P86A 2FRQA 1Y08A 4HWYA 4G54A 1PPPA 3P5VA 4RY2A 2YJBA 2PBHA 4BS6A 2DCAA 1U5IA 1ITOA 3PT2A 2ARYA 1F2BA 3LXSA 5CVOB 4OW0A 3KSEA 3OQCA 3OF8A 1Y4HA 2AIMA 5FPWA 4BOQA 2PREA 2F1GA 1GECE 2DCCA 4PP1A 4RKXA 2Y5BA 4BPVA 4MZOA 3PW3A 3KFQA 4BOZA 4OVZA 3RVXA 3IV2A 1PXVA 1YALA 3QT4A 1KXRA 4YV8A 3PRMA 3QSDA 2CIOA 2E00A 3E1ZB 2HHNA 4CDCB 2G7YA 3QJ3A 1ME4A 4FIPA 3BWKA 1AU2A 1NPZA 4CDFB 1PBHA 3D6SA 2C0YA 2DZYA 2OULA 4D8BA 1ZIVA 5A24A 2WBFX 1YVBA 3IEJA 2AVWA 2DC8A 3PRPA 3CBKA 1QOLA 4YYSA 4P6EA 1NLJA 2DC7A 1CB5A 2XU3A 3KWBX 3N4CA 7PCKA 1U9WA 3OVXA 2HWKA 5E6JA 2HD5A 2DJFB 4N4ZA 1PPDA 1UKFA 3MTVA 6PADA 2FRAA 3K8UA 2XU1A 1BY8A 1DKIA 3B79A 3M99A 4Q8HA 3LFYA 3BBAA 1A6RA 3B21A 3V6CA 2FUDA 4D8IA 3HHAA 2E01A 5K16A 3BC3A 3PHWA 1MIRA 3PSEA 3MTNA 2HXZA 1QMYA 2R9FA 3MJ5A 2NQIA 3IMAA 2BTWA 1PCIA 3NHEA 3OVZA 3CH3X 1PE6A 2F7DA 1MEMA 3KX1A 2Z84A 1NQCA 3W31A 2BU3A 3W30A 1EWPA 3USVA 4K7CA 4BS5A 4D8EA 2XU5A 1PVJA 1AU3A 2AUZA 1THEA 1U9VA 4XUIA 4QRVA 3ZUAA 2NQGA 2BTWB 2JTCA 4IUMA 2AS8A 1ZCMA 2UZJA 1BQIA 1YK8A 2R9NA 3MHHA 2FQ9A 3ZNHA 1KFXL 2IBIA 4PI3A 2IPPB 3N3KA 2G8EA 3KKUA 1GMYA 1CSBB 3PBHA 1X9YA 5CHTA 2G8JA 4N8WA 1YK7A 2GFOA 4PT5A 2DJGB 1PPNA 2DCDA 3S3RA 1ICFA 8PCHA 3HHIA 3TNXA 2FYEA 2AYOA 2FTDA 3CBJA 4IP3A 1NL6A 1AYUA 2FE8A 2DC6A 2O6XA 1S4VA 1BP4A 3DF0A 1CTEA 3O65A 1POPA 2Y6EA 3HWNA 4DMXA 4YYUA 3H89A 1NB3A 4R3DA 3ERVA 4MM3B 3MHSA 1SP4B 1CJLA 4QBBA 1PADA 4OVZB 4XR7A 3RNVA 2R6NA 3K9MA 3S3QA 4BOUA 2YJCA 1GLOA 4P16A 3C9EA 1M6DA 4I07A 1EWOA 2FO5A 2P7UA 3P5XA 2JRIA 3O0UA 4OELA 3IOQA 4YYWA 2YJ2A 1VSNA 2H7JA 2PADA 4W5CA 2DC9A 3P5UA 3WXEA 3IHPA 4PP2E 1O0EA 5PADA 4YYVA 2OP3A 3F5VA 1DF0A 2J7QA 4MI7A 4REZA 3TRKA 2JQFR 4BOSA 1QDQA 1AYWA 2J7QC 4A5UA 4RF0A 3C0RA 2VHFA 4QH6A 1TU6A 2AGAA 2B1NA 2E02A 1FH0A 1QXPA 1DEUA 1AYVA 3F75A 5EGWA 2AUXA 3KWZA 5JA7A 2BDLA 2E03A 3U8EA 1KHQA 4GUAA 5JH3A 3H8BA 4M0WA 1PIPA 4N79A 2AU1A 5EZQA 1YZBA 3K24A 1KFUL 1K3BB 4WA6A 3WXFA 2YJ9A 1MS6A 3I06A 2R9OA 1EWLA 4MSXA 3BPFA 2CB5A 2R9MA 3I3TA 3H8CA 1JQPA 4I05A 1AU4A 5KO3A 2AYNA 4YVAA 1MEGA 2DZZA 1AIMA 9PAPA 3BB7A 3N3GA 3PHXA 3IUTA 3KW9A 5EZSA 5JZEA 4RF1A 4BOPA 4OEMA 1VJVA 3BPMA 5CVNB 3PDFA 3O1GA 4W5BA 5J94A 3H7DA 3HD3A 1YT7A 4X6JA 1IWDA 4QRGA 1SNKA 3OF9A 2R9CA 2NQAA 1STFE 3RVWA 2OZ2A 2B1MA 4BSQA 2XU4A 1ME3A 4MZSA 2HH5A 1MHWA 1CVZA 1BGOA 4CDEB 2VHSA 1HUCB 4WURA 5EF4A 4Q8GA 2BDZA 1F29A 1CQDA 3CH2X 4FJCA 1CV8A 1F2CA 4ZUXU 4P6GA 4DMYA 1EWMA 2PNSA 2GHUA 2JQGR 4CDDB 5F02A 3AI8A 4AXMA 1KHPA 2ATOA 5CVMA 2DOSA 3RVVA 3H6SA 3OISA 1U9QX 3E9SA 2G6DA 2NQDB 4FK5A 1CPJA 1Q6KA 4YYRA 5CHVA 2P0RA 1XKGA 3BY4A 3IFUA 3PNRA 4QRXA 1EF7A 4CZWA 1U9XA 1GCBA 3PHUA 2YJ8A 3GCBA 4BQVA 1ATKA 1AU0A 3BOWA 1F2AA
chains in the Genus database with same CATH topology
1NB5A 4AXLA 1MDWA 1AECA 2FT2A 3BCNA 2ACTA 4W4UA 3WXGA 3MORA 4X6HA 1PPOA 4I04A 3V6EA 1CS8A 3P5WA 4PADA 1TLOA 1TL9A 4X6IA 2DCBA 4KLBA 4YYQA 2VFBA 2P86A 2FRQA 1Y08A 4HWYA 4G54A 1PPPA 3P5VA 4RY2A 2YJBA 2PBHA 4BS6A 2DCAA 2VFCA 1U5IA 1ITOA 2ARYA 1F2BA 3LXSA 5CVOB 3KSEA 3OF8A 1Y4HA 2AIMA 5FPWA 2PREA 2F1GA 1GECE 2DCCA 4PP1A 2Y5BA 4BPVA 4MZOA 3PW3A 3KFQA 3RVXA 3IV2A 1PXVA 1YALA 3QT4A 1KXRA 4YV8A 3QSDA 2CIOA 2E00A 3E1ZB 2HHNA 4CDCB 2G7YA 3QJ3A 1ME4A 4FIPA 3BWKA 1AU2A 1NPZA 4CDFB 1PBHA 3D6SA 2C0YA 2DZYA 2OULA 1ZIVA 5A24A 2WBFX 1YVBA 3IEJA 2AVWA 2DC8A 3CBKA 1QOLA 4YYSA 4P6EA 1NLJA 2DC7A 1CB5A 2XU3A 3KWBX 3N4CA 7PCKA 1U9WA 3OVXA 2HD5A 2DJFB 4N4ZA 1PPDA 6PADA 2FRAA 3K8UA 2XU1A 1W6FA 1BY8A 3B79A 3M99A 1W4TA 4Q8HA 3LFYA 1A6RA 3V6CA 2FUDA 3HHAA 2E01A 5K16A 3BC3A 1MIRA 3MTNA 2HXZA 1QMYA 2R9FA 2NQIA 3IMAA 1PCIA 3NHEA 3OVZA 3CH3X 1PE6A 2F7DA 1MEMA 4NV8A 3KX1A 1NQCA 1EWPA 3USVA 4K7CA 4BS5A 2XU5A 1AU3A 2AUZA 1THEA 1U9VA 4XUIA 4QRVA 3ZUAA 2NQGA 2AS8A 1ZCMA 1BQIA 1YK8A 2R9NA 3MHHA 2FQ9A 1KFXL 2IBIA 4PI3A 2IPPB 3N3KA 2G8EA 3KKUA 1GMYA 1CSBB 3PBHA 1X9YA 5CHTA 2G8JA 4N8WA 1YK7A 2GFOA 2DJGB 1PPNA 2DCDA 3S3RA 1ICFA 8PCHA 3HHIA 3TNXA 2FYEA 2AYOA 2FTDA 3CBJA 1NL6A 1AYUA 2DC6A 2O6XA 1S4VA 1BP4A 3DF0A 1CTEA 1POPA 2Y6EA 3HWNA 4DMXA 3D9WA 4YYUA 3H89A 1NB3A 3ERVA 3MHSA 1SP4B 1CJLA 4QBBA 1PADA 4C5PA 4XR7A 2R6NA 3K9MA 3S3QA 2YJCA 1GLOA 3C9EA 1M6DA 4I07A 1EWOA 2FO5A 2P7UA 3P5XA 3O0UA 4B55A 4OELA 3IOQA 4YYWA 2YJ2A 1VSNA 2H7JA 2PADA 4W5CA 2DC9A 3P5UA 3WXEA 3IHPA 4PP2E 1O0EA 5PADA 4YYVA 1E2TA 2OP3A 3F5VA 1DF0A 2JQFR 1QDQA 1AYWA 2VHFA 1W5RA 4QH6A 1TU6A 2B1NA 2E02A 1FH0A 1QXPA 1DEUA 1AYVA 3F75A 5EGWA 2AUXA 3KWZA 4GUZA 5JA7A 2BDLA 2E03A 3U8EA 1KHQA 5JH3A 3H8BA 1PIPA 4N79A 2AU1A 2BSZA 3K24A 1KFUL 1K3BB 4WA6A 3WXFA 2YJ9A 1MS6A 3I06A 2R9OA 1EWLA 4MSXA 3BPFA 2CB5A 2R9MA 3I3TA 3H8CA 1JQPA 4I05A 1AU4A 2AYNA 4YVAA 1MEGA 2DZZA 1AIMA 9PAPA 3N3GA 3IUTA 3KW9A 4OEMA 1VJVA 3BPMA 5CVNB 3PDFA 3O1GA 4W5BA 5J94A 3H7DA 3HD3A 1YT7A 4X6JA 1IWDA 4QRGA 1SNKA 3OF9A 2R9CA 2NQAA 1STFE 3RVWA 2OZ2A 2B1MA 4BSQA 2XU4A 1ME3A 4MZSA 2HH5A 1MHWA 1CVZA 1BGOA 4CDEB 2VHSA 1HUCB 5EF4A 4Q8GA 2BDZA 1F29A 1CQDA 3CH2X 4FJCA 1CV8A 1F2CA 4ZUXU 4P6GA 1GX3A 4NV7A 4DMYA 1EWMA 2PNSA 2GHUA 2JQGR 4CDDB 5F02A 3AI8A 4AXMA 1KHPA 2ATOA 5CVMA 3RVVA 3H6SA 3OISA 1U9QX 2G6DA 2NQDB 4FK5A 4BGFA 1CPJA 1Q6KA 4YYRA 5CHVA 2P0RA 1XKGA 3PNRA 4QRXA 1EF7A 3LTWA 4CZWA 1U9XA 1GCBA 2YJ8A 3GCBA 4BQVA 1ATKA 1AU0A 3BOWA 1F2AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NB5 A;  4AXL A;  1MDW A;  1AEC A;  2FT2 A;  3BCN A;  2ACT A;  4W4U A;  3WXG A;  3MOR A;  4X6H A;  1PPO A;  4I04 A;  3V6E A;  1CS8 A;  3P5W A;  4PAD A;  1TLO A;  1TL9 A;  4X6I A;  2DCB A;  4KLB A;  4YYQ A;  2P86 A;  2FRQ A;  1Y08 A;  4HWY A;  4G54 A;  1PPP A;  3P5V A;  4RY2 A;  2YJB A;  2PBH A;  4BS6 A;  2DCA A;  1U5I A;  1ITO A;  2ARY A;  1F2B A;  3LXS A;  5CVO B;  3KSE A;  3OF8 A;  1Y4H A;  2AIM A;  5FPW A;  2PRE A;  2F1G A;  1GEC E;  2DCC A;  4PP1 A;  2Y5B A;  4BPV A;  4MZO A;  3PW3 A;  3KFQ A;  3RVX A;  3IV2 A;  1PXV A;  1YAL A;  3QT4 A;  1KXR A;  4YV8 A;  3QSD A;  2CIO A;  2E00 A;  3E1Z B;  2HHN A;  4CDC B;  2G7Y A;  3QJ3 A;  1ME4 A;  4FIP A;  3BWK A;  1AU2 A;  1NPZ A;  4CDF B;  1PBH A;  3D6S A;  2C0Y A;  2DZY A;  2OUL A;  1ZIV A;  5A24 A;  2WBF X;  1YVB A;  3IEJ A;  2AVW A;  2DC8 A;  3CBK A;  1QOL A;  4YYS A;  4P6E A;  1NLJ A;  2DC7 A;  1CB5 A;  2XU3 A;  3KWB X;  3N4C A;  7PCK A;  1U9W A;  3OVX A;  2HD5 A;  2DJF B;  4N4Z A;  1PPD A;  6PAD A;  2FRA A;  3K8U A;  2XU1 A;  1BY8 A;  3B79 A;  3M99 A;  4Q8H A;  3LFY A;  1A6R A;  3V6C A;  2FUD A;  3HHA A;  2E01 A;  5K16 A;  3BC3 A;  1MIR A;  3MTN A;  2HXZ A;  1QMY A;  2R9F A;  2NQI A;  3IMA A;  1PCI A;  3NHE A;  3OVZ A;  3CH3 X;  1PE6 A;  2F7D A;  1MEM A;  3KX1 A;  1NQC A;  1EWP A;  3USV A;  4K7C A;  4BS5 A;  2XU5 A;  1AU3 A;  2AUZ A;  1THE A;  1U9V A;  4XUI A;  4QRV A;  3ZUA A;  2NQG A;  2AS8 A;  1ZCM A;  1BQI A;  1YK8 A;  2R9N A;  3MHH A;  2FQ9 A;  1KFX L;  2IBI A;  4PI3 A;  2IPP B;  3N3K A;  2G8E A;  3KKU A;  1GMY A;  1CSB B;  3PBH A;  1X9Y A;  5CHT A;  2G8J A;  4N8W A;  1YK7 A;  2GFO A;  2DJG B;  1PPN A;  2DCD A;  3S3R A;  1ICF A;  8PCH A;  3HHI A;  3TNX A;  2FYE A;  2AYO A;  2FTD A;  3CBJ A;  1NL6 A;  1AYU A;  2DC6 A;  2O6X A;  1S4V A;  1BP4 A;  3DF0 A;  1CTE A;  1POP A;  2Y6E A;  3HWN A;  4DMX A;  4YYU A;  3H89 A;  1NB3 A;  3ERV A;  3MHS A;  1SP4 B;  1CJL A;  4QBB A;  1PAD A;  4XR7 A;  2R6N A;  3K9M A;  3S3Q A;  2YJC A;  1GLO A;  3C9E A;  1M6D A;  4I07 A;  1EWO A;  2FO5 A;  2P7U A;  3P5X A;  3O0U A;  4OEL A;  3IOQ A;  4YYW A;  2YJ2 A;  1VSN A;  2H7J A;  2PAD A;  4W5C A;  2DC9 A;  3P5U A;  3WXE A;  3IHP A;  4PP2 E;  1O0E A;  5PAD A;  4YYV A;  2OP3 A;  3F5V A;  1DF0 A;  2JQF R;  1QDQ A;  1AYW A;  2VHF A;  4QH6 A;  1TU6 A;  2B1N A;  2E02 A;  1FH0 A;  1QXP A;  1DEU A;  1AYV A;  3F75 A;  5EGW A;  2AUX A;  3KWZ A;  5JA7 A;  2BDL A;  2E03 A;  3U8E A;  1KHQ A;  5JH3 A;  3H8B A;  1PIP A;  4N79 A;  2AU1 A;  3K24 A;  1KFU L;  1K3B B;  4WA6 A;  3WXF A;  2YJ9 A;  1MS6 A;  3I06 A;  2R9O A;  1EWL A;  4MSX A;  3BPF A;  2CB5 A;  2R9M A;  3I3T A;  3H8C A;  1JQP A;  4I05 A;  1AU4 A;  2AYN A;  4YVA A;  1MEG A;  2DZZ A;  1AIM A;  9PAP A;  3N3G A;  3IUT A;  3KW9 A;  4OEM A;  1VJV A;  3BPM A;  5CVN B;  3PDF A;  3O1G A;  4W5B A;  5J94 A;  3H7D A;  3HD3 A;  1YT7 A;  4X6J A;  1IWD A;  4QRG A;  1SNK A;  3OF9 A;  2R9C A;  2NQA A;  1STF E;  3RVW A;  2OZ2 A;  2B1M A;  4BSQ A;  2XU4 A;  1ME3 A;  4MZS A;  2HH5 A;  1MHW A;  1CVZ A;  1BGO A;  4CDE B;  2VHS A;  1HUC B;  5EF4 A;  4Q8G A;  2BDZ A;  1F29 A;  1CQD A;  3CH2 X;  4FJC A;  1CV8 A;  1F2C A;  4ZUX U;  4P6G A;  4DMY A;  1EWM A;  2PNS A;  2GHU A;  2JQG R;  4CDD B;  5F02 A;  3AI8 A;  4AXM A;  1KHP A;  2ATO A;  5CVM A;  3RVV A;  3H6S A;  3OIS A;  1U9Q X;  2G6D A;  2NQD B;  4FK5 A;  1CPJ A;  1Q6K A;  4YYR A;  5CHV A;  2P0R A;  1XKG A;  3PNR A;  4QRX A;  1EF7 A;  4CZW A;  1U9X A;  1GCB A;  2YJ8 A;  3GCB A;  4BQV A;  1ATK A;  1AU0 A;  3BOW A;  1F2A A; 
#chains in the Genus database with same CATH topology
 1NB5 A;  4AXL A;  4XZX A;  1MDW A;  4HXD B;  1AEC A;  2FT2 A;  3BCN A;  2ACT A;  4W4U A;  4RNA A;  3WXG A;  3MOR A;  4X6H A;  1PPO A;  4I04 A;  3V6E A;  3TMP A;  1CS8 A;  3P5W A;  4PAD A;  1TLO A;  1TL9 A;  4X6I A;  3MP2 A;  2DCB A;  4KLB A;  4YYQ A;  4ZTB A;  2P86 A;  2FRQ A;  1Y08 A;  4HWY A;  4G54 A;  1PPP A;  3P5V A;  4RY2 A;  2YJB A;  2PBH A;  4BS6 A;  2DCA A;  1U5I A;  1ITO A;  3PT2 A;  2ARY A;  1F2B A;  3LXS A;  5CVO B;  4OW0 A;  3KSE A;  3OQC A;  3OF8 A;  1Y4H A;  2AIM A;  5FPW A;  4BOQ A;  2PRE A;  2F1G A;  1GEC E;  2DCC A;  4PP1 A;  4RKX A;  2Y5B A;  4BPV A;  4MZO A;  3PW3 A;  3KFQ A;  4BOZ A;  4OVZ A;  3RVX A;  3IV2 A;  1PXV A;  1YAL A;  3QT4 A;  1KXR A;  4YV8 A;  3PRM A;  3QSD A;  2CIO A;  2E00 A;  3E1Z B;  2HHN A;  4CDC B;  2G7Y A;  3QJ3 A;  1ME4 A;  4FIP A;  3BWK A;  1AU2 A;  1NPZ A;  4CDF B;  1PBH A;  3D6S A;  2C0Y A;  2DZY A;  2OUL A;  4D8B A;  1ZIV A;  5A24 A;  2WBF X;  1YVB A;  3IEJ A;  2AVW A;  2DC8 A;  3PRP A;  3CBK A;  1QOL A;  4YYS A;  4P6E A;  1NLJ A;  2DC7 A;  1CB5 A;  2XU3 A;  3KWB X;  3N4C A;  7PCK A;  1U9W A;  3OVX A;  2HWK A;  5E6J A;  2HD5 A;  2DJF B;  4N4Z A;  1PPD A;  1UKF A;  3MTV A;  6PAD A;  2FRA A;  3K8U A;  2XU1 A;  1BY8 A;  1DKI A;  3B79 A;  3M99 A;  4Q8H A;  3LFY A;  3BBA A;  1A6R A;  3B21 A;  3V6C A;  2FUD A;  4D8I A;  3HHA A;  2E01 A;  5K16 A;  3BC3 A;  3PHW A;  1MIR A;  3PSE A;  3MTN A;  2HXZ A;  1QMY A;  2R9F A;  3MJ5 A;  2NQI A;  3IMA A;  2BTW A;  1PCI A;  3NHE A;  3OVZ A;  3CH3 X;  1PE6 A;  2F7D A;  1MEM A;  3KX1 A;  2Z84 A;  1NQC A;  3W31 A;  2BU3 A;  3W30 A;  1EWP A;  3USV A;  4K7C A;  4BS5 A;  4D8E A;  2XU5 A;  1PVJ A;  1AU3 A;  2AUZ A;  1THE A;  1U9V A;  4XUI A;  4QRV A;  3ZUA A;  2NQG A;  2BTW B;  2JTC A;  4IUM A;  2AS8 A;  1ZCM A;  2UZJ A;  1BQI A;  1YK8 A;  2R9N A;  3MHH A;  2FQ9 A;  3ZNH A;  1KFX L;  2IBI A;  4PI3 A;  2IPP B;  3N3K A;  2G8E A;  3KKU A;  1GMY A;  1CSB B;  3PBH A;  1X9Y A;  5CHT A;  2G8J A;  4N8W A;  1YK7 A;  2GFO A;  4PT5 A;  2DJG B;  1PPN A;  2DCD A;  3S3R A;  1ICF A;  8PCH A;  3HHI A;  3TNX A;  2FYE A;  2AYO A;  2FTD A;  3CBJ A;  4IP3 A;  1NL6 A;  1AYU A;  2FE8 A;  2DC6 A;  2O6X A;  1S4V A;  1BP4 A;  3DF0 A;  1CTE A;  3O65 A;  1POP A;  2Y6E A;  3HWN A;  4DMX A;  4YYU A;  3H89 A;  1NB3 A;  4R3D A;  3ERV A;  4MM3 B;  3MHS A;  1SP4 B;  1CJL A;  4QBB A;  1PAD A;  4OVZ B;  4XR7 A;  3RNV A;  2R6N A;  3K9M A;  3S3Q A;  4BOU A;  2YJC A;  1GLO A;  4P16 A;  3C9E A;  1M6D A;  4I07 A;  1EWO A;  2FO5 A;  2P7U A;  3P5X A;  2JRI A;  3O0U A;  4OEL A;  3IOQ A;  4YYW A;  2YJ2 A;  1VSN A;  2H7J A;  2PAD A;  4W5C A;  2DC9 A;  3P5U A;  3WXE A;  3IHP A;  4PP2 E;  1O0E A;  5PAD A;  4YYV A;  2OP3 A;  3F5V A;  1DF0 A;  2J7Q A;  4MI7 A;  4REZ A;  3TRK A;  2JQF R;  4BOS A;  1QDQ A;  1AYW A;  2J7Q C;  4A5U A;  4RF0 A;  3C0R A;  2VHF A;  4QH6 A;  1TU6 A;  2AGA A;  2B1N A;  2E02 A;  1FH0 A;  1QXP A;  1DEU A;  1AYV A;  3F75 A;  5EGW A;  2AUX A;  3KWZ A;  5JA7 A;  2BDL A;  2E03 A;  3U8E A;  1KHQ A;  4GUA A;  5JH3 A;  3H8B A;  4M0W A;  1PIP A;  4N79 A;  2AU1 A;  5EZQ A;  1YZB A;  3K24 A;  1KFU L;  1K3B B;  4WA6 A;  3WXF A;  2YJ9 A;  1MS6 A;  3I06 A;  2R9O A;  1EWL A;  4MSX A;  3BPF A;  2CB5 A;  2R9M A;  3I3T A;  3H8C A;  1JQP A;  4I05 A;  1AU4 A;  5KO3 A;  2AYN A;  4YVA A;  1MEG A;  2DZZ A;  1AIM A;  9PAP A;  3BB7 A;  3N3G A;  3PHX A;  3IUT A;  3KW9 A;  5EZS A;  5JZE A;  4RF1 A;  4BOP A;  4OEM A;  1VJV A;  3BPM A;  5CVN B;  3PDF A;  3O1G A;  4W5B A;  5J94 A;  3H7D A;  3HD3 A;  1YT7 A;  4X6J A;  1IWD A;  4QRG A;  1SNK A;  3OF9 A;  2R9C A;  2NQA A;  1STF E;  3RVW A;  2OZ2 A;  2B1M A;  4BSQ A;  2XU4 A;  1ME3 A;  4MZS A;  2HH5 A;  1MHW A;  1CVZ A;  1BGO A;  4CDE B;  2VHS A;  1HUC B;  4WUR A;  5EF4 A;  4Q8G A;  2BDZ A;  1F29 A;  1CQD A;  3CH2 X;  4FJC A;  1CV8 A;  1F2C A;  4ZUX U;  4P6G A;  4DMY A;  1EWM A;  2PNS A;  2GHU A;  2JQG R;  4CDD B;  5F02 A;  3AI8 A;  4AXM A;  1KHP A;  2ATO A;  5CVM A;  2DOS A;  3RVV A;  3H6S A;  3OIS A;  1U9Q X;  3E9S A;  2G6D A;  2NQD B;  4FK5 A;  1CPJ A;  1Q6K A;  4YYR A;  5CHV A;  2P0R A;  1XKG A;  3BY4 A;  3IFU A;  3PNR A;  4QRX A;  1EF7 A;  4CZW A;  1U9X A;  1GCB A;  3PHU A;  2YJ8 A;  3GCB A;  4BQV A;  1ATK A;  1AU0 A;  3BOW A;  1F2A A; 
#chains in the Genus database with same CATH homology
 1NB5 A;  4AXL A;  1MDW A;  1AEC A;  2FT2 A;  3BCN A;  2ACT A;  4W4U A;  3WXG A;  3MOR A;  4X6H A;  1PPO A;  4I04 A;  3V6E A;  1CS8 A;  3P5W A;  4PAD A;  1TLO A;  1TL9 A;  4X6I A;  2DCB A;  4KLB A;  4YYQ A;  2VFB A;  2P86 A;  2FRQ A;  1Y08 A;  4HWY A;  4G54 A;  1PPP A;  3P5V A;  4RY2 A;  2YJB A;  2PBH A;  4BS6 A;  2DCA A;  2VFC A;  1U5I A;  1ITO A;  2ARY A;  1F2B A;  3LXS A;  5CVO B;  3KSE A;  3OF8 A;  1Y4H A;  2AIM A;  5FPW A;  2PRE A;  2F1G A;  1GEC E;  2DCC A;  4PP1 A;  2Y5B A;  4BPV A;  4MZO A;  3PW3 A;  3KFQ A;  3RVX A;  3IV2 A;  1PXV A;  1YAL A;  3QT4 A;  1KXR A;  4YV8 A;  3QSD A;  2CIO A;  2E00 A;  3E1Z B;  2HHN A;  4CDC B;  2G7Y A;  3QJ3 A;  1ME4 A;  4FIP A;  3BWK A;  1AU2 A;  1NPZ A;  4CDF B;  1PBH A;  3D6S A;  2C0Y A;  2DZY A;  2OUL A;  1ZIV A;  5A24 A;  2WBF X;  1YVB A;  3IEJ A;  2AVW A;  2DC8 A;  3CBK A;  1QOL A;  4YYS A;  4P6E A;  1NLJ A;  2DC7 A;  1CB5 A;  2XU3 A;  3KWB X;  3N4C A;  7PCK A;  1U9W A;  3OVX A;  2HD5 A;  2DJF B;  4N4Z A;  1PPD A;  6PAD A;  2FRA A;  3K8U A;  2XU1 A;  1W6F A;  1BY8 A;  3B79 A;  3M99 A;  1W4T A;  4Q8H A;  3LFY A;  1A6R A;  3V6C A;  2FUD A;  3HHA A;  2E01 A;  5K16 A;  3BC3 A;  1MIR A;  3MTN A;  2HXZ A;  1QMY A;  2R9F A;  2NQI A;  3IMA A;  1PCI A;  3NHE A;  3OVZ A;  3CH3 X;  1PE6 A;  2F7D A;  1MEM A;  4NV8 A;  3KX1 A;  1NQC A;  1EWP A;  3USV A;  4K7C A;  4BS5 A;  2XU5 A;  1AU3 A;  2AUZ A;  1THE A;  1U9V A;  4XUI A;  4QRV A;  3ZUA A;  2NQG A;  2AS8 A;  1ZCM A;  1BQI A;  1YK8 A;  2R9N A;  3MHH A;  2FQ9 A;  1KFX L;  2IBI A;  4PI3 A;  2IPP B;  3N3K A;  2G8E A;  3KKU A;  1GMY A;  1CSB B;  3PBH A;  1X9Y A;  5CHT A;  2G8J A;  4N8W A;  1YK7 A;  2GFO A;  2DJG B;  1PPN A;  2DCD A;  3S3R A;  1ICF A;  8PCH A;  3HHI A;  3TNX A;  2FYE A;  2AYO A;  2FTD A;  3CBJ A;  1NL6 A;  1AYU A;  2DC6 A;  2O6X A;  1S4V A;  1BP4 A;  3DF0 A;  1CTE A;  1POP A;  2Y6E A;  3HWN A;  4DMX A;  3D9W A;  4YYU A;  3H89 A;  1NB3 A;  3ERV A;  3MHS A;  1SP4 B;  1CJL A;  4QBB A;  1PAD A;  4C5P A;  4XR7 A;  2R6N A;  3K9M A;  3S3Q A;  2YJC A;  1GLO A;  3C9E A;  1M6D A;  4I07 A;  1EWO A;  2FO5 A;  2P7U A;  3P5X A;  3O0U A;  4B55 A;  4OEL A;  3IOQ A;  4YYW A;  2YJ2 A;  1VSN A;  2H7J A;  2PAD A;  4W5C A;  2DC9 A;  3P5U A;  3WXE A;  3IHP A;  4PP2 E;  1O0E A;  5PAD A;  4YYV A;  1E2T A;  2OP3 A;  3F5V A;  1DF0 A;  2JQF R;  1QDQ A;  1AYW A;  2VHF A;  1W5R A;  4QH6 A;  1TU6 A;  2B1N A;  2E02 A;  1FH0 A;  1QXP A;  1DEU A;  1AYV A;  3F75 A;  5EGW A;  2AUX A;  3KWZ A;  4GUZ A;  5JA7 A;  2BDL A;  2E03 A;  3U8E A;  1KHQ A;  5JH3 A;  3H8B A;  1PIP A;  4N79 A;  2AU1 A;  2BSZ A;  3K24 A;  1KFU L;  1K3B B;  4WA6 A;  3WXF A;  2YJ9 A;  1MS6 A;  3I06 A;  2R9O A;  1EWL A;  4MSX A;  3BPF A;  2CB5 A;  2R9M A;  3I3T A;  3H8C A;  1JQP A;  4I05 A;  1AU4 A;  2AYN A;  4YVA A;  1MEG A;  2DZZ A;  1AIM A;  9PAP A;  3N3G A;  3IUT A;  3KW9 A;  4OEM A;  1VJV A;  3BPM A;  5CVN B;  3PDF A;  3O1G A;  4W5B A;  5J94 A;  3H7D A;  3HD3 A;  1YT7 A;  4X6J A;  1IWD A;  4QRG A;  1SNK A;  3OF9 A;  2R9C A;  2NQA A;  1STF E;  3RVW A;  2OZ2 A;  2B1M A;  4BSQ A;  2XU4 A;  1ME3 A;  4MZS A;  2HH5 A;  1MHW A;  1CVZ A;  1BGO A;  4CDE B;  2VHS A;  1HUC B;  5EF4 A;  4Q8G A;  2BDZ A;  1F29 A;  1CQD A;  3CH2 X;  4FJC A;  1CV8 A;  1F2C A;  4ZUX U;  4P6G A;  1GX3 A;  4NV7 A;  4DMY A;  1EWM A;  2PNS A;  2GHU A;  2JQG R;  4CDD B;  5F02 A;  3AI8 A;  4AXM A;  1KHP A;  2ATO A;  5CVM A;  3RVV A;  3H6S A;  3OIS A;  1U9Q X;  2G6D A;  2NQD B;  4FK5 A;  4BGF A;  1CPJ A;  1Q6K A;  4YYR A;  5CHV A;  2P0R A;  1XKG A;  3PNR A;  4QRX A;  1EF7 A;  3LTW A;  4CZW A;  1U9X A;  1GCB A;  2YJ8 A;  3GCB A;  4BQV A;  1ATK A;  1AU0 A;  3BOW A;  1F2A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...