2XU5A

Cathepsin l with a nitrile inhibitor
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
220
structure length
216
Chain Sequence
b'APRSVDWREKGYVTPVKNQGQCGSCWAFSATGALEGQMFRKTGRLISLSEQNLVDCSGPQGNEGCNGGLMDYAFQYVQDNGGLDSEESYPYEATEESCKYNPKYSVANDTGFVDIPKQEKALMKAVATVGPISVAIDAGHESFLFYKEGIYFEPDCSSEDMDHGVLVVGYGFEDNNKYWLVKNSWGEEWGMGGYVKMAKDRRNHCGIASAASYPTV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CATHEPSIN L1
publication title Systematic Investigation of Halogen Bonding in Protein-Ligand Interactions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 67
structure length 216
sequence length 220
ec nomenclature ec 3.4.22.15: Cathepsin L.
pdb deposition date 2010-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2xu5A00
3NHEA 3D6SA 1F29A 3IMAA 3OF9A 2HHNA 4QH6A 1EWMA 2WBFX 2FYEA 1NB5A 4I04A 1YT7A 3V6EA 4OELA 5A24A 3CH2X 2F7DA 4BS6A 2VHFA 3QT4A 1GLOA 2DCDA 3P5XA 1X9YA 1NL6A 3OVXA 4YYQA 2YJ9A 3KSEA 3O1GA 2DJFB 1THEA 1HUCB 1MEGA 3WXEA 1MIRA 1GCBA 3PBHA 3C9EA 2P0RA 2IBIA 3H6SA 2B1MA 2DC9A 2DZYA 2PADA 5CHVA 4QRVA 2P7UA 3ZUAA 2JQGR 9PAPA 2B1NA 2CIOA 4PADA 3P5UA 4XR7A 1AU0A 2DC7A 2PREA 3IV2A 1NB3A 2G8EA 4PI3A 2NQIA 1AYVA 3MTNA 3I06A 1K3BB 4YYVA 2DCBA 4YVAA 4G54A 5CVOB 1SNKA 4CDCB 3K9MA 2AUXA 3HWNA 3H7DA 4I05A 1AYUA 3LFYA 4RY2A 1A6RA 2G8JA 3H8CA 2OULA 1F2AA 5FPWA 2E00A 3BPMA 1CJLA 3DF0A 2FT2A 3PDFA 1VSNA 2DCAA 2R9OA 2FQ9A 1GECE 2OP3A 4Q8GA 4XUIA 1PE6A 3S3RA 4AXLA 3CBKA 1FH0A 5JA7A 3P5WA 2OZ2A 3CH3X 1YALA 2R9MA 1PCIA 2DZZA 2JQFR 2ARYA 1KXRA 6PADA 1YK8A 1S4VA 4N8WA 1AU4A 1PPPA 1Y08A 4FIPA 1YK7A 5JH3A 3IHPA 1F2CA 4N79A 1QOLA 3IUTA 1GMYA 1U5IA 8PCHA 1VJVA 3KWZA 4YYUA 1BGOA 3PNRA 1KFUL 2R9NA 5CVMA 3CBJA 1QDQA 4KLBA 4ZUXU 2AYNA 3WXFA 4PP2E 2XU5A 4YYSA 4FJCA 1ICFA 1NPZA 2YJ8A 3IEJA 1QXPA 3O0UA 3N3KA 5K16A 2O6XA 1XKGA 4K7CA 2DCCA 1BY8A 4BQVA 1NQCA 2NQAA 7PCKA 5CHTA 4Q8HA 3QSDA 4YYRA 4DMXA 2XU3A 2H7JA 3MORA 1ITOA 2AUZA 3KKUA 3KX1A 2HXZA 3H8BA 4YYWA 3N4CA 1SP4B 2DJGB 1CV8A 3HHAA 1CS8A 3PW3A 4FK5A 3MHSA 1CSBB 4QRGA 1AECA 1ME3A 1KHPA 2DC6A 1ZCMA 4MZSA 1TLOA 3KFQA 2BDZA 2NQDB 4P6EA 1CPJA 2FUDA 2AU1A 5EGWA 4AXMA 2AYOA 2DC8A 4DMYA 3OVZA 1MS6A 1IWDA 1PADA 2IPPB 1AYWA 2NQGA 1BQIA 3OISA 4QBBA 2R6NA 2AVWA 4BSQA 1KHQA 4CZWA 4CDFB 1PPDA 3K8UA 2GHUA 1ATKA 1U9WA 2E01A 2CB5A 2G7YA 3P5VA 4BS5A 3BWKA 2GFOA 2ACTA 3IOQA 1CB5A 1Y4HA 1AU2A 1YVBA 1PIPA 1DEUA 4P6GA 4W5CA 1EWPA 5CVNB 1NLJA 1MEMA 5F02A 3S3QA 2R9CA 3GCBA 1PPNA 4HWYA 3MHHA 4BPVA 3KW9A 3H89A 2AIMA 4X6IA 2FRAA 1U9QX 2XU4A 3B79A 4X6JA 3WXGA 4I07A 3F5VA 2C0YA 3OF8A 3LXSA 1PXVA 3BC3A 1CTEA 3BCNA 1PPOA 1O0EA 3I3TA 4CDDB 2FRQA 1U9XA 2Y6EA 4N4ZA 2VHSA 1EF7A 3N3GA 3BPFA 2FO5A 1BP4A 3K24A 3E1ZB 3BOWA 4PP1A 2R9FA 1AIMA 2FTDA 3U8EA 2G6DA 3KWBX 2P86A 5J94A 3ERVA 3QJ3A 2XU1A 2F1GA 4YV8A 3M99A 2E02A 5PADA 1CVZA 3F75A 1MHWA 1MDWA 1F2BA 2YJ2A 1STFE 3USVA 3RVXA 1AU3A 3TNXA 4MSXA 4W4UA 1Q6KA 3RVVA 1JQPA 2Y5BA 1ZIVA 4WA6A 4W5BA 4CDEB 3AI8A 4OEMA 1U9VA 4QRXA 2ATOA 3HHIA 1KFXL 2E03A 1POPA 2HH5A 4MZOA 2PBHA 3V6CA 3RVWA 5EF4A 1ME4A 1CQDA 3HD3A 1EWOA 2AS8A 1QMYA 1EWLA 4X6HA 1TL9A 2HD5A 1M6DA 2BDLA 1DF0A 2YJCA 2PNSA 2YJBA 1TU6A 1PBHA
chains in the Genus database with same CATH superfamily
3NHEA 3D6SA 3PHXA 1F29A 3IMAA 3OF9A 2HHNA 3PHWA 4QH6A 1EWMA 2WBFX 2FYEA 3C0RA 1NB5A 4I04A 1YT7A 3V6EA 4OELA 5A24A 3B21A 2BTWB 3CH2X 2F7DA 4BS6A 4D8EA 2VHFA 3QT4A 1GLOA 2DCDA 3P5XA 5JZEA 3PSEA 1X9YA 1NL6A 3OVXA 4YYQA 2YJ9A 3KSEA 3O1GA 2DJFB 4RF1A 1THEA 1HUCB 1MEGA 3WXEA 1MIRA 1GCBA 3PBHA 3C9EA 2P0RA 2IBIA 3H6SA 2B1MA 2DC9A 2DZYA 4OVZB 2PADA 5CHVA 4QRVA 2P7UA 3ZUAA 2BU3A 2JQGR 9PAPA 2B1NA 2CIOA 3O65A 4PADA 3P5UA 4XR7A 1AU0A 2DC7A 2PREA 3IV2A 1NB3A 2G8EA 4PI3A 3MTVA 2NQIA 1AYVA 3MTNA 3I06A 1K3BB 4YYVA 2DCBA 4YVAA 4XZXA 4G54A 5CVOB 1SNKA 4CDCB 3K9MA 2AUXA 3HWNA 3H7DA 4P16A 4I05A 1AYUA 3LFYA 4RY2A 1A6RA 2G8JA 3H8CA 2OULA 3IFUA 1F2AA 5FPWA 2E00A 3BPMA 1CJLA 3DF0A 3BBAA 2FT2A 3PDFA 1VSNA 2DCAA 2R9OA 2FQ9A 5EZQA 1GECE 2OP3A 4Q8GA 4XUIA 1PE6A 4BOZA 3S3RA 4AXLA 2FE8A 3CBKA 1FH0A 5JA7A 3P5WA 2OZ2A 3CH3X 1YALA 2R9MA 1PCIA 2DZZA 2JQFR 2ARYA 2JRIA 1KXRA 6PADA 3ZNHA 1YK8A 1S4VA 4N8WA 1AU4A 1PPPA 1Y08A 4FIPA 1YK7A 5JH3A 3IHPA 1F2CA 4N79A 1QOLA 3IUTA 1GMYA 1U5IA 4OW0A 8PCHA 1DKIA 1VJVA 3KWZA 4YYUA 1BGOA 3PNRA 4A5UA 1KFUL 2R9NA 5CVMA 3CBJA 1QDQA 4KLBA 4ZUXU 2AYNA 3WXFA 4PP2E 2XU5A 4YYSA 2BTWA 4FJCA 1ICFA 1NPZA 2YJ8A 2UZJA 3IEJA 1QXPA 3O0UA 3N3KA 5K16A 2O6XA 1XKGA 4K7CA 2DCCA 1BY8A 4BQVA 1NQCA 2NQAA 2Z84A 3PHUA 7PCKA 5CHTA 4Q8HA 3QSDA 4IP3A 4YYRA 4DMXA 2XU3A 4GUAA 2H7JA 3MORA 3OQCA 1ITOA 2AUZA 3KKUA 3KX1A 2HXZA 3H8BA 4YYWA 3N4CA 1SP4B 2DJGB 4MI7A 1CV8A 3HHAA 1CS8A 3PW3A 4FK5A 4RF0A 3MHSA 4ZTBA 1CSBB 4QRGA 1AECA 1ME3A 1KHPA 2J7QA 2DC6A 1ZCMA 4WURA 4R3DA 1TLOA 4MZSA 3KFQA 2BDZA 2J7QC 2NQDB 4P6EA 1CPJA 2FUDA 3W30A 2AU1A 5EGWA 4AXMA 4RKXA 2AYOA 2DC8A 2HWKA 4DMYA 3OVZA 1MS6A 3MP2A 3MJ5A 1IWDA 1PADA 1UKFA 2IPPB 1AYWA 4IUMA 2NQGA 1BQIA 3OISA 4QBBA 2R6NA 3BY4A 2AVWA 4BSQA 4BOSA 1KHQA 4CZWA 4CDFB 3BB7A 4BOUA 1PPDA 4D8IA 3K8UA 2GHUA 4BOQA 1ATKA 1U9WA 2E01A 2CB5A 2JTCA 2G7YA 3P5VA 4BS5A 3BWKA 2GFOA 4HXDB 2ACTA 5KO3A 3IOQA 1CB5A 3RNVA 1Y4HA 1AU2A 1YVBA 1PIPA 1DEUA 4P6GA 4W5CA 1EWPA 5CVNB 1NLJA 1MEMA 5F02A 3S3QA 2R9CA 3GCBA 1PPNA 4HWYA 3MHHA 4BPVA 3KW9A 3PRPA 3H89A 2AIMA 4X6IA 2FRAA 1U9QX 3PT2A 2XU4A 3B79A 4X6JA 3WXGA 4I07A 3F5VA 2C0YA 3OF8A 3LXSA 1PXVA 1YZBA 3BC3A 4D8BA 1CTEA 3BCNA 3TMPA 1PPOA 1O0EA 4OVZA 3I3TA 4CDDB 2FRQA 5E6JA 1U9XA 4REZA 2Y6EA 4N4ZA 2VHSA 1EF7A 3N3GA 3BPFA 2FO5A 1BP4A 3K24A 3E1ZB 3E9SA 3BOWA 4PP1A 2R9FA 1AIMA 2FTDA 3U8EA 2G6DA 3PRMA 3KWBX 2P86A 5J94A 3ERVA 3QJ3A 2XU1A 2F1GA 5EZSA 4M0WA 4YV8A 3M99A 2E02A 5PADA 1CVZA 3F75A 1MHWA 1MDWA 1F2BA 2YJ2A 4PT5A 1STFE 3USVA 3W31A 3RVXA 1AU3A 3TNXA 1PVJA 4BOPA 4MSXA 4W4UA 1Q6KA 3RVVA 1JQPA 2Y5BA 1ZIVA 4WA6A 4W5BA 4CDEB 3AI8A 4OEMA 1U9VA 4MM3B 4QRXA 2ATOA 3HHIA 1KFXL 3TRKA 2E03A 1POPA 2HH5A 4MZOA 2PBHA 3V6CA 3RVWA 5EF4A 1ME4A 1CQDA 2AGAA 3HD3A 1EWOA 4RNAA 2AS8A 1QMYA 1EWLA 4X6HA 1TL9A 2HD5A 1M6DA 2BDLA 1DF0A 2YJCA 2PNSA 2YJBA 1TU6A 1PBHA 2DOSA
chains in the Genus database with same CATH topology
3NHEA 3D6SA 1F29A 3IMAA 3OF9A 2HHNA 4QH6A 1EWMA 2WBFX 2FYEA 1NB5A 4I04A 4GUZA 1YT7A 3V6EA 4OELA 5A24A 3CH2X 2F7DA 4BS6A 2VHFA 3QT4A 1GLOA 2DCDA 3P5XA 1X9YA 1NL6A 3OVXA 4YYQA 2YJ9A 3KSEA 3O1GA 1W5RA 2DJFB 1THEA 1HUCB 1MEGA 3WXEA 1MIRA 1GCBA 3PBHA 3C9EA 2P0RA 2IBIA 3H6SA 2B1MA 2DC9A 2DZYA 2PADA 5CHVA 4QRVA 2P7UA 3ZUAA 2JQGR 9PAPA 2B1NA 2CIOA 4PADA 3P5UA 4XR7A 4NV7A 1AU0A 2DC7A 2PREA 3IV2A 1NB3A 2G8EA 4PI3A 2NQIA 1AYVA 3MTNA 3I06A 1K3BB 4YYVA 2DCBA 4YVAA 4G54A 5CVOB 1SNKA 4CDCB 3K9MA 2AUXA 3HWNA 3H7DA 4I05A 1AYUA 3D9WA 3LFYA 4RY2A 1A6RA 2G8JA 3H8CA 2OULA 1F2AA 5FPWA 2E00A 3BPMA 1CJLA 3DF0A 2FT2A 3PDFA 1VSNA 2DCAA 4BGFA 2R9OA 2FQ9A 1GECE 2OP3A 4Q8GA 4XUIA 1PE6A 3S3RA 4AXLA 3CBKA 1FH0A 4C5PA 5JA7A 3P5WA 2OZ2A 3CH3X 1YALA 2R9MA 1PCIA 2DZZA 2JQFR 2ARYA 1KXRA 6PADA 1YK8A 1S4VA 4N8WA 1AU4A 1PPPA 1Y08A 4FIPA 1YK7A 5JH3A 3IHPA 1F2CA 4N79A 1QOLA 3IUTA 1GMYA 1U5IA 8PCHA 1VJVA 3KWZA 4YYUA 1BGOA 3PNRA 1KFUL 2R9NA 5CVMA 3CBJA 1QDQA 4KLBA 4ZUXU 2AYNA 3WXFA 4PP2E 2XU5A 4YYSA 4FJCA 1E2TA 1ICFA 1NPZA 2YJ8A 3IEJA 1QXPA 3O0UA 3N3KA 5K16A 2O6XA 1XKGA 4K7CA 2DCCA 1BY8A 4BQVA 1NQCA 2NQAA 7PCKA 5CHTA 4Q8HA 3QSDA 4YYRA 4DMXA 2XU3A 2H7JA 3MORA 1ITOA 2AUZA 3KKUA 3KX1A 2HXZA 3H8BA 4YYWA 3N4CA 1SP4B 2DJGB 1CV8A 3HHAA 1CS8A 3PW3A 4FK5A 3MHSA 1CSBB 4QRGA 1AECA 1ME3A 1KHPA 2DC6A 1ZCMA 4MZSA 1TLOA 1GX3A 3KFQA 2BDZA 2NQDB 4P6EA 1CPJA 2FUDA 2AU1A 5EGWA 4AXMA 2AYOA 2DC8A 4DMYA 3OVZA 1MS6A 1IWDA 2VFBA 1PADA 2IPPB 1AYWA 2NQGA 1BQIA 3OISA 4QBBA 2R6NA 2AVWA 4BSQA 1KHQA 4CZWA 4CDFB 2BSZA 1PPDA 3K8UA 2GHUA 1ATKA 1U9WA 2E01A 2CB5A 2G7YA 3P5VA 4BS5A 3BWKA 2GFOA 2ACTA 3IOQA 1CB5A 1Y4HA 1AU2A 1YVBA 1PIPA 1DEUA 4P6GA 4W5CA 1EWPA 5CVNB 1NLJA 1MEMA 5F02A 3S3QA 2R9CA 3GCBA 1PPNA 4HWYA 3MHHA 4BPVA 3KW9A 3H89A 2AIMA 4X6IA 2FRAA 1U9QX 2XU4A 3B79A 4X6JA 3WXGA 4I07A 3F5VA 2C0YA 3OF8A 3LXSA 1PXVA 3BC3A 1CTEA 3BCNA 1PPOA 1O0EA 3I3TA 4CDDB 2FRQA 1U9XA 2Y6EA 4N4ZA 3LTWA 2VHSA 1EF7A 3N3GA 3BPFA 2FO5A 1BP4A 3K24A 3E1ZB 3BOWA 4PP1A 2R9FA 1AIMA 2FTDA 3U8EA 2G6DA 3KWBX 2P86A 5J94A 3ERVA 3QJ3A 2XU1A 2F1GA 4YV8A 3M99A 2E02A 5PADA 1CVZA 3F75A 1MHWA 1MDWA 1F2BA 2YJ2A 4NV8A 1STFE 3USVA 3RVXA 1AU3A 3TNXA 4MSXA 4W4UA 1Q6KA 3RVVA 1JQPA 2Y5BA 1ZIVA 4WA6A 2VFCA 4W5BA 4CDEB 3AI8A 4OEMA 1U9VA 4QRXA 2ATOA 3HHIA 1KFXL 2E03A 1POPA 2HH5A 4MZOA 1W6FA 2PBHA 3V6CA 3RVWA 5EF4A 1ME4A 1CQDA 1W4TA 4B55A 3HD3A 1EWOA 2AS8A 1QMYA 1EWLA 4X6HA 1TL9A 2HD5A 1M6DA 2BDLA 1DF0A 2YJCA 2PNSA 2YJBA 1TU6A 1PBHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NHE A;  3D6S A;  1F29 A;  3IMA A;  3OF9 A;  2HHN A;  4QH6 A;  1EWM A;  2WBF X;  2FYE A;  1NB5 A;  4I04 A;  1YT7 A;  3V6E A;  4OEL A;  5A24 A;  3CH2 X;  2F7D A;  4BS6 A;  2VHF A;  3QT4 A;  1GLO A;  2DCD A;  3P5X A;  1X9Y A;  1NL6 A;  3OVX A;  4YYQ A;  2YJ9 A;  3KSE A;  3O1G A;  2DJF B;  1THE A;  1HUC B;  1MEG A;  3WXE A;  1MIR A;  1GCB A;  3PBH A;  3C9E A;  2P0R A;  2IBI A;  3H6S A;  2B1M A;  2DC9 A;  2DZY A;  2PAD A;  5CHV A;  4QRV A;  2P7U A;  3ZUA A;  2JQG R;  9PAP A;  2B1N A;  2CIO A;  4PAD A;  3P5U A;  4XR7 A;  1AU0 A;  2DC7 A;  2PRE A;  3IV2 A;  1NB3 A;  2G8E A;  4PI3 A;  2NQI A;  1AYV A;  3MTN A;  3I06 A;  1K3B B;  4YYV A;  2DCB A;  4YVA A;  4G54 A;  5CVO B;  1SNK A;  4CDC B;  3K9M A;  2AUX A;  3HWN A;  3H7D A;  4I05 A;  1AYU A;  3LFY A;  4RY2 A;  1A6R A;  2G8J A;  3H8C A;  2OUL A;  1F2A A;  5FPW A;  2E00 A;  3BPM A;  1CJL A;  3DF0 A;  2FT2 A;  3PDF A;  1VSN A;  2DCA A;  2R9O A;  2FQ9 A;  1GEC E;  2OP3 A;  4Q8G A;  4XUI A;  1PE6 A;  3S3R A;  4AXL A;  3CBK A;  1FH0 A;  5JA7 A;  3P5W A;  2OZ2 A;  3CH3 X;  1YAL A;  2R9M A;  1PCI A;  2DZZ A;  2JQF R;  2ARY A;  1KXR A;  6PAD A;  1YK8 A;  1S4V A;  4N8W A;  1AU4 A;  1PPP A;  1Y08 A;  4FIP A;  1YK7 A;  5JH3 A;  3IHP A;  1F2C A;  4N79 A;  1QOL A;  3IUT A;  1GMY A;  1U5I A;  8PCH A;  1VJV A;  3KWZ A;  4YYU A;  1BGO A;  3PNR A;  1KFU L;  2R9N A;  5CVM A;  3CBJ A;  1QDQ A;  4KLB A;  4ZUX U;  2AYN A;  3WXF A;  4PP2 E;  2XU5 A;  4YYS A;  4FJC A;  1ICF A;  1NPZ A;  2YJ8 A;  3IEJ A;  1QXP A;  3O0U A;  3N3K A;  5K16 A;  2O6X A;  1XKG A;  4K7C A;  2DCC A;  1BY8 A;  4BQV A;  1NQC A;  2NQA A;  7PCK A;  5CHT A;  4Q8H A;  3QSD A;  4YYR A;  4DMX A;  2XU3 A;  2H7J A;  3MOR A;  1ITO A;  2AUZ A;  3KKU A;  3KX1 A;  2HXZ A;  3H8B A;  4YYW A;  3N4C A;  1SP4 B;  2DJG B;  1CV8 A;  3HHA A;  1CS8 A;  3PW3 A;  4FK5 A;  3MHS A;  1CSB B;  4QRG A;  1AEC A;  1ME3 A;  1KHP A;  2DC6 A;  1ZCM A;  4MZS A;  1TLO A;  3KFQ A;  2BDZ A;  2NQD B;  4P6E A;  1CPJ A;  2FUD A;  2AU1 A;  5EGW A;  4AXM A;  2AYO A;  2DC8 A;  4DMY A;  3OVZ A;  1MS6 A;  1IWD A;  1PAD A;  2IPP B;  1AYW A;  2NQG A;  1BQI A;  3OIS A;  4QBB A;  2R6N A;  2AVW A;  4BSQ A;  1KHQ A;  4CZW A;  4CDF B;  1PPD A;  3K8U A;  2GHU A;  1ATK A;  1U9W A;  2E01 A;  2CB5 A;  2G7Y A;  3P5V A;  4BS5 A;  3BWK A;  2GFO A;  2ACT A;  3IOQ A;  1CB5 A;  1Y4H A;  1AU2 A;  1YVB A;  1PIP A;  1DEU A;  4P6G A;  4W5C A;  1EWP A;  5CVN B;  1NLJ A;  1MEM A;  5F02 A;  3S3Q A;  2R9C A;  3GCB A;  1PPN A;  4HWY A;  3MHH A;  4BPV A;  3KW9 A;  3H89 A;  2AIM A;  4X6I A;  2FRA A;  1U9Q X;  2XU4 A;  3B79 A;  4X6J A;  3WXG A;  4I07 A;  3F5V A;  2C0Y A;  3OF8 A;  3LXS A;  1PXV A;  3BC3 A;  1CTE A;  3BCN A;  1PPO A;  1O0E A;  3I3T A;  4CDD B;  2FRQ A;  1U9X A;  2Y6E A;  4N4Z A;  2VHS A;  1EF7 A;  3N3G A;  3BPF A;  2FO5 A;  1BP4 A;  3K24 A;  3E1Z B;  3BOW A;  4PP1 A;  2R9F A;  1AIM A;  2FTD A;  3U8E A;  2G6D A;  3KWB X;  2P86 A;  5J94 A;  3ERV A;  3QJ3 A;  2XU1 A;  2F1G A;  4YV8 A;  3M99 A;  2E02 A;  5PAD A;  1CVZ A;  3F75 A;  1MHW A;  1MDW A;  1F2B A;  2YJ2 A;  1STF E;  3USV A;  3RVX A;  1AU3 A;  3TNX A;  4MSX A;  4W4U A;  1Q6K A;  3RVV A;  1JQP A;  2Y5B A;  1ZIV A;  4WA6 A;  4W5B A;  4CDE B;  3AI8 A;  4OEM A;  1U9V A;  4QRX A;  2ATO A;  3HHI A;  1KFX L;  2E03 A;  1POP A;  2HH5 A;  4MZO A;  2PBH A;  3V6C A;  3RVW A;  5EF4 A;  1ME4 A;  1CQD A;  3HD3 A;  1EWO A;  2AS8 A;  1QMY A;  1EWL A;  4X6H A;  1TL9 A;  2HD5 A;  1M6D A;  2BDL A;  1DF0 A;  2YJC A;  2PNS A;  2YJB A;  1TU6 A;  1PBH A; 
#chains in the Genus database with same CATH topology
 3NHE A;  3D6S A;  3PHX A;  1F29 A;  3IMA A;  3OF9 A;  2HHN A;  3PHW A;  4QH6 A;  1EWM A;  2WBF X;  2FYE A;  3C0R A;  1NB5 A;  4I04 A;  1YT7 A;  3V6E A;  4OEL A;  5A24 A;  3B21 A;  2BTW B;  3CH2 X;  2F7D A;  4BS6 A;  4D8E A;  2VHF A;  3QT4 A;  1GLO A;  2DCD A;  3P5X A;  5JZE A;  3PSE A;  1X9Y A;  1NL6 A;  3OVX A;  4YYQ A;  2YJ9 A;  3KSE A;  3O1G A;  2DJF B;  4RF1 A;  1THE A;  1HUC B;  1MEG A;  3WXE A;  1MIR A;  1GCB A;  3PBH A;  3C9E A;  2P0R A;  2IBI A;  3H6S A;  2B1M A;  2DC9 A;  2DZY A;  4OVZ B;  2PAD A;  5CHV A;  4QRV A;  2P7U A;  3ZUA A;  2BU3 A;  2JQG R;  9PAP A;  2B1N A;  2CIO A;  3O65 A;  4PAD A;  3P5U A;  4XR7 A;  1AU0 A;  2DC7 A;  2PRE A;  3IV2 A;  1NB3 A;  2G8E A;  4PI3 A;  3MTV A;  2NQI A;  1AYV A;  3MTN A;  3I06 A;  1K3B B;  4YYV A;  2DCB A;  4YVA A;  4XZX A;  4G54 A;  5CVO B;  1SNK A;  4CDC B;  3K9M A;  2AUX A;  3HWN A;  3H7D A;  4P16 A;  4I05 A;  1AYU A;  3LFY A;  4RY2 A;  1A6R A;  2G8J A;  3H8C A;  2OUL A;  3IFU A;  1F2A A;  5FPW A;  2E00 A;  3BPM A;  1CJL A;  3DF0 A;  3BBA A;  2FT2 A;  3PDF A;  1VSN A;  2DCA A;  2R9O A;  2FQ9 A;  5EZQ A;  1GEC E;  2OP3 A;  4Q8G A;  4XUI A;  1PE6 A;  4BOZ A;  3S3R A;  4AXL A;  2FE8 A;  3CBK A;  1FH0 A;  5JA7 A;  3P5W A;  2OZ2 A;  3CH3 X;  1YAL A;  2R9M A;  1PCI A;  2DZZ A;  2JQF R;  2ARY A;  2JRI A;  1KXR A;  6PAD A;  3ZNH A;  1YK8 A;  1S4V A;  4N8W A;  1AU4 A;  1PPP A;  1Y08 A;  4FIP A;  1YK7 A;  5JH3 A;  3IHP A;  1F2C A;  4N79 A;  1QOL A;  3IUT A;  1GMY A;  1U5I A;  4OW0 A;  8PCH A;  1DKI A;  1VJV A;  3KWZ A;  4YYU A;  1BGO A;  3PNR A;  4A5U A;  1KFU L;  2R9N A;  5CVM A;  3CBJ A;  1QDQ A;  4KLB A;  4ZUX U;  2AYN A;  3WXF A;  4PP2 E;  2XU5 A;  4YYS A;  2BTW A;  4FJC A;  1ICF A;  1NPZ A;  2YJ8 A;  2UZJ A;  3IEJ A;  1QXP A;  3O0U A;  3N3K A;  5K16 A;  2O6X A;  1XKG A;  4K7C A;  2DCC A;  1BY8 A;  4BQV A;  1NQC A;  2NQA A;  2Z84 A;  3PHU A;  7PCK A;  5CHT A;  4Q8H A;  3QSD A;  4IP3 A;  4YYR A;  4DMX A;  2XU3 A;  4GUA A;  2H7J A;  3MOR A;  3OQC A;  1ITO A;  2AUZ A;  3KKU A;  3KX1 A;  2HXZ A;  3H8B A;  4YYW A;  3N4C A;  1SP4 B;  2DJG B;  4MI7 A;  1CV8 A;  3HHA A;  1CS8 A;  3PW3 A;  4FK5 A;  4RF0 A;  3MHS A;  4ZTB A;  1CSB B;  4QRG A;  1AEC A;  1ME3 A;  1KHP A;  2J7Q A;  2DC6 A;  1ZCM A;  4WUR A;  4R3D A;  1TLO A;  4MZS A;  3KFQ A;  2BDZ A;  2J7Q C;  2NQD B;  4P6E A;  1CPJ A;  2FUD A;  3W30 A;  2AU1 A;  5EGW A;  4AXM A;  4RKX A;  2AYO A;  2DC8 A;  2HWK A;  4DMY A;  3OVZ A;  1MS6 A;  3MP2 A;  3MJ5 A;  1IWD A;  1PAD A;  1UKF A;  2IPP B;  1AYW A;  4IUM A;  2NQG A;  1BQI A;  3OIS A;  4QBB A;  2R6N A;  3BY4 A;  2AVW A;  4BSQ A;  4BOS A;  1KHQ A;  4CZW A;  4CDF B;  3BB7 A;  4BOU A;  1PPD A;  4D8I A;  3K8U A;  2GHU A;  4BOQ A;  1ATK A;  1U9W A;  2E01 A;  2CB5 A;  2JTC A;  2G7Y A;  3P5V A;  4BS5 A;  3BWK A;  2GFO A;  4HXD B;  2ACT A;  5KO3 A;  3IOQ A;  1CB5 A;  3RNV A;  1Y4H A;  1AU2 A;  1YVB A;  1PIP A;  1DEU A;  4P6G A;  4W5C A;  1EWP A;  5CVN B;  1NLJ A;  1MEM A;  5F02 A;  3S3Q A;  2R9C A;  3GCB A;  1PPN A;  4HWY A;  3MHH A;  4BPV A;  3KW9 A;  3PRP A;  3H89 A;  2AIM A;  4X6I A;  2FRA A;  1U9Q X;  3PT2 A;  2XU4 A;  3B79 A;  4X6J A;  3WXG A;  4I07 A;  3F5V A;  2C0Y A;  3OF8 A;  3LXS A;  1PXV A;  1YZB A;  3BC3 A;  4D8B A;  1CTE A;  3BCN A;  3TMP A;  1PPO A;  1O0E A;  4OVZ A;  3I3T A;  4CDD B;  2FRQ A;  5E6J A;  1U9X A;  4REZ A;  2Y6E A;  4N4Z A;  2VHS A;  1EF7 A;  3N3G A;  3BPF A;  2FO5 A;  1BP4 A;  3K24 A;  3E1Z B;  3E9S A;  3BOW A;  4PP1 A;  2R9F A;  1AIM A;  2FTD A;  3U8E A;  2G6D A;  3PRM A;  3KWB X;  2P86 A;  5J94 A;  3ERV A;  3QJ3 A;  2XU1 A;  2F1G A;  5EZS A;  4M0W A;  4YV8 A;  3M99 A;  2E02 A;  5PAD A;  1CVZ A;  3F75 A;  1MHW A;  1MDW A;  1F2B A;  2YJ2 A;  4PT5 A;  1STF E;  3USV A;  3W31 A;  3RVX A;  1AU3 A;  3TNX A;  1PVJ A;  4BOP A;  4MSX A;  4W4U A;  1Q6K A;  3RVV A;  1JQP A;  2Y5B A;  1ZIV A;  4WA6 A;  4W5B A;  4CDE B;  3AI8 A;  4OEM A;  1U9V A;  4MM3 B;  4QRX A;  2ATO A;  3HHI A;  1KFX L;  3TRK A;  2E03 A;  1POP A;  2HH5 A;  4MZO A;  2PBH A;  3V6C A;  3RVW A;  5EF4 A;  1ME4 A;  1CQD A;  2AGA A;  3HD3 A;  1EWO A;  4RNA A;  2AS8 A;  1QMY A;  1EWL A;  4X6H A;  1TL9 A;  2HD5 A;  1M6D A;  2BDL A;  1DF0 A;  2YJC A;  2PNS A;  2YJB A;  1TU6 A;  1PBH A;  2DOS A; 
#chains in the Genus database with same CATH homology
 3NHE A;  3D6S A;  1F29 A;  3IMA A;  3OF9 A;  2HHN A;  4QH6 A;  1EWM A;  2WBF X;  2FYE A;  1NB5 A;  4I04 A;  4GUZ A;  1YT7 A;  3V6E A;  4OEL A;  5A24 A;  3CH2 X;  2F7D A;  4BS6 A;  2VHF A;  3QT4 A;  1GLO A;  2DCD A;  3P5X A;  1X9Y A;  1NL6 A;  3OVX A;  4YYQ A;  2YJ9 A;  3KSE A;  3O1G A;  1W5R A;  2DJF B;  1THE A;  1HUC B;  1MEG A;  3WXE A;  1MIR A;  1GCB A;  3PBH A;  3C9E A;  2P0R A;  2IBI A;  3H6S A;  2B1M A;  2DC9 A;  2DZY A;  2PAD A;  5CHV A;  4QRV A;  2P7U A;  3ZUA A;  2JQG R;  9PAP A;  2B1N A;  2CIO A;  4PAD A;  3P5U A;  4XR7 A;  4NV7 A;  1AU0 A;  2DC7 A;  2PRE A;  3IV2 A;  1NB3 A;  2G8E A;  4PI3 A;  2NQI A;  1AYV A;  3MTN A;  3I06 A;  1K3B B;  4YYV A;  2DCB A;  4YVA A;  4G54 A;  5CVO B;  1SNK A;  4CDC B;  3K9M A;  2AUX A;  3HWN A;  3H7D A;  4I05 A;  1AYU A;  3D9W A;  3LFY A;  4RY2 A;  1A6R A;  2G8J A;  3H8C A;  2OUL A;  1F2A A;  5FPW A;  2E00 A;  3BPM A;  1CJL A;  3DF0 A;  2FT2 A;  3PDF A;  1VSN A;  2DCA A;  4BGF A;  2R9O A;  2FQ9 A;  1GEC E;  2OP3 A;  4Q8G A;  4XUI A;  1PE6 A;  3S3R A;  4AXL A;  3CBK A;  1FH0 A;  4C5P A;  5JA7 A;  3P5W A;  2OZ2 A;  3CH3 X;  1YAL A;  2R9M A;  1PCI A;  2DZZ A;  2JQF R;  2ARY A;  1KXR A;  6PAD A;  1YK8 A;  1S4V A;  4N8W A;  1AU4 A;  1PPP A;  1Y08 A;  4FIP A;  1YK7 A;  5JH3 A;  3IHP A;  1F2C A;  4N79 A;  1QOL A;  3IUT A;  1GMY A;  1U5I A;  8PCH A;  1VJV A;  3KWZ A;  4YYU A;  1BGO A;  3PNR A;  1KFU L;  2R9N A;  5CVM A;  3CBJ A;  1QDQ A;  4KLB A;  4ZUX U;  2AYN A;  3WXF A;  4PP2 E;  2XU5 A;  4YYS A;  4FJC A;  1E2T A;  1ICF A;  1NPZ A;  2YJ8 A;  3IEJ A;  1QXP A;  3O0U A;  3N3K A;  5K16 A;  2O6X A;  1XKG A;  4K7C A;  2DCC A;  1BY8 A;  4BQV A;  1NQC A;  2NQA A;  7PCK A;  5CHT A;  4Q8H A;  3QSD A;  4YYR A;  4DMX A;  2XU3 A;  2H7J A;  3MOR A;  1ITO A;  2AUZ A;  3KKU A;  3KX1 A;  2HXZ A;  3H8B A;  4YYW A;  3N4C A;  1SP4 B;  2DJG B;  1CV8 A;  3HHA A;  1CS8 A;  3PW3 A;  4FK5 A;  3MHS A;  1CSB B;  4QRG A;  1AEC A;  1ME3 A;  1KHP A;  2DC6 A;  1ZCM A;  4MZS A;  1TLO A;  1GX3 A;  3KFQ A;  2BDZ A;  2NQD B;  4P6E A;  1CPJ A;  2FUD A;  2AU1 A;  5EGW A;  4AXM A;  2AYO A;  2DC8 A;  4DMY A;  3OVZ A;  1MS6 A;  1IWD A;  2VFB A;  1PAD A;  2IPP B;  1AYW A;  2NQG A;  1BQI A;  3OIS A;  4QBB A;  2R6N A;  2AVW A;  4BSQ A;  1KHQ A;  4CZW A;  4CDF B;  2BSZ A;  1PPD A;  3K8U A;  2GHU A;  1ATK A;  1U9W A;  2E01 A;  2CB5 A;  2G7Y A;  3P5V A;  4BS5 A;  3BWK A;  2GFO A;  2ACT A;  3IOQ A;  1CB5 A;  1Y4H A;  1AU2 A;  1YVB A;  1PIP A;  1DEU A;  4P6G A;  4W5C A;  1EWP A;  5CVN B;  1NLJ A;  1MEM A;  5F02 A;  3S3Q A;  2R9C A;  3GCB A;  1PPN A;  4HWY A;  3MHH A;  4BPV A;  3KW9 A;  3H89 A;  2AIM A;  4X6I A;  2FRA A;  1U9Q X;  2XU4 A;  3B79 A;  4X6J A;  3WXG A;  4I07 A;  3F5V A;  2C0Y A;  3OF8 A;  3LXS A;  1PXV A;  3BC3 A;  1CTE A;  3BCN A;  1PPO A;  1O0E A;  3I3T A;  4CDD B;  2FRQ A;  1U9X A;  2Y6E A;  4N4Z A;  3LTW A;  2VHS A;  1EF7 A;  3N3G A;  3BPF A;  2FO5 A;  1BP4 A;  3K24 A;  3E1Z B;  3BOW A;  4PP1 A;  2R9F A;  1AIM A;  2FTD A;  3U8E A;  2G6D A;  3KWB X;  2P86 A;  5J94 A;  3ERV A;  3QJ3 A;  2XU1 A;  2F1G A;  4YV8 A;  3M99 A;  2E02 A;  5PAD A;  1CVZ A;  3F75 A;  1MHW A;  1MDW A;  1F2B A;  2YJ2 A;  4NV8 A;  1STF E;  3USV A;  3RVX A;  1AU3 A;  3TNX A;  4MSX A;  4W4U A;  1Q6K A;  3RVV A;  1JQP A;  2Y5B A;  1ZIV A;  4WA6 A;  2VFC A;  4W5B A;  4CDE B;  3AI8 A;  4OEM A;  1U9V A;  4QRX A;  2ATO A;  3HHI A;  1KFX L;  2E03 A;  1POP A;  2HH5 A;  4MZO A;  1W6F A;  2PBH A;  3V6C A;  3RVW A;  5EF4 A;  1ME4 A;  1CQD A;  1W4T A;  4B55 A;  3HD3 A;  1EWO A;  2AS8 A;  1QMY A;  1EWL A;  4X6H A;  1TL9 A;  2HD5 A;  1M6D A;  2BDL A;  1DF0 A;  2YJC A;  2PNS A;  2YJB A;  1TU6 A;  1PBH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...