4I07A

Structure of mature form of cathepsin b1 from schistosoma mansoni
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
253
structure length
252
Chain Sequence
EIPSSFDSRKKWPRCKSIATIRDQSRCGSWAFGAVEAMSDRSCIQSGGKQNVELSAVDLLSCCESCGLGCEGGILGPAWDYWVKEGIVTGSSKENHAGCEPYPFPKCEHHTKGKYPPCGSKIYKTPRCKQTCQKKYKTPYTQDKHRGKSSYNVKNDEKAIQKEIMKYGPVEAGFTVYEDFLNYKSGIYKHITGETLGGHAIRIIGWGVENKAPYWLIANSWNEDWGENGYFRIVRGRDECSIESEVTAGRIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cathepsin B-like peptidase (C01 family)
publication title Activation route of the Schistosoma mansoni cathepsin B1 drug target: structural map with a glycosaminoglycan switch
pubmed doi rcsb
source organism Schistosoma mansoni
molecule tags Hydrolase
total genus 81
structure length 252
sequence length 253
ec nomenclature ec 3.4.22.1: Cathepsin B.
pdb deposition date 2012-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 4i07A00
4BSQA 1U9XA 1BY8A 2DC6A 1MEGA 2F1GA 2PBHA 4YV8A 4BQVA 3IUTA 3WXFA 5EGWA 1AIMA 4XUIA 1QMYA 2XU1A 3IEJA 3IHPA 1NQCA 2ACTA 4AXLA 1CB5A 2AYNA 3C9EA 4DMXA 1PPOA 1PCIA 1DEUA 4FJCA 1S4VA 1ZIVA 1CJLA 2CIOA 2DC7A 3PW3A 2E03A 3I06A 4YYQA 3P5WA 2HD5A 1ATKA 1PADA 3OVZA 1YK7A 4DMYA 2BDZA 2JQGR 1U5IA 2YJCA 5JA7A 4N4ZA 3USVA 1U9QX 2YJ9A 2DZYA 2PADA 2E01A 4X6IA 5CVNB 3V6EA 1AU2A 4YYUA 2DCDA 4YYVA 3BOWA 1NB5A 2FUDA 4YYRA 3HWNA 1MHWA 3PNRA 1U9WA 3KWZA 1TU6A 2R9FA 5CVMA 3S3RA 3OISA 4QRXA 4YVAA 4BPVA 4N79A 2CB5A 1NL6A 3KX1A 2FT2A 2YJ8A 1NLJA 5CVOB 1AYUA 3KKUA 5J94A 1GLOA 1KHQA 1TL9A 1EWLA 3KFQA 4BS6A 2HXZA 4W4UA 2DC9A 2FRQA 2OULA 2NQIA 1EWPA 2FTDA 3MTNA 1SP4B 3CBKA 3HD3A 1CQDA 4Q8GA 3KWBX 2DJGB 1VSNA 3H89A 2R9OA 2OP3A 2NQGA 1AECA 1VJVA 3F5VA 4WA6A 3DF0A 2G6DA 1Y08A 2DZZA 3HHAA 1KXRA 1PPDA 2IBIA 1ZCMA 3S3QA 5F02A 5EF4A 4CZWA 5CHVA 3O1GA 2AIMA 2VHSA 3BCNA 2HHNA 1AU4A 2GFOA 1PXVA 3BPFA 3CH2X 3P5XA 2E02A 1YVBA 1IWDA 1QXPA 1PIPA 2HH5A 1O0EA 4ZUXU 1F29A 4I04A 4CDFB 1KFXL 8PCHA 3V6CA 1PPPA 1GECE 2Y6EA 4MZSA 2FO5A 1CV8A 4I05A 2OZ2A 4PI3A 4QRVA 3U8EA 2O6XA 4KLBA 1PE6A 2G8JA 1F2CA 7PCKA 4K7CA 1THEA 3CH3X 2NQDB 2G8EA 2R9NA 1KFUL 3IV2A 2H7JA 5PADA 4PP2E 2ATOA 3OF8A 3PBHA 3H7DA 1BQIA 3K9MA 4P6EA 1SNKA 4W5CA 2DJFB 1NB3A 4QBBA 1PBHA 2XU4A 2AVWA 2AUXA 1AYVA 4XR7A 1X9YA 4PADA 3BWKA 1STFE 4FIPA 2XU3A 1Y4HA 3LXSA 2AU1A 3O0UA 1MS6A 4MSXA 3K8UA 3QJ3A 4X6JA 2JQFR 3E1ZB 5FPWA 3K24A 3PDFA 2IPPB 3RVVA 2R9MA 2ARYA 2B1MA 2AUZA 4OEMA 5JH3A 3KSEA 4QH6A 1CVZA 2P0RA 1DF0A 4Q8HA 1ME3A 3IMAA 3RVXA 1ME4A 1AU3A 1EWOA 2XU5A 2R9CA 1M6DA 1U9VA 1F2AA 1YK8A 3RVWA 2YJ2A 4X6HA 3ZUAA 4P6GA 3CBJA 4OELA 1JQPA 3OVXA 1FH0A 1A6RA 2WBFX 4I07A 4G54A 5K16A 1BP4A 2R6NA 3MHSA 9PAPA 2FRAA 3NHEA 1MIRA 4PP1A 1TLOA 1EWMA 2E00A 3WXGA 2FQ9A 2P86A 1EF7A 1Q6KA 4BS5A 4YYWA 2VHFA 6PADA 4N8WA 3WXEA 1ITOA 3KW9A 3F75A 2DCBA 3N4CA 1F2BA 3LFYA 2B1NA 2PREA 3H6SA 1AYWA 1PPNA 2PNSA 2AS8A 3I3TA 1GCBA 3H8BA 1CS8A 4AXMA 4CDDB 1CPJA 3D6SA 2DCCA 1NPZA 3P5UA 1QOLA 3QT4A 3M99A 3BPMA 2DCAA 3N3KA 1KHPA 3H8CA 1ICFA 3P5VA 2G7YA 3ERVA 2NQAA 4MZOA 1AU0A 1MDWA 2F7DA 1POPA 1HUCB 3HHIA 3AI8A 4FK5A 1CTEA 1MEMA 2DC8A 1K3BB 1GMYA 2Y5BA 3MORA 2YJBA 3QSDA 4HWYA 5CHTA 4RY2A 3OF9A 4YYSA 3B79A 1QDQA 5A24A 3IOQA 1XKGA 1CSBB 3BC3A 2FYEA 4W5BA 1YALA 3GCBA 4QRGA 1YT7A 2C0YA 3N3GA 3MHHA 2GHUA 2AYOA 4CDEB 4CDCB 2P7UA 3TNXA 1BGOA 2BDLA
chains in the Genus database with same CATH superfamily
4BSQA 1U9XA 1BY8A 2DC6A 3PHXA 1MEGA 2F1GA 2PBHA 4YV8A 4BQVA 3IUTA 3WXFA 5EGWA 1AIMA 4XUIA 1QMYA 2XU1A 3IEJA 3IHPA 4PT5A 1NQCA 2ACTA 4AXLA 1CB5A 2AYNA 3C9EA 4DMXA 1PPOA 1PCIA 1DEUA 4FJCA 1S4VA 1ZIVA 1CJLA 2CIOA 2DC7A 3PW3A 4BOZA 2E03A 3I06A 4YYQA 3P5WA 3PHUA 2HD5A 1ATKA 4D8BA 1PADA 3OVZA 1YK7A 4DMYA 2BDZA 2J7QC 2JQGR 1U5IA 2YJCA 5JA7A 4N4ZA 3USVA 1U9QX 2YJ9A 2DZYA 2PADA 2E01A 4X6IA 5CVNB 3V6EA 3MP2A 1AU2A 4YYUA 2DCDA 4YYVA 3BOWA 1NB5A 2FUDA 4YYRA 3HWNA 1MHWA 3PNRA 1U9WA 3KWZA 1TU6A 2R9FA 5CVMA 3S3RA 3OISA 4QRXA 4YVAA 4BPVA 4N79A 2CB5A 1NL6A 3KX1A 2FT2A 2YJ8A 4MM3B 1NLJA 5CVOB 1AYUA 3KKUA 5J94A 1GLOA 2DOSA 1KHQA 1TL9A 1EWLA 3KFQA 4BS6A 2HXZA 3BB7A 4W4UA 3O65A 2DC9A 2FRQA 1UKFA 2OULA 2NQIA 1EWPA 2FTDA 3MTNA 1SP4B 3CBKA 3HD3A 1CQDA 4Q8GA 3KWBX 2DJGB 4RF0A 1VSNA 3H89A 2R9OA 2OP3A 2NQGA 1AECA 4OW0A 1VJVA 3F5VA 4WA6A 3DF0A 2G6DA 1Y08A 3ZNHA 2DZZA 3HHAA 1KXRA 1PPDA 2IBIA 1ZCMA 4OVZA 3S3QA 5F02A 3W31A 5EF4A 4CZWA 2Z84A 5CHVA 3O1GA 2AIMA 2VHSA 4BOPA 3BCNA 2HHNA 1AU4A 2GFOA 1PXVA 3BPFA 3CH2X 3P5XA 2E02A 1YVBA 3E9SA 1IWDA 1QXPA 1PIPA 5E6JA 2BTWB 4ZTBA 2HH5A 1O0EA 4ZUXU 2UZJA 1F29A 4I04A 3W30A 4CDFB 1KFXL 8PCHA 3V6CA 1PPPA 3PRMA 5EZQA 1GECE 2BU3A 2Y6EA 4MZSA 2FO5A 1CV8A 4I05A 2OZ2A 4PI3A 4QRVA 3U8EA 2O6XA 4KLBA 4RNAA 4BOSA 1PE6A 2G8JA 1F2CA 7PCKA 4K7CA 1THEA 3CH3X 2NQDB 2G8EA 2R9NA 3OQCA 1KFUL 3IV2A 2H7JA 4D8EA 5PADA 3PRPA 4PP2E 2ATOA 3OF8A 3PBHA 3H7DA 1BQIA 4M0WA 3K9MA 4P6EA 1SNKA 4W5CA 3PT2A 2DJFB 3TRKA 1NB3A 4QBBA 4GUAA 1PBHA 2XU4A 4A5UA 2AVWA 2AUXA 1AYVA 4XR7A 1X9YA 4REZA 4PADA 3BWKA 1STFE 4FIPA 5EZSA 2XU3A 2FE8A 1Y4HA 3LXSA 2AU1A 3O0UA 1MS6A 4MSXA 4MI7A 3K8UA 3QJ3A 4X6JA 4BOUA 3PHWA 2JQFR 3E1ZB 5FPWA 3K24A 3PDFA 4BOQA 4RF1A 2IPPB 3RVVA 2R9MA 2ARYA 2B1MA 2AUZA 4OEMA 5JH3A 3MJ5A 3KSEA 4RKXA 4QH6A 2JRIA 1CVZA 2P0RA 1DF0A 4Q8HA 1ME3A 3IMAA 3RVXA 1ME4A 1AU3A 1EWOA 2XU5A 2R9CA 4P16A 1M6DA 1U9VA 1F2AA 1YK8A 3RVWA 2YJ2A 4R3DA 3C0RA 4X6HA 3ZUAA 4IP3A 4P6GA 2AGAA 3CBJA 4OELA 3MTVA 1JQPA 3OVXA 1FH0A 1A6RA 2WBFX 4I07A 4G54A 5K16A 1BP4A 2R6NA 3MHSA 9PAPA 2FRAA 4D8IA 4HXDB 3NHEA 1MIRA 4PP1A 1TLOA 1EWMA 2E00A 3WXGA 2FQ9A 2P86A 1EF7A 1Q6KA 4BS5A 4YYWA 2VHFA 6PADA 4N8WA 2J7QA 3WXEA 1ITOA 3KW9A 4OVZB 3F75A 2DCBA 3N4CA 4XZXA 1F2BA 5JZEA 3LFYA 2B1NA 2PREA 3H6SA 4IUMA 1AYWA 1PPNA 2PNSA 2AS8A 3I3TA 1GCBA 3H8BA 1CS8A 4AXMA 4CDDB 1CPJA 3D6SA 1DKIA 2DCCA 1NPZA 3P5UA 1QOLA 3QT4A 3IFUA 3M99A 3BPMA 2DCAA 3N3KA 3B21A 1KHPA 3H8CA 1ICFA 3P5VA 2G7YA 3ERVA 2NQAA 4MZOA 1AU0A 1MDWA 2F7DA 1POPA 1HUCB 3HHIA 3AI8A 4FK5A 1CTEA 1MEMA 1YZBA 2DC8A 1K3BB 4WURA 1GMYA 2JTCA 2Y5BA 3MORA 2YJBA 3QSDA 4HWYA 5CHTA 4RY2A 3BBAA 3OF9A 4YYSA 3B79A 1QDQA 5A24A 3IOQA 1XKGA 1CSBB 3BC3A 2FYEA 4W5BA 1PVJA 1YALA 3GCBA 4QRGA 1YT7A 2C0YA 3BY4A 2HWKA 3N3GA 3PSEA 3MHHA 2GHUA 2AYOA 4CDEB 4CDCB 2P7UA 3TNXA 2BTWA 3TMPA 1BGOA 5KO3A 3RNVA 2BDLA
chains in the Genus database with same CATH topology
4BSQA 1U9XA 1BY8A 2DC6A 1MEGA 2F1GA 2PBHA 4YV8A 4BQVA 3IUTA 3WXFA 5EGWA 1AIMA 4XUIA 1QMYA 2XU1A 3IEJA 3IHPA 3LTWA 1NQCA 2ACTA 4AXLA 1CB5A 2AYNA 3C9EA 4DMXA 1PPOA 1PCIA 1DEUA 4FJCA 1S4VA 1ZIVA 1CJLA 2CIOA 2DC7A 3PW3A 4GUZA 2E03A 3I06A 2VFBA 4YYQA 3P5WA 2HD5A 1ATKA 4NV7A 1PADA 3OVZA 1YK7A 4DMYA 2BDZA 2JQGR 1U5IA 2YJCA 5JA7A 4N4ZA 3USVA 1U9QX 2YJ9A 2DZYA 2PADA 2E01A 4X6IA 4B55A 5CVNB 3V6EA 1W4TA 1AU2A 4YYUA 2DCDA 4C5PA 4YYVA 3BOWA 1NB5A 2FUDA 4YYRA 3HWNA 1MHWA 3PNRA 1U9WA 3KWZA 1TU6A 2R9FA 5CVMA 3S3RA 3OISA 4QRXA 4YVAA 4BPVA 4N79A 2CB5A 1NL6A 3KX1A 2FT2A 2YJ8A 1NLJA 5CVOB 1AYUA 3KKUA 5J94A 1GLOA 1KHQA 1W6FA 1TL9A 1EWLA 3KFQA 4BS6A 2HXZA 4W4UA 2DC9A 2FRQA 2OULA 2NQIA 1EWPA 2FTDA 3MTNA 1SP4B 3CBKA 3HD3A 1CQDA 4Q8GA 3KWBX 2DJGB 1VSNA 3H89A 2R9OA 2OP3A 2NQGA 1AECA 4NV8A 1VJVA 3F5VA 4WA6A 3DF0A 2G6DA 1Y08A 2DZZA 3HHAA 1KXRA 1PPDA 2IBIA 1E2TA 1ZCMA 3S3QA 5F02A 5EF4A 4CZWA 5CHVA 3O1GA 2AIMA 2VHSA 3BCNA 2HHNA 1AU4A 2GFOA 1PXVA 3BPFA 3CH2X 3P5XA 2E02A 1YVBA 1IWDA 1QXPA 1PIPA 2HH5A 1O0EA 4ZUXU 1F29A 4I04A 4CDFB 1KFXL 8PCHA 3V6CA 1PPPA 1GECE 2Y6EA 4MZSA 2FO5A 1CV8A 4I05A 2OZ2A 4PI3A 4QRVA 3U8EA 2O6XA 4KLBA 1PE6A 2G8JA 1F2CA 7PCKA 2VFCA 4K7CA 1THEA 3CH3X 2NQDB 2G8EA 2R9NA 1KFUL 3IV2A 2H7JA 5PADA 4PP2E 2ATOA 3OF8A 3PBHA 3H7DA 1BQIA 3K9MA 4P6EA 1SNKA 4W5CA 2DJFB 1NB3A 4QBBA 1PBHA 2XU4A 2AVWA 2AUXA 1AYVA 4XR7A 1X9YA 4PADA 3BWKA 1STFE 4FIPA 2XU3A 1GX3A 1Y4HA 3LXSA 2AU1A 3O0UA 1MS6A 4MSXA 3K8UA 3QJ3A 4X6JA 2JQFR 3E1ZB 5FPWA 3K24A 3PDFA 2IPPB 3RVVA 2R9MA 2ARYA 2B1MA 2AUZA 4OEMA 5JH3A 3KSEA 4QH6A 1CVZA 2P0RA 1DF0A 4Q8HA 1ME3A 3IMAA 3RVXA 1ME4A 1AU3A 1EWOA 2XU5A 2R9CA 1M6DA 1U9VA 1F2AA 1YK8A 3RVWA 2YJ2A 4X6HA 3ZUAA 4P6GA 3CBJA 4OELA 1JQPA 3OVXA 1FH0A 1A6RA 2WBFX 4I07A 4G54A 5K16A 1BP4A 2R6NA 3MHSA 9PAPA 2FRAA 3NHEA 1MIRA 4PP1A 1TLOA 1EWMA 2E00A 3WXGA 2FQ9A 2P86A 1EF7A 1Q6KA 4BS5A 4YYWA 2VHFA 3D9WA 6PADA 4N8WA 3WXEA 1ITOA 3KW9A 3F75A 2DCBA 3N4CA 1F2BA 3LFYA 2B1NA 1W5RA 2PREA 3H6SA 1AYWA 1PPNA 2PNSA 2AS8A 3I3TA 1GCBA 3H8BA 1CS8A 4AXMA 4CDDB 1CPJA 3D6SA 2DCCA 1NPZA 3P5UA 1QOLA 3QT4A 3M99A 3BPMA 2DCAA 3N3KA 1KHPA 3H8CA 1ICFA 3P5VA 2G7YA 3ERVA 2BSZA 2NQAA 4MZOA 1AU0A 1MDWA 2F7DA 1POPA 1HUCB 3HHIA 3AI8A 4FK5A 1CTEA 1MEMA 4BGFA 2DC8A 1K3BB 1GMYA 2Y5BA 3MORA 2YJBA 3QSDA 4HWYA 5CHTA 4RY2A 3OF9A 4YYSA 3B79A 1QDQA 5A24A 3IOQA 1XKGA 1CSBB 3BC3A 2FYEA 4W5BA 1YALA 3GCBA 4QRGA 1YT7A 2C0YA 3N3GA 3MHHA 2GHUA 2AYOA 4CDEB 4CDCB 2P7UA 3TNXA 1BGOA 2BDLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BSQ A;  1U9X A;  1BY8 A;  2DC6 A;  1MEG A;  2F1G A;  2PBH A;  4YV8 A;  4BQV A;  3IUT A;  3WXF A;  5EGW A;  1AIM A;  4XUI A;  1QMY A;  2XU1 A;  3IEJ A;  3IHP A;  1NQC A;  2ACT A;  4AXL A;  1CB5 A;  2AYN A;  3C9E A;  4DMX A;  1PPO A;  1PCI A;  1DEU A;  4FJC A;  1S4V A;  1ZIV A;  1CJL A;  2CIO A;  2DC7 A;  3PW3 A;  2E03 A;  3I06 A;  4YYQ A;  3P5W A;  2HD5 A;  1ATK A;  1PAD A;  3OVZ A;  1YK7 A;  4DMY A;  2BDZ A;  2JQG R;  1U5I A;  2YJC A;  5JA7 A;  4N4Z A;  3USV A;  1U9Q X;  2YJ9 A;  2DZY A;  2PAD A;  2E01 A;  4X6I A;  5CVN B;  3V6E A;  1AU2 A;  4YYU A;  2DCD A;  4YYV A;  3BOW A;  1NB5 A;  2FUD A;  4YYR A;  3HWN A;  1MHW A;  3PNR A;  1U9W A;  3KWZ A;  1TU6 A;  2R9F A;  5CVM A;  3S3R A;  3OIS A;  4QRX A;  4YVA A;  4BPV A;  4N79 A;  2CB5 A;  1NL6 A;  3KX1 A;  2FT2 A;  2YJ8 A;  1NLJ A;  5CVO B;  1AYU A;  3KKU A;  5J94 A;  1GLO A;  1KHQ A;  1TL9 A;  1EWL A;  3KFQ A;  4BS6 A;  2HXZ A;  4W4U A;  2DC9 A;  2FRQ A;  2OUL A;  2NQI A;  1EWP A;  2FTD A;  3MTN A;  1SP4 B;  3CBK A;  3HD3 A;  1CQD A;  4Q8G A;  3KWB X;  2DJG B;  1VSN A;  3H89 A;  2R9O A;  2OP3 A;  2NQG A;  1AEC A;  1VJV A;  3F5V A;  4WA6 A;  3DF0 A;  2G6D A;  1Y08 A;  2DZZ A;  3HHA A;  1KXR A;  1PPD A;  2IBI A;  1ZCM A;  3S3Q A;  5F02 A;  5EF4 A;  4CZW A;  5CHV A;  3O1G A;  2AIM A;  2VHS A;  3BCN A;  2HHN A;  1AU4 A;  2GFO A;  1PXV A;  3BPF A;  3CH2 X;  3P5X A;  2E02 A;  1YVB A;  1IWD A;  1QXP A;  1PIP A;  2HH5 A;  1O0E A;  4ZUX U;  1F29 A;  4I04 A;  4CDF B;  1KFX L;  8PCH A;  3V6C A;  1PPP A;  1GEC E;  2Y6E A;  4MZS A;  2FO5 A;  1CV8 A;  4I05 A;  2OZ2 A;  4PI3 A;  4QRV A;  3U8E A;  2O6X A;  4KLB A;  1PE6 A;  2G8J A;  1F2C A;  7PCK A;  4K7C A;  1THE A;  3CH3 X;  2NQD B;  2G8E A;  2R9N A;  1KFU L;  3IV2 A;  2H7J A;  5PAD A;  4PP2 E;  2ATO A;  3OF8 A;  3PBH A;  3H7D A;  1BQI A;  3K9M A;  4P6E A;  1SNK A;  4W5C A;  2DJF B;  1NB3 A;  4QBB A;  1PBH A;  2XU4 A;  2AVW A;  2AUX A;  1AYV A;  4XR7 A;  1X9Y A;  4PAD A;  3BWK A;  1STF E;  4FIP A;  2XU3 A;  1Y4H A;  3LXS A;  2AU1 A;  3O0U A;  1MS6 A;  4MSX A;  3K8U A;  3QJ3 A;  4X6J A;  2JQF R;  3E1Z B;  5FPW A;  3K24 A;  3PDF A;  2IPP B;  3RVV A;  2R9M A;  2ARY A;  2B1M A;  2AUZ A;  4OEM A;  5JH3 A;  3KSE A;  4QH6 A;  1CVZ A;  2P0R A;  1DF0 A;  4Q8H A;  1ME3 A;  3IMA A;  3RVX A;  1ME4 A;  1AU3 A;  1EWO A;  2XU5 A;  2R9C A;  1M6D A;  1U9V A;  1F2A A;  1YK8 A;  3RVW A;  2YJ2 A;  4X6H A;  3ZUA A;  4P6G A;  3CBJ A;  4OEL A;  1JQP A;  3OVX A;  1FH0 A;  1A6R A;  2WBF X;  4I07 A;  4G54 A;  5K16 A;  1BP4 A;  2R6N A;  3MHS A;  9PAP A;  2FRA A;  3NHE A;  1MIR A;  4PP1 A;  1TLO A;  1EWM A;  2E00 A;  3WXG A;  2FQ9 A;  2P86 A;  1EF7 A;  1Q6K A;  4BS5 A;  4YYW A;  2VHF A;  6PAD A;  4N8W A;  3WXE A;  1ITO A;  3KW9 A;  3F75 A;  2DCB A;  3N4C A;  1F2B A;  3LFY A;  2B1N A;  2PRE A;  3H6S A;  1AYW A;  1PPN A;  2PNS A;  2AS8 A;  3I3T A;  1GCB A;  3H8B A;  1CS8 A;  4AXM A;  4CDD B;  1CPJ A;  3D6S A;  2DCC A;  1NPZ A;  3P5U A;  1QOL A;  3QT4 A;  3M99 A;  3BPM A;  2DCA A;  3N3K A;  1KHP A;  3H8C A;  1ICF A;  3P5V A;  2G7Y A;  3ERV A;  2NQA A;  4MZO A;  1AU0 A;  1MDW A;  2F7D A;  1POP A;  1HUC B;  3HHI A;  3AI8 A;  4FK5 A;  1CTE A;  1MEM A;  2DC8 A;  1K3B B;  1GMY A;  2Y5B A;  3MOR A;  2YJB A;  3QSD A;  4HWY A;  5CHT A;  4RY2 A;  3OF9 A;  4YYS A;  3B79 A;  1QDQ A;  5A24 A;  3IOQ A;  1XKG A;  1CSB B;  3BC3 A;  2FYE A;  4W5B A;  1YAL A;  3GCB A;  4QRG A;  1YT7 A;  2C0Y A;  3N3G A;  3MHH A;  2GHU A;  2AYO A;  4CDE B;  4CDC B;  2P7U A;  3TNX A;  1BGO A;  2BDL A; 
#chains in the Genus database with same CATH topology
 4BSQ A;  1U9X A;  1BY8 A;  2DC6 A;  3PHX A;  1MEG A;  2F1G A;  2PBH A;  4YV8 A;  4BQV A;  3IUT A;  3WXF A;  5EGW A;  1AIM A;  4XUI A;  1QMY A;  2XU1 A;  3IEJ A;  3IHP A;  4PT5 A;  1NQC A;  2ACT A;  4AXL A;  1CB5 A;  2AYN A;  3C9E A;  4DMX A;  1PPO A;  1PCI A;  1DEU A;  4FJC A;  1S4V A;  1ZIV A;  1CJL A;  2CIO A;  2DC7 A;  3PW3 A;  4BOZ A;  2E03 A;  3I06 A;  4YYQ A;  3P5W A;  3PHU A;  2HD5 A;  1ATK A;  4D8B A;  1PAD A;  3OVZ A;  1YK7 A;  4DMY A;  2BDZ A;  2J7Q C;  2JQG R;  1U5I A;  2YJC A;  5JA7 A;  4N4Z A;  3USV A;  1U9Q X;  2YJ9 A;  2DZY A;  2PAD A;  2E01 A;  4X6I A;  5CVN B;  3V6E A;  3MP2 A;  1AU2 A;  4YYU A;  2DCD A;  4YYV A;  3BOW A;  1NB5 A;  2FUD A;  4YYR A;  3HWN A;  1MHW A;  3PNR A;  1U9W A;  3KWZ A;  1TU6 A;  2R9F A;  5CVM A;  3S3R A;  3OIS A;  4QRX A;  4YVA A;  4BPV A;  4N79 A;  2CB5 A;  1NL6 A;  3KX1 A;  2FT2 A;  2YJ8 A;  4MM3 B;  1NLJ A;  5CVO B;  1AYU A;  3KKU A;  5J94 A;  1GLO A;  2DOS A;  1KHQ A;  1TL9 A;  1EWL A;  3KFQ A;  4BS6 A;  2HXZ A;  3BB7 A;  4W4U A;  3O65 A;  2DC9 A;  2FRQ A;  1UKF A;  2OUL A;  2NQI A;  1EWP A;  2FTD A;  3MTN A;  1SP4 B;  3CBK A;  3HD3 A;  1CQD A;  4Q8G A;  3KWB X;  2DJG B;  4RF0 A;  1VSN A;  3H89 A;  2R9O A;  2OP3 A;  2NQG A;  1AEC A;  4OW0 A;  1VJV A;  3F5V A;  4WA6 A;  3DF0 A;  2G6D A;  1Y08 A;  3ZNH A;  2DZZ A;  3HHA A;  1KXR A;  1PPD A;  2IBI A;  1ZCM A;  4OVZ A;  3S3Q A;  5F02 A;  3W31 A;  5EF4 A;  4CZW A;  2Z84 A;  5CHV A;  3O1G A;  2AIM A;  2VHS A;  4BOP A;  3BCN A;  2HHN A;  1AU4 A;  2GFO A;  1PXV A;  3BPF A;  3CH2 X;  3P5X A;  2E02 A;  1YVB A;  3E9S A;  1IWD A;  1QXP A;  1PIP A;  5E6J A;  2BTW B;  4ZTB A;  2HH5 A;  1O0E A;  4ZUX U;  2UZJ A;  1F29 A;  4I04 A;  3W30 A;  4CDF B;  1KFX L;  8PCH A;  3V6C A;  1PPP A;  3PRM A;  5EZQ A;  1GEC E;  2BU3 A;  2Y6E A;  4MZS A;  2FO5 A;  1CV8 A;  4I05 A;  2OZ2 A;  4PI3 A;  4QRV A;  3U8E A;  2O6X A;  4KLB A;  4RNA A;  4BOS A;  1PE6 A;  2G8J A;  1F2C A;  7PCK A;  4K7C A;  1THE A;  3CH3 X;  2NQD B;  2G8E A;  2R9N A;  3OQC A;  1KFU L;  3IV2 A;  2H7J A;  4D8E A;  5PAD A;  3PRP A;  4PP2 E;  2ATO A;  3OF8 A;  3PBH A;  3H7D A;  1BQI A;  4M0W A;  3K9M A;  4P6E A;  1SNK A;  4W5C A;  3PT2 A;  2DJF B;  3TRK A;  1NB3 A;  4QBB A;  4GUA A;  1PBH A;  2XU4 A;  4A5U A;  2AVW A;  2AUX A;  1AYV A;  4XR7 A;  1X9Y A;  4REZ A;  4PAD A;  3BWK A;  1STF E;  4FIP A;  5EZS A;  2XU3 A;  2FE8 A;  1Y4H A;  3LXS A;  2AU1 A;  3O0U A;  1MS6 A;  4MSX A;  4MI7 A;  3K8U A;  3QJ3 A;  4X6J A;  4BOU A;  3PHW A;  2JQF R;  3E1Z B;  5FPW A;  3K24 A;  3PDF A;  4BOQ A;  4RF1 A;  2IPP B;  3RVV A;  2R9M A;  2ARY A;  2B1M A;  2AUZ A;  4OEM A;  5JH3 A;  3MJ5 A;  3KSE A;  4RKX A;  4QH6 A;  2JRI A;  1CVZ A;  2P0R A;  1DF0 A;  4Q8H A;  1ME3 A;  3IMA A;  3RVX A;  1ME4 A;  1AU3 A;  1EWO A;  2XU5 A;  2R9C A;  4P16 A;  1M6D A;  1U9V A;  1F2A A;  1YK8 A;  3RVW A;  2YJ2 A;  4R3D A;  3C0R A;  4X6H A;  3ZUA A;  4IP3 A;  4P6G A;  2AGA A;  3CBJ A;  4OEL A;  3MTV A;  1JQP A;  3OVX A;  1FH0 A;  1A6R A;  2WBF X;  4I07 A;  4G54 A;  5K16 A;  1BP4 A;  2R6N A;  3MHS A;  9PAP A;  2FRA A;  4D8I A;  4HXD B;  3NHE A;  1MIR A;  4PP1 A;  1TLO A;  1EWM A;  2E00 A;  3WXG A;  2FQ9 A;  2P86 A;  1EF7 A;  1Q6K A;  4BS5 A;  4YYW A;  2VHF A;  6PAD A;  4N8W A;  2J7Q A;  3WXE A;  1ITO A;  3KW9 A;  4OVZ B;  3F75 A;  2DCB A;  3N4C A;  4XZX A;  1F2B A;  5JZE A;  3LFY A;  2B1N A;  2PRE A;  3H6S A;  4IUM A;  1AYW A;  1PPN A;  2PNS A;  2AS8 A;  3I3T A;  1GCB A;  3H8B A;  1CS8 A;  4AXM A;  4CDD B;  1CPJ A;  3D6S A;  1DKI A;  2DCC A;  1NPZ A;  3P5U A;  1QOL A;  3QT4 A;  3IFU A;  3M99 A;  3BPM A;  2DCA A;  3N3K A;  3B21 A;  1KHP A;  3H8C A;  1ICF A;  3P5V A;  2G7Y A;  3ERV A;  2NQA A;  4MZO A;  1AU0 A;  1MDW A;  2F7D A;  1POP A;  1HUC B;  3HHI A;  3AI8 A;  4FK5 A;  1CTE A;  1MEM A;  1YZB A;  2DC8 A;  1K3B B;  4WUR A;  1GMY A;  2JTC A;  2Y5B A;  3MOR A;  2YJB A;  3QSD A;  4HWY A;  5CHT A;  4RY2 A;  3BBA A;  3OF9 A;  4YYS A;  3B79 A;  1QDQ A;  5A24 A;  3IOQ A;  1XKG A;  1CSB B;  3BC3 A;  2FYE A;  4W5B A;  1PVJ A;  1YAL A;  3GCB A;  4QRG A;  1YT7 A;  2C0Y A;  3BY4 A;  2HWK A;  3N3G A;  3PSE A;  3MHH A;  2GHU A;  2AYO A;  4CDE B;  4CDC B;  2P7U A;  3TNX A;  2BTW A;  3TMP A;  1BGO A;  5KO3 A;  3RNV A;  2BDL A; 
#chains in the Genus database with same CATH homology
 4BSQ A;  1U9X A;  1BY8 A;  2DC6 A;  1MEG A;  2F1G A;  2PBH A;  4YV8 A;  4BQV A;  3IUT A;  3WXF A;  5EGW A;  1AIM A;  4XUI A;  1QMY A;  2XU1 A;  3IEJ A;  3IHP A;  3LTW A;  1NQC A;  2ACT A;  4AXL A;  1CB5 A;  2AYN A;  3C9E A;  4DMX A;  1PPO A;  1PCI A;  1DEU A;  4FJC A;  1S4V A;  1ZIV A;  1CJL A;  2CIO A;  2DC7 A;  3PW3 A;  4GUZ A;  2E03 A;  3I06 A;  2VFB A;  4YYQ A;  3P5W A;  2HD5 A;  1ATK A;  4NV7 A;  1PAD A;  3OVZ A;  1YK7 A;  4DMY A;  2BDZ A;  2JQG R;  1U5I A;  2YJC A;  5JA7 A;  4N4Z A;  3USV A;  1U9Q X;  2YJ9 A;  2DZY A;  2PAD A;  2E01 A;  4X6I A;  4B55 A;  5CVN B;  3V6E A;  1W4T A;  1AU2 A;  4YYU A;  2DCD A;  4C5P A;  4YYV A;  3BOW A;  1NB5 A;  2FUD A;  4YYR A;  3HWN A;  1MHW A;  3PNR A;  1U9W A;  3KWZ A;  1TU6 A;  2R9F A;  5CVM A;  3S3R A;  3OIS A;  4QRX A;  4YVA A;  4BPV A;  4N79 A;  2CB5 A;  1NL6 A;  3KX1 A;  2FT2 A;  2YJ8 A;  1NLJ A;  5CVO B;  1AYU A;  3KKU A;  5J94 A;  1GLO A;  1KHQ A;  1W6F A;  1TL9 A;  1EWL A;  3KFQ A;  4BS6 A;  2HXZ A;  4W4U A;  2DC9 A;  2FRQ A;  2OUL A;  2NQI A;  1EWP A;  2FTD A;  3MTN A;  1SP4 B;  3CBK A;  3HD3 A;  1CQD A;  4Q8G A;  3KWB X;  2DJG B;  1VSN A;  3H89 A;  2R9O A;  2OP3 A;  2NQG A;  1AEC A;  4NV8 A;  1VJV A;  3F5V A;  4WA6 A;  3DF0 A;  2G6D A;  1Y08 A;  2DZZ A;  3HHA A;  1KXR A;  1PPD A;  2IBI A;  1E2T A;  1ZCM A;  3S3Q A;  5F02 A;  5EF4 A;  4CZW A;  5CHV A;  3O1G A;  2AIM A;  2VHS A;  3BCN A;  2HHN A;  1AU4 A;  2GFO A;  1PXV A;  3BPF A;  3CH2 X;  3P5X A;  2E02 A;  1YVB A;  1IWD A;  1QXP A;  1PIP A;  2HH5 A;  1O0E A;  4ZUX U;  1F29 A;  4I04 A;  4CDF B;  1KFX L;  8PCH A;  3V6C A;  1PPP A;  1GEC E;  2Y6E A;  4MZS A;  2FO5 A;  1CV8 A;  4I05 A;  2OZ2 A;  4PI3 A;  4QRV A;  3U8E A;  2O6X A;  4KLB A;  1PE6 A;  2G8J A;  1F2C A;  7PCK A;  2VFC A;  4K7C A;  1THE A;  3CH3 X;  2NQD B;  2G8E A;  2R9N A;  1KFU L;  3IV2 A;  2H7J A;  5PAD A;  4PP2 E;  2ATO A;  3OF8 A;  3PBH A;  3H7D A;  1BQI A;  3K9M A;  4P6E A;  1SNK A;  4W5C A;  2DJF B;  1NB3 A;  4QBB A;  1PBH A;  2XU4 A;  2AVW A;  2AUX A;  1AYV A;  4XR7 A;  1X9Y A;  4PAD A;  3BWK A;  1STF E;  4FIP A;  2XU3 A;  1GX3 A;  1Y4H A;  3LXS A;  2AU1 A;  3O0U A;  1MS6 A;  4MSX A;  3K8U A;  3QJ3 A;  4X6J A;  2JQF R;  3E1Z B;  5FPW A;  3K24 A;  3PDF A;  2IPP B;  3RVV A;  2R9M A;  2ARY A;  2B1M A;  2AUZ A;  4OEM A;  5JH3 A;  3KSE A;  4QH6 A;  1CVZ A;  2P0R A;  1DF0 A;  4Q8H A;  1ME3 A;  3IMA A;  3RVX A;  1ME4 A;  1AU3 A;  1EWO A;  2XU5 A;  2R9C A;  1M6D A;  1U9V A;  1F2A A;  1YK8 A;  3RVW A;  2YJ2 A;  4X6H A;  3ZUA A;  4P6G A;  3CBJ A;  4OEL A;  1JQP A;  3OVX A;  1FH0 A;  1A6R A;  2WBF X;  4I07 A;  4G54 A;  5K16 A;  1BP4 A;  2R6N A;  3MHS A;  9PAP A;  2FRA A;  3NHE A;  1MIR A;  4PP1 A;  1TLO A;  1EWM A;  2E00 A;  3WXG A;  2FQ9 A;  2P86 A;  1EF7 A;  1Q6K A;  4BS5 A;  4YYW A;  2VHF A;  3D9W A;  6PAD A;  4N8W A;  3WXE A;  1ITO A;  3KW9 A;  3F75 A;  2DCB A;  3N4C A;  1F2B A;  3LFY A;  2B1N A;  1W5R A;  2PRE A;  3H6S A;  1AYW A;  1PPN A;  2PNS A;  2AS8 A;  3I3T A;  1GCB A;  3H8B A;  1CS8 A;  4AXM A;  4CDD B;  1CPJ A;  3D6S A;  2DCC A;  1NPZ A;  3P5U A;  1QOL A;  3QT4 A;  3M99 A;  3BPM A;  2DCA A;  3N3K A;  1KHP A;  3H8C A;  1ICF A;  3P5V A;  2G7Y A;  3ERV A;  2BSZ A;  2NQA A;  4MZO A;  1AU0 A;  1MDW A;  2F7D A;  1POP A;  1HUC B;  3HHI A;  3AI8 A;  4FK5 A;  1CTE A;  1MEM A;  4BGF A;  2DC8 A;  1K3B B;  1GMY A;  2Y5B A;  3MOR A;  2YJB A;  3QSD A;  4HWY A;  5CHT A;  4RY2 A;  3OF9 A;  4YYS A;  3B79 A;  1QDQ A;  5A24 A;  3IOQ A;  1XKG A;  1CSB B;  3BC3 A;  2FYE A;  4W5B A;  1YAL A;  3GCB A;  4QRG A;  1YT7 A;  2C0Y A;  3N3G A;  3MHH A;  2GHU A;  2AYO A;  4CDE B;  4CDC B;  2P7U A;  3TNX A;  1BGO A;  2BDL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...