4I07A

Structure of mature form of cathepsin b1 from schistosoma mansoni
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
253
structure length
252
Chain Sequence
EIPSSFDSRKKWPRCKSIATIRDQSRCGSWAFGAVEAMSDRSCIQSGGKQNVELSAVDLLSCCESCGLGCEGGILGPAWDYWVKEGIVTGSSKENHAGCEPYPFPKCEHHTKGKYPPCGSKIYKTPRCKQTCQKKYKTPYTQDKHRGKSSYNVKNDEKAIQKEIMKYGPVEAGFTVYEDFLNYKSGIYKHITGETLGGHAIRIIGWGVENKAPYWLIANSWNEDWGENGYFRIVRGRDECSIESEVTAGRIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Cathepsin B-like peptidase (C01 family)
publication title Activation route of the Schistosoma mansoni cathepsin B1 drug target: structural map with a glycosaminoglycan switch
pubmed doi rcsb
source organism Schistosoma mansoni
total genus 81
structure length 252
sequence length 253
ec nomenclature ec 3.4.22.1: Cathepsin B.
pdb deposition date 2012-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 4i07A00
1ME4A 2HHNA 4QRGA 4K7CA 3K24A 1YK8A 1MEGA 4BS6A 5JA7A 2NQIA 1PPNA 2E02A 2BDZA 2P7UA 3QSDA 1U9VA 3OVXA 4CDFB 1PXVA 1YK7A 1U9WA 2AYNA 1ITOA 4YYUA 3RVVA 3CH2X 2DCDA 2R6NA 1AECA 3KFQA 1CJLA 4P6EA 3K9MA 2G7YA 2HD5A 4KLBA 4N8WA 3D6SA 1F2AA 1TL9A 1NB3A 1KFUL 3QT4A 1AU4A 2NQDB 4YVAA 1POPA 2FRQA 2HXZA 3IUTA 3I3TA 3BWKA 2E03A 4FIPA 4MSXA 3V6EA 3B79A 1F2CA 5EF4A 1S4VA 2DC7A 3P5UA 3H8BA 2AVWA 1U9QX 1K3BB 1PBHA 2BDLA 3H8CA 4CZWA 3KW9A 1PE6A 2R9OA 1PCIA 2CIOA 4XUIA 3USVA 3KSEA 3BPFA 4DMXA 2AUXA 3OF8A 3U8EA 1Y08A 2F1GA 1O0EA 2WBFX 1CVZA 1EWMA 4YYWA 1QXPA 2F7DA 4DMYA 4N79A 1CV8A 4PP2E 3QJ3A 5CHTA 4HWYA 4OELA 1THEA 1NQCA 1MIRA 4QH6A 1Q6KA 2DCCA 2NQAA 3DF0A 3WXFA 1Y4HA 4PI3A 1KXRA 4N4ZA 3HHIA 5K16A 2O6XA 4P6GA 4BPVA 3P5WA 1NPZA 2DJFB 3WXGA 1PPDA 1VJVA 2B1MA 1AU3A 4FK5A 2P0RA 2PADA 5FPWA 3V6CA 1STFE 1BQIA 3K8UA 5CVNB 2IBIA 3IEJA 3KWZA 4QRXA 3BC3A 1SNKA 2DC8A 1MHWA 4RY2A 4XR7A 2FQ9A 2NQGA 3OVZA 1NLJA 4BQVA 2ACTA 3RVXA 3F5VA 1VSNA 1QMYA 3BPMA 1SP4B 3CBJA 4MZOA 3GCBA 2PNSA 4YYRA 3HD3A 1YT7A 1A6RA 4X6JA 3OISA 1TU6A 3KWBX 9PAPA 3PNRA 3N3GA 1PIPA 1QDQA 1XKGA 1YVBA 2XU3A 1HUCB 2AU1A 3HWNA 3KX1A 4W5CA 3IV2A 3TNXA 4W4UA 1DEUA 2G8EA 1GLOA 4BSQA 4YV8A 3WXEA 3MHSA 1CS8A 3I06A 3BCNA 2E00A 2R9CA 4G54A 4CDCB 2R9NA 4X6IA 4QBBA 2FTDA 4FJCA 4YYVA 2HH5A 3N4CA 2YJBA 3H7DA 1CPJA 2PBHA 1PPPA 6PADA 3CH3X 3S3RA 2ARYA 5EGWA 3H6SA 3E1ZB 2ATOA 4OEMA 1DF0A 3MORA 1X9YA 3N3KA 4ZUXU 3ZUAA 2VHSA 2DJGB 2OP3A 2R9MA 1GCBA 4W5BA 4I04A 2YJ8A 1F29A 1ZIVA 1ZCMA 2DCBA 3MTNA 3LXSA 1EWPA 1EF7A 3PBHA 2AIMA 3CBKA 4X6HA 3MHHA 1ME3A 1BY8A 1ATKA 1CSBB 1YALA 1FH0A 4PP1A 3C9EA 1MEMA 2DC9A 2FRAA 1GECE 3S3QA 1BGOA 2DC6A 1AYVA 1JQPA 2FT2A 3PDFA 3ERVA 4AXLA 2Y5BA 4MZSA 3IHPA 3HHAA 1CB5A 5F02A 4BS5A 3NHEA 3LFYA 1ICFA 4Q8GA 4YYQA 5JH3A 2XU1A 5CVOB 2VHFA 4YYSA 5PADA 1AU2A 1QOLA 1PADA 3H89A 1MDWA 1MS6A 2DCAA 4PADA 4QRVA 1AYWA 1F2BA 4WA6A 2FYEA 1U5IA 2JQFR 3AI8A 1U9XA 2AS8A 2OULA 5J94A 4AXMA 4CDEB 2B1NA 2R9FA 2JQGR 2DZYA 2DZZA 2AUZA 3OF9A 3O1GA 1EWLA 7PCKA 1AIMA 1TLOA 2E01A 4CDDB 3P5XA 3PW3A 3O0UA 2YJCA 2FUDA 5CVMA 2Y6EA 2YJ9A 4Q8HA 5CHVA 2YJ2A 4I05A 1GMYA 3KKUA 2C0YA 2XU4A 8PCHA 1NB5A 1IWDA 2GFOA 1AU0A 3RVWA 2XU5A 3M99A 1KFXL 1PPOA 2G8JA 4I07A 1EWOA 1AYUA 2GHUA 3F75A 2CB5A 3IMAA 2G6DA 1CTEA 2P86A 1NL6A 1CQDA 3BOWA 2OZ2A 2AYOA 3P5VA 1M6DA 2FO5A 1BP4A 2H7JA 1KHPA 5A24A 2PREA 1KHQA 3IOQA 2IPPB
chains in the Genus database with same CATH superfamily
1ME4A 2HHNA 4QRGA 4GUAA 4K7CA 3K24A 1YK8A 1MEGA 4BS6A 2UZJA 5JA7A 2NQIA 1PPNA 2E02A 2BDZA 2P7UA 3QSDA 1U9VA 3OVXA 4CDFB 1PXVA 1YK7A 1U9WA 2AYNA 1ITOA 1PVJA 3BBAA 4HXDB 4YYUA 3RVVA 3E9SA 4WURA 3CH2X 2DCDA 3PSEA 2R6NA 1AECA 3KFQA 1CJLA 3K9MA 4P6EA 2G7YA 2HD5A 4KLBA 3PHWA 4MI7A 4N8WA 4PT5A 3D6SA 1F2AA 1TL9A 1NB3A 1KFUL 3QT4A 2Z84A 1AU4A 2NQDB 4YVAA 1POPA 2FRQA 2HXZA 3IUTA 3I3TA 3BWKA 5EZQA 2E03A 4FIPA 4MSXA 3V6EA 3B79A 1F2CA 5EZSA 5EF4A 1S4VA 2DC7A 3P5UA 3H8BA 3PRPA 3PHUA 3OQCA 2AVWA 1U9QX 1K3BB 1PBHA 2BDLA 3H8CA 4CZWA 3KW9A 1PE6A 2JRIA 1PCIA 2CIOA 2R9OA 4XUIA 3MP2A 3USVA 3KSEA 3BPFA 4DMXA 2AUXA 3OF8A 3U8EA 1Y08A 2F1GA 1O0EA 2WBFX 1CVZA 1EWMA 4YYWA 1QXPA 2F7DA 4DMYA 4N79A 1CV8A 4PP2E 4RF1A 3QJ3A 5JZEA 5CHTA 4HWYA 4OELA 1THEA 1NQCA 1MIRA 4QH6A 1Q6KA 2DCCA 4OVZA 2NQAA 3DF0A 3WXFA 1Y4HA 4PI3A 1KXRA 4N4ZA 3HHIA 4ZTBA 5K16A 4P16A 2O6XA 4MM3B 4P6GA 4A5UA 4BPVA 3P5WA 1NPZA 2DJFB 3WXGA 1PPDA 1VJVA 2B1MA 1AU3A 4FK5A 2P0RA 4REZA 3MTVA 2PADA 5FPWA 3V6CA 1STFE 1BQIA 3K8UA 5CVNB 2IBIA 3IEJA 3B21A 3KWZA 4QRXA 3BC3A 1SNKA 2DC8A 1MHWA 4RY2A 4XR7A 2FQ9A 2NQGA 3OVZA 1NLJA 4BQVA 2ACTA 3RVXA 3F5VA 1VSNA 1QMYA 3BPMA 1SP4B 3CBJA 4BOZA 4MZOA 3GCBA 2PNSA 4YYRA 3HD3A 1YT7A 1A6RA 4X6JA 3OISA 1TU6A 3KWBX 9PAPA 4OW0A 3PNRA 3N3GA 3TRKA 1PIPA 1QDQA 1XKGA 1YVBA 2XU3A 1HUCB 3W30A 2HWKA 2AU1A 3HWNA 3KX1A 4W5CA 3IV2A 3TNXA 4BOUA 4W4UA 3BB7A 1DEUA 2G8EA 1GLOA 4BSQA 4YV8A 3WXEA 3MHSA 1CS8A 3I06A 3BCNA 2E00A 2R9CA 4G54A 4CDCB 2R9NA 4X6IA 2J7QC 4QBBA 2FTDA 4FJCA 4YYVA 2HH5A 3N4CA 2YJBA 3H7DA 1CPJA 2PBHA 1PPPA 6PADA 3CH3X 3S3RA 2ARYA 5EGWA 3H6SA 3E1ZB 1YZBA 2ATOA 4IP3A 4OEMA 1DF0A 3MORA 1X9YA 5E6JA 3N3KA 4ZUXU 3O65A 3ZUAA 2VHSA 4R3DA 3BY4A 2DJGB 2OP3A 3PRMA 2R9MA 1GCBA 4W5BA 4I04A 2YJ8A 1F29A 1ZIVA 1ZCMA 2DCBA 3MTNA 3LXSA 1EWPA 1EF7A 4RNAA 3PBHA 2AIMA 2BTWB 3CBKA 4X6HA 4BOSA 4D8EA 3MHHA 1ME3A 1BY8A 2DOSA 1ATKA 1CSBB 1YALA 1FH0A 4OVZB 4PP1A 3C9EA 1MEMA 2DC9A 2FRAA 3TMPA 1GECE 3S3QA 1BGOA 2DC6A 1AYVA 1JQPA 2FT2A 3PDFA 2AGAA 3ERVA 4AXLA 2Y5BA 4MZSA 3IHPA 3HHAA 1CB5A 5F02A 4BS5A 3NHEA 4IUMA 3LFYA 5KO3A 1ICFA 2JTCA 4Q8GA 4YYQA 5JH3A 2XU1A 5CVOB 2VHFA 4YYSA 5PADA 1AU2A 1QOLA 3IFUA 1PADA 3H89A 1MDWA 4BOPA 1MS6A 2DCAA 4PADA 4RF0A 4RKXA 4QRVA 1AYWA 1F2BA 4WA6A 2FYEA 1U5IA 3C0RA 2JQFR 3W31A 3AI8A 1U9XA 2AS8A 2OULA 4D8IA 5J94A 4AXMA 4CDEB 2B1NA 2R9FA 2JQGR 2DZYA 2BU3A 2DZZA 3PT2A 1DKIA 2AUZA 3OF9A 3ZNHA 3O1GA 3RNVA 1EWLA 7PCKA 1AIMA 1TLOA 2E01A 4CDDB 3P5XA 4D8BA 3PW3A 3O0UA 2YJCA 2FUDA 5CVMA 2Y6EA 2YJ9A 4Q8HA 5CHVA 2YJ2A 4BOQA 4I05A 1GMYA 3KKUA 2C0YA 2XU4A 3MJ5A 8PCHA 1NB5A 1IWDA 2GFOA 1AU0A 2J7QA 3RVWA 2XU5A 3M99A 1KFXL 1PPOA 2G8JA 4I07A 1EWOA 1AYUA 2GHUA 3F75A 2FE8A 2BTWA 2CB5A 3IMAA 2G6DA 4M0WA 1UKFA 1CTEA 2P86A 1NL6A 1CQDA 3BOWA 2OZ2A 2AYOA 3PHXA 3P5VA 1M6DA 2FO5A 1BP4A 2H7JA 1KHPA 4XZXA 5A24A 2PREA 1KHQA 3IOQA 2IPPB
chains in the Genus database with same CATH topology
1ME4A 2HHNA 4QRGA 4K7CA 3K24A 1YK8A 1MEGA 4BS6A 5JA7A 2NQIA 1PPNA 2E02A 2BDZA 2P7UA 3QSDA 1U9VA 3OVXA 4CDFB 1PXVA 1YK7A 1U9WA 2AYNA 1ITOA 4YYUA 3RVVA 3CH2X 2DCDA 2R6NA 1AECA 3KFQA 1CJLA 3K9MA 4P6EA 2G7YA 2HD5A 4KLBA 3LTWA 4C5PA 4N8WA 3D6SA 1F2AA 1TL9A 1NB3A 1KFUL 3QT4A 1AU4A 2NQDB 4YVAA 1POPA 2FRQA 2HXZA 3IUTA 3I3TA 3BWKA 2E03A 4FIPA 2BSZA 4MSXA 3V6EA 3B79A 1F2CA 5EF4A 1S4VA 2DC7A 3P5UA 3H8BA 2AVWA 1U9QX 1K3BB 1PBHA 2BDLA 3H8CA 4CZWA 3KW9A 1PE6A 2R9OA 1PCIA 2CIOA 1W4TA 4XUIA 3USVA 3KSEA 3BPFA 4DMXA 2AUXA 3OF8A 3U8EA 1Y08A 2F1GA 1O0EA 2WBFX 1CVZA 1EWMA 4YYWA 1QXPA 2F7DA 4DMYA 4N79A 1CV8A 4PP2E 3QJ3A 5CHTA 4HWYA 4OELA 1THEA 2VFCA 1NQCA 1MIRA 4QH6A 1Q6KA 2DCCA 2NQAA 3DF0A 3WXFA 1Y4HA 4PI3A 1KXRA 4N4ZA 3HHIA 5K16A 2O6XA 4P6GA 4BPVA 3P5WA 1NPZA 2DJFB 3WXGA 1PPDA 1VJVA 2B1MA 1AU3A 4FK5A 2P0RA 2PADA 5FPWA 3V6CA 1STFE 1BQIA 3K8UA 5CVNB 2IBIA 3IEJA 3KWZA 4QRXA 3BC3A 1SNKA 2DC8A 1MHWA 4RY2A 4XR7A 2FQ9A 2NQGA 3OVZA 1NLJA 4BQVA 2ACTA 3RVXA 3F5VA 1VSNA 1QMYA 3BPMA 1SP4B 3CBJA 4MZOA 3GCBA 2PNSA 4YYRA 3HD3A 1YT7A 1A6RA 4X6JA 3OISA 1TU6A 3KWBX 9PAPA 3PNRA 3N3GA 1PIPA 1QDQA 1XKGA 1YVBA 2XU3A 1HUCB 2AU1A 3HWNA 3KX1A 4W5CA 3IV2A 3TNXA 4W4UA 1DEUA 2G8EA 1GLOA 4BSQA 4YV8A 3WXEA 3MHSA 1CS8A 3I06A 3BCNA 2E00A 2R9CA 4G54A 4CDCB 2R9NA 4X6IA 4QBBA 2FTDA 4FJCA 4YYVA 2HH5A 3N4CA 2YJBA 3H7DA 1CPJA 2PBHA 1GX3A 1PPPA 6PADA 3CH3X 3S3RA 2ARYA 5EGWA 3H6SA 3E1ZB 2ATOA 4OEMA 1DF0A 3MORA 1X9YA 3N3KA 4ZUXU 3ZUAA 2VHSA 4NV7A 2DJGB 2OP3A 2R9MA 2VFBA 1GCBA 4W5BA 4I04A 2YJ8A 1F29A 1ZIVA 1ZCMA 2DCBA 3MTNA 3LXSA 1EWPA 1EF7A 3PBHA 2AIMA 3CBKA 4X6HA 3MHHA 1ME3A 1BY8A 1ATKA 1CSBB 1YALA 1FH0A 4PP1A 3C9EA 1MEMA 2DC9A 2FRAA 4GUZA 1GECE 3S3QA 1BGOA 1W5RA 2DC6A 1AYVA 1JQPA 2FT2A 3PDFA 3ERVA 4AXLA 2Y5BA 4MZSA 3IHPA 3HHAA 1CB5A 5F02A 4BS5A 3NHEA 3LFYA 1ICFA 4NV8A 4Q8GA 4YYQA 5JH3A 2XU1A 5CVOB 2VHFA 4YYSA 5PADA 1AU2A 1QOLA 1PADA 3H89A 1MDWA 1MS6A 2DCAA 4PADA 4QRVA 1AYWA 1F2BA 4WA6A 2FYEA 1U5IA 1W6FA 2JQFR 3AI8A 1U9XA 2AS8A 3D9WA 2OULA 5J94A 4AXMA 4CDEB 2B1NA 4BGFA 2R9FA 2JQGR 2DZYA 2DZZA 2AUZA 3OF9A 3O1GA 1EWLA 7PCKA 1AIMA 1TLOA 4B55A 2E01A 4CDDB 3P5XA 3PW3A 3O0UA 2YJCA 2FUDA 5CVMA 2Y6EA 2YJ9A 4Q8HA 5CHVA 2YJ2A 4I05A 1GMYA 3KKUA 2C0YA 2XU4A 8PCHA 1E2TA 1NB5A 1IWDA 2GFOA 1AU0A 3RVWA 2XU5A 3M99A 1KFXL 1PPOA 2G8JA 4I07A 1EWOA 1AYUA 2GHUA 3F75A 2CB5A 3IMAA 2G6DA 1CTEA 2P86A 1NL6A 1CQDA 3BOWA 2OZ2A 2AYOA 3P5VA 1M6DA 2FO5A 1BP4A 2H7JA 1KHPA 5A24A 2PREA 1KHQA 3IOQA 2IPPB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ME4 A;  2HHN A;  4QRG A;  4K7C A;  3K24 A;  1YK8 A;  1MEG A;  4BS6 A;  5JA7 A;  2NQI A;  1PPN A;  2E02 A;  2BDZ A;  2P7U A;  3QSD A;  1U9V A;  3OVX A;  4CDF B;  1PXV A;  1YK7 A;  1U9W A;  2AYN A;  1ITO A;  4YYU A;  3RVV A;  3CH2 X;  2DCD A;  2R6N A;  1AEC A;  3KFQ A;  1CJL A;  4P6E A;  3K9M A;  2G7Y A;  2HD5 A;  4KLB A;  4N8W A;  3D6S A;  1F2A A;  1TL9 A;  1NB3 A;  1KFU L;  3QT4 A;  1AU4 A;  2NQD B;  4YVA A;  1POP A;  2FRQ A;  2HXZ A;  3IUT A;  3I3T A;  3BWK A;  2E03 A;  4FIP A;  4MSX A;  3V6E A;  3B79 A;  1F2C A;  5EF4 A;  1S4V A;  2DC7 A;  3P5U A;  3H8B A;  2AVW A;  1U9Q X;  1K3B B;  1PBH A;  2BDL A;  3H8C A;  4CZW A;  3KW9 A;  1PE6 A;  2R9O A;  1PCI A;  2CIO A;  4XUI A;  3USV A;  3KSE A;  3BPF A;  4DMX A;  2AUX A;  3OF8 A;  3U8E A;  1Y08 A;  2F1G A;  1O0E A;  2WBF X;  1CVZ A;  1EWM A;  4YYW A;  1QXP A;  2F7D A;  4DMY A;  4N79 A;  1CV8 A;  4PP2 E;  3QJ3 A;  5CHT A;  4HWY A;  4OEL A;  1THE A;  1NQC A;  1MIR A;  4QH6 A;  1Q6K A;  2DCC A;  2NQA A;  3DF0 A;  3WXF A;  1Y4H A;  4PI3 A;  1KXR A;  4N4Z A;  3HHI A;  5K16 A;  2O6X A;  4P6G A;  4BPV A;  3P5W A;  1NPZ A;  2DJF B;  3WXG A;  1PPD A;  1VJV A;  2B1M A;  1AU3 A;  4FK5 A;  2P0R A;  2PAD A;  5FPW A;  3V6C A;  1STF E;  1BQI A;  3K8U A;  5CVN B;  2IBI A;  3IEJ A;  3KWZ A;  4QRX A;  3BC3 A;  1SNK A;  2DC8 A;  1MHW A;  4RY2 A;  4XR7 A;  2FQ9 A;  2NQG A;  3OVZ A;  1NLJ A;  4BQV A;  2ACT A;  3RVX A;  3F5V A;  1VSN A;  1QMY A;  3BPM A;  1SP4 B;  3CBJ A;  4MZO A;  3GCB A;  2PNS A;  4YYR A;  3HD3 A;  1YT7 A;  1A6R A;  4X6J A;  3OIS A;  1TU6 A;  3KWB X;  9PAP A;  3PNR A;  3N3G A;  1PIP A;  1QDQ A;  1XKG A;  1YVB A;  2XU3 A;  1HUC B;  2AU1 A;  3HWN A;  3KX1 A;  4W5C A;  3IV2 A;  3TNX A;  4W4U A;  1DEU A;  2G8E A;  1GLO A;  4BSQ A;  4YV8 A;  3WXE A;  3MHS A;  1CS8 A;  3I06 A;  3BCN A;  2E00 A;  2R9C A;  4G54 A;  4CDC B;  2R9N A;  4X6I A;  4QBB A;  2FTD A;  4FJC A;  4YYV A;  2HH5 A;  3N4C A;  2YJB A;  3H7D A;  1CPJ A;  2PBH A;  1PPP A;  6PAD A;  3CH3 X;  3S3R A;  2ARY A;  5EGW A;  3H6S A;  3E1Z B;  2ATO A;  4OEM A;  1DF0 A;  3MOR A;  1X9Y A;  3N3K A;  4ZUX U;  3ZUA A;  2VHS A;  2DJG B;  2OP3 A;  2R9M A;  1GCB A;  4W5B A;  4I04 A;  2YJ8 A;  1F29 A;  1ZIV A;  1ZCM A;  2DCB A;  3MTN A;  3LXS A;  1EWP A;  1EF7 A;  3PBH A;  2AIM A;  3CBK A;  4X6H A;  3MHH A;  1ME3 A;  1BY8 A;  1ATK A;  1CSB B;  1YAL A;  1FH0 A;  4PP1 A;  3C9E A;  1MEM A;  2DC9 A;  2FRA A;  1GEC E;  3S3Q A;  1BGO A;  2DC6 A;  1AYV A;  1JQP A;  2FT2 A;  3PDF A;  3ERV A;  4AXL A;  2Y5B A;  4MZS A;  3IHP A;  3HHA A;  1CB5 A;  5F02 A;  4BS5 A;  3NHE A;  3LFY A;  1ICF A;  4Q8G A;  4YYQ A;  5JH3 A;  2XU1 A;  5CVO B;  2VHF A;  4YYS A;  5PAD A;  1AU2 A;  1QOL A;  1PAD A;  3H89 A;  1MDW A;  1MS6 A;  2DCA A;  4PAD A;  4QRV A;  1AYW A;  1F2B A;  4WA6 A;  2FYE A;  1U5I A;  2JQF R;  3AI8 A;  1U9X A;  2AS8 A;  2OUL A;  5J94 A;  4AXM A;  4CDE B;  2B1N A;  2R9F A;  2JQG R;  2DZY A;  2DZZ A;  2AUZ A;  3OF9 A;  3O1G A;  1EWL A;  7PCK A;  1AIM A;  1TLO A;  2E01 A;  4CDD B;  3P5X A;  3PW3 A;  3O0U A;  2YJC A;  2FUD A;  5CVM A;  2Y6E A;  2YJ9 A;  4Q8H A;  5CHV A;  2YJ2 A;  4I05 A;  1GMY A;  3KKU A;  2C0Y A;  2XU4 A;  8PCH A;  1NB5 A;  1IWD A;  2GFO A;  1AU0 A;  3RVW A;  2XU5 A;  3M99 A;  1KFX L;  1PPO A;  2G8J A;  4I07 A;  1EWO A;  1AYU A;  2GHU A;  3F75 A;  2CB5 A;  3IMA A;  2G6D A;  1CTE A;  2P86 A;  1NL6 A;  1CQD A;  3BOW A;  2OZ2 A;  2AYO A;  3P5V A;  1M6D A;  2FO5 A;  1BP4 A;  2H7J A;  1KHP A;  5A24 A;  2PRE A;  1KHQ A;  3IOQ A;  2IPP B; 
#chains in the Genus database with same CATH topology
 1ME4 A;  2HHN A;  4QRG A;  4GUA A;  4K7C A;  3K24 A;  1YK8 A;  1MEG A;  4BS6 A;  2UZJ A;  5JA7 A;  2NQI A;  1PPN A;  2E02 A;  2BDZ A;  2P7U A;  3QSD A;  1U9V A;  3OVX A;  4CDF B;  1PXV A;  1YK7 A;  1U9W A;  2AYN A;  1ITO A;  1PVJ A;  3BBA A;  4HXD B;  4YYU A;  3RVV A;  3E9S A;  4WUR A;  3CH2 X;  2DCD A;  3PSE A;  2R6N A;  1AEC A;  3KFQ A;  1CJL A;  3K9M A;  4P6E A;  2G7Y A;  2HD5 A;  4KLB A;  3PHW A;  4MI7 A;  4N8W A;  4PT5 A;  3D6S A;  1F2A A;  1TL9 A;  1NB3 A;  1KFU L;  3QT4 A;  2Z84 A;  1AU4 A;  2NQD B;  4YVA A;  1POP A;  2FRQ A;  2HXZ A;  3IUT A;  3I3T A;  3BWK A;  5EZQ A;  2E03 A;  4FIP A;  4MSX A;  3V6E A;  3B79 A;  1F2C A;  5EZS A;  5EF4 A;  1S4V A;  2DC7 A;  3P5U A;  3H8B A;  3PRP A;  3PHU A;  3OQC A;  2AVW A;  1U9Q X;  1K3B B;  1PBH A;  2BDL A;  3H8C A;  4CZW A;  3KW9 A;  1PE6 A;  2JRI A;  1PCI A;  2CIO A;  2R9O A;  4XUI A;  3MP2 A;  3USV A;  3KSE A;  3BPF A;  4DMX A;  2AUX A;  3OF8 A;  3U8E A;  1Y08 A;  2F1G A;  1O0E A;  2WBF X;  1CVZ A;  1EWM A;  4YYW A;  1QXP A;  2F7D A;  4DMY A;  4N79 A;  1CV8 A;  4PP2 E;  4RF1 A;  3QJ3 A;  5JZE A;  5CHT A;  4HWY A;  4OEL A;  1THE A;  1NQC A;  1MIR A;  4QH6 A;  1Q6K A;  2DCC A;  4OVZ A;  2NQA A;  3DF0 A;  3WXF A;  1Y4H A;  4PI3 A;  1KXR A;  4N4Z A;  3HHI A;  4ZTB A;  5K16 A;  4P16 A;  2O6X A;  4MM3 B;  4P6G A;  4A5U A;  4BPV A;  3P5W A;  1NPZ A;  2DJF B;  3WXG A;  1PPD A;  1VJV A;  2B1M A;  1AU3 A;  4FK5 A;  2P0R A;  4REZ A;  3MTV A;  2PAD A;  5FPW A;  3V6C A;  1STF E;  1BQI A;  3K8U A;  5CVN B;  2IBI A;  3IEJ A;  3B21 A;  3KWZ A;  4QRX A;  3BC3 A;  1SNK A;  2DC8 A;  1MHW A;  4RY2 A;  4XR7 A;  2FQ9 A;  2NQG A;  3OVZ A;  1NLJ A;  4BQV A;  2ACT A;  3RVX A;  3F5V A;  1VSN A;  1QMY A;  3BPM A;  1SP4 B;  3CBJ A;  4BOZ A;  4MZO A;  3GCB A;  2PNS A;  4YYR A;  3HD3 A;  1YT7 A;  1A6R A;  4X6J A;  3OIS A;  1TU6 A;  3KWB X;  9PAP A;  4OW0 A;  3PNR A;  3N3G A;  3TRK A;  1PIP A;  1QDQ A;  1XKG A;  1YVB A;  2XU3 A;  1HUC B;  3W30 A;  2HWK A;  2AU1 A;  3HWN A;  3KX1 A;  4W5C A;  3IV2 A;  3TNX A;  4BOU A;  4W4U A;  3BB7 A;  1DEU A;  2G8E A;  1GLO A;  4BSQ A;  4YV8 A;  3WXE A;  3MHS A;  1CS8 A;  3I06 A;  3BCN A;  2E00 A;  2R9C A;  4G54 A;  4CDC B;  2R9N A;  4X6I A;  2J7Q C;  4QBB A;  2FTD A;  4FJC A;  4YYV A;  2HH5 A;  3N4C A;  2YJB A;  3H7D A;  1CPJ A;  2PBH A;  1PPP A;  6PAD A;  3CH3 X;  3S3R A;  2ARY A;  5EGW A;  3H6S A;  3E1Z B;  1YZB A;  2ATO A;  4IP3 A;  4OEM A;  1DF0 A;  3MOR A;  1X9Y A;  5E6J A;  3N3K A;  4ZUX U;  3O65 A;  3ZUA A;  2VHS A;  4R3D A;  3BY4 A;  2DJG B;  2OP3 A;  3PRM A;  2R9M A;  1GCB A;  4W5B A;  4I04 A;  2YJ8 A;  1F29 A;  1ZIV A;  1ZCM A;  2DCB A;  3MTN A;  3LXS A;  1EWP A;  1EF7 A;  4RNA A;  3PBH A;  2AIM A;  2BTW B;  3CBK A;  4X6H A;  4BOS A;  4D8E A;  3MHH A;  1ME3 A;  1BY8 A;  2DOS A;  1ATK A;  1CSB B;  1YAL A;  1FH0 A;  4OVZ B;  4PP1 A;  3C9E A;  1MEM A;  2DC9 A;  2FRA A;  3TMP A;  1GEC E;  3S3Q A;  1BGO A;  2DC6 A;  1AYV A;  1JQP A;  2FT2 A;  3PDF A;  2AGA A;  3ERV A;  4AXL A;  2Y5B A;  4MZS A;  3IHP A;  3HHA A;  1CB5 A;  5F02 A;  4BS5 A;  3NHE A;  4IUM A;  3LFY A;  5KO3 A;  1ICF A;  2JTC A;  4Q8G A;  4YYQ A;  5JH3 A;  2XU1 A;  5CVO B;  2VHF A;  4YYS A;  5PAD A;  1AU2 A;  1QOL A;  3IFU A;  1PAD A;  3H89 A;  1MDW A;  4BOP A;  1MS6 A;  2DCA A;  4PAD A;  4RF0 A;  4RKX A;  4QRV A;  1AYW A;  1F2B A;  4WA6 A;  2FYE A;  1U5I A;  3C0R A;  2JQF R;  3W31 A;  3AI8 A;  1U9X A;  2AS8 A;  2OUL A;  4D8I A;  5J94 A;  4AXM A;  4CDE B;  2B1N A;  2R9F A;  2JQG R;  2DZY A;  2BU3 A;  2DZZ A;  3PT2 A;  1DKI A;  2AUZ A;  3OF9 A;  3ZNH A;  3O1G A;  3RNV A;  1EWL A;  7PCK A;  1AIM A;  1TLO A;  2E01 A;  4CDD B;  3P5X A;  4D8B A;  3PW3 A;  3O0U A;  2YJC A;  2FUD A;  5CVM A;  2Y6E A;  2YJ9 A;  4Q8H A;  5CHV A;  2YJ2 A;  4BOQ A;  4I05 A;  1GMY A;  3KKU A;  2C0Y A;  2XU4 A;  3MJ5 A;  8PCH A;  1NB5 A;  1IWD A;  2GFO A;  1AU0 A;  2J7Q A;  3RVW A;  2XU5 A;  3M99 A;  1KFX L;  1PPO A;  2G8J A;  4I07 A;  1EWO A;  1AYU A;  2GHU A;  3F75 A;  2FE8 A;  2BTW A;  2CB5 A;  3IMA A;  2G6D A;  4M0W A;  1UKF A;  1CTE A;  2P86 A;  1NL6 A;  1CQD A;  3BOW A;  2OZ2 A;  2AYO A;  3PHX A;  3P5V A;  1M6D A;  2FO5 A;  1BP4 A;  2H7J A;  1KHP A;  4XZX A;  5A24 A;  2PRE A;  1KHQ A;  3IOQ A;  2IPP B; 
#chains in the Genus database with same CATH homology
 1ME4 A;  2HHN A;  4QRG A;  4K7C A;  3K24 A;  1YK8 A;  1MEG A;  4BS6 A;  5JA7 A;  2NQI A;  1PPN A;  2E02 A;  2BDZ A;  2P7U A;  3QSD A;  1U9V A;  3OVX A;  4CDF B;  1PXV A;  1YK7 A;  1U9W A;  2AYN A;  1ITO A;  4YYU A;  3RVV A;  3CH2 X;  2DCD A;  2R6N A;  1AEC A;  3KFQ A;  1CJL A;  3K9M A;  4P6E A;  2G7Y A;  2HD5 A;  4KLB A;  3LTW A;  4C5P A;  4N8W A;  3D6S A;  1F2A A;  1TL9 A;  1NB3 A;  1KFU L;  3QT4 A;  1AU4 A;  2NQD B;  4YVA A;  1POP A;  2FRQ A;  2HXZ A;  3IUT A;  3I3T A;  3BWK A;  2E03 A;  4FIP A;  2BSZ A;  4MSX A;  3V6E A;  3B79 A;  1F2C A;  5EF4 A;  1S4V A;  2DC7 A;  3P5U A;  3H8B A;  2AVW A;  1U9Q X;  1K3B B;  1PBH A;  2BDL A;  3H8C A;  4CZW A;  3KW9 A;  1PE6 A;  2R9O A;  1PCI A;  2CIO A;  1W4T A;  4XUI A;  3USV A;  3KSE A;  3BPF A;  4DMX A;  2AUX A;  3OF8 A;  3U8E A;  1Y08 A;  2F1G A;  1O0E A;  2WBF X;  1CVZ A;  1EWM A;  4YYW A;  1QXP A;  2F7D A;  4DMY A;  4N79 A;  1CV8 A;  4PP2 E;  3QJ3 A;  5CHT A;  4HWY A;  4OEL A;  1THE A;  2VFC A;  1NQC A;  1MIR A;  4QH6 A;  1Q6K A;  2DCC A;  2NQA A;  3DF0 A;  3WXF A;  1Y4H A;  4PI3 A;  1KXR A;  4N4Z A;  3HHI A;  5K16 A;  2O6X A;  4P6G A;  4BPV A;  3P5W A;  1NPZ A;  2DJF B;  3WXG A;  1PPD A;  1VJV A;  2B1M A;  1AU3 A;  4FK5 A;  2P0R A;  2PAD A;  5FPW A;  3V6C A;  1STF E;  1BQI A;  3K8U A;  5CVN B;  2IBI A;  3IEJ A;  3KWZ A;  4QRX A;  3BC3 A;  1SNK A;  2DC8 A;  1MHW A;  4RY2 A;  4XR7 A;  2FQ9 A;  2NQG A;  3OVZ A;  1NLJ A;  4BQV A;  2ACT A;  3RVX A;  3F5V A;  1VSN A;  1QMY A;  3BPM A;  1SP4 B;  3CBJ A;  4MZO A;  3GCB A;  2PNS A;  4YYR A;  3HD3 A;  1YT7 A;  1A6R A;  4X6J A;  3OIS A;  1TU6 A;  3KWB X;  9PAP A;  3PNR A;  3N3G A;  1PIP A;  1QDQ A;  1XKG A;  1YVB A;  2XU3 A;  1HUC B;  2AU1 A;  3HWN A;  3KX1 A;  4W5C A;  3IV2 A;  3TNX A;  4W4U A;  1DEU A;  2G8E A;  1GLO A;  4BSQ A;  4YV8 A;  3WXE A;  3MHS A;  1CS8 A;  3I06 A;  3BCN A;  2E00 A;  2R9C A;  4G54 A;  4CDC B;  2R9N A;  4X6I A;  4QBB A;  2FTD A;  4FJC A;  4YYV A;  2HH5 A;  3N4C A;  2YJB A;  3H7D A;  1CPJ A;  2PBH A;  1GX3 A;  1PPP A;  6PAD A;  3CH3 X;  3S3R A;  2ARY A;  5EGW A;  3H6S A;  3E1Z B;  2ATO A;  4OEM A;  1DF0 A;  3MOR A;  1X9Y A;  3N3K A;  4ZUX U;  3ZUA A;  2VHS A;  4NV7 A;  2DJG B;  2OP3 A;  2R9M A;  2VFB A;  1GCB A;  4W5B A;  4I04 A;  2YJ8 A;  1F29 A;  1ZIV A;  1ZCM A;  2DCB A;  3MTN A;  3LXS A;  1EWP A;  1EF7 A;  3PBH A;  2AIM A;  3CBK A;  4X6H A;  3MHH A;  1ME3 A;  1BY8 A;  1ATK A;  1CSB B;  1YAL A;  1FH0 A;  4PP1 A;  3C9E A;  1MEM A;  2DC9 A;  2FRA A;  4GUZ A;  1GEC E;  3S3Q A;  1BGO A;  1W5R A;  2DC6 A;  1AYV A;  1JQP A;  2FT2 A;  3PDF A;  3ERV A;  4AXL A;  2Y5B A;  4MZS A;  3IHP A;  3HHA A;  1CB5 A;  5F02 A;  4BS5 A;  3NHE A;  3LFY A;  1ICF A;  4NV8 A;  4Q8G A;  4YYQ A;  5JH3 A;  2XU1 A;  5CVO B;  2VHF A;  4YYS A;  5PAD A;  1AU2 A;  1QOL A;  1PAD A;  3H89 A;  1MDW A;  1MS6 A;  2DCA A;  4PAD A;  4QRV A;  1AYW A;  1F2B A;  4WA6 A;  2FYE A;  1U5I A;  1W6F A;  2JQF R;  3AI8 A;  1U9X A;  2AS8 A;  3D9W A;  2OUL A;  5J94 A;  4AXM A;  4CDE B;  2B1N A;  4BGF A;  2R9F A;  2JQG R;  2DZY A;  2DZZ A;  2AUZ A;  3OF9 A;  3O1G A;  1EWL A;  7PCK A;  1AIM A;  1TLO A;  4B55 A;  2E01 A;  4CDD B;  3P5X A;  3PW3 A;  3O0U A;  2YJC A;  2FUD A;  5CVM A;  2Y6E A;  2YJ9 A;  4Q8H A;  5CHV A;  2YJ2 A;  4I05 A;  1GMY A;  3KKU A;  2C0Y A;  2XU4 A;  8PCH A;  1E2T A;  1NB5 A;  1IWD A;  2GFO A;  1AU0 A;  3RVW A;  2XU5 A;  3M99 A;  1KFX L;  1PPO A;  2G8J A;  4I07 A;  1EWO A;  1AYU A;  2GHU A;  3F75 A;  2CB5 A;  3IMA A;  2G6D A;  1CTE A;  2P86 A;  1NL6 A;  1CQD A;  3BOW A;  2OZ2 A;  2AYO A;  3P5V A;  1M6D A;  2FO5 A;  1BP4 A;  2H7J A;  1KHP A;  5A24 A;  2PRE A;  1KHQ A;  3IOQ A;  2IPP B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...