1EF7A

Crystal structure of human cathepsin x
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
242
structure length
242
Chain Sequence
LPKSWDWRNVDGVNYASITRNQHIPQYCGSCWAHASTSAMADRINIKRKGAWPSTLLSVQNVIDCGNAGSCEGGNDLSVWDYAHQHGIPDETCNNYQAKDQECDKFNQCGTCNEFKECHAIRNYTLWRVGDYGSLSGREKMMAEIYANGPISCGIMATERLANYTGGIYAEYQDTTYINHVVSVAGWGISDGTEYWIVRNSWGEPWGERGWLRIVTSTYKDGKGARYNLAIEEHCTFGDPIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of cathepsin X: a flip-flop of the ring of His23 allows carboxy-monopeptidase and carboxy-dipeptidase activity of the protease.
pubmed doi rcsb
molecule keywords CATHEPSIN X
molecule tags Hydrolase
total genus 75
structure length 242
sequence length 242
chains with identical sequence B
ec nomenclature ec 3.4.18.1: Cathepsin X.
pdb deposition date 2000-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1ef7A00
4MZOA 1CV8A 1NQCA 1CPJA 4FJCA 3OF8A 3ERVA 2VHSA 3C9EA 1PXVA 2P7UA 8PCHA 4CZWA 1NLJA 3BCNA 3H8CA 2FUDA 1MEGA 5CHVA 5CVOB 1CTEA 1Y4HA 2OP3A 2DCAA 2DZZA 2YJ8A 5F02A 3QJ3A 4W5CA 3P5XA 2B1MA 2R9FA 3MHSA 2DJGB 1HUCB 1Y08A 2VHFA 5A24A 1AYVA 2E02A 2AUXA 2ACTA 3BOWA 3I3TA 4BS5A 2DZYA 1GECE 2YJCA 3BWKA 1ICFA 2G7YA 3OF9A 3WXFA 1M6DA 4HWYA 4N4ZA 3KFQA 3F75A 2FT2A 3GCBA 1QOLA 1CB5A 1VSNA 2AVWA 1MEMA 3KWZA 1AU0A 3HD3A 2FRQA 1ME4A 2XU4A 2BDZA 3DF0A 4RY2A 5K16A 3H8BA 1TL9A 1F2CA 1U9VA 1CVZA 2DC8A 3O0UA 2PBHA 4ZUXU 2BDLA 1K3BB 1XKGA 3K24A 7PCKA 1S4VA 1F2AA 1KFXL 1MIRA 2C0YA 3K9MA 1DEUA 3CBJA 1IWDA 2Y5BA 2H7JA 3S3RA 3M99A 1KFUL 4N79A 4AXMA 2IPPB 2JQGR 5JH3A 4YYSA 1F29A 4Q8GA 3AI8A 2NQIA 4CDCB 2YJBA 2PNSA 3IUTA 2DC7A 1PPNA 2IBIA 1ZIVA 4YYQA 5EF4A 2DC9A 2XU5A 3P5WA 1EWPA 3B79A 2DC6A 1STFE 3O1GA 4I04A 3PW3A 1Q6KA 1EWOA 3P5UA 3HHIA 4P6EA 5JA7A 5CVMA 2R9OA 1YALA 1CQDA 3E1ZB 3KSEA 2FQ9A 2F1GA 2YJ2A 4WA6A 3P5VA 4QRXA 4XUIA 2G8JA 4OELA 1NPZA 3F5VA 2E01A 3H89A 9PAPA 1SNKA 1EWLA 5CHTA 2NQGA 3K8UA 1BP4A 4X6HA 4DMYA 1ZCMA 1EWMA 2NQDB 3BPMA 1NB5A 3ZUAA 2PREA 4QRVA 1A6RA 2XU3A 2DCBA 1NB3A 5CVNB 1GCBA 2AIMA 3I06A 4X6IA 1GLOA 2FRAA 3HHAA 4X6JA 3LXSA 4AXLA 4OEMA 3PDFA 1X9YA 1VJVA 1FH0A 4YYWA 3IMAA 4YV8A 1TU6A 1TLOA 3CBKA 2R9MA 1ITOA 3KKUA 3HWNA 3H7DA 1AU2A 5FPWA 3IEJA 1U9WA 1SP4B 4QRGA 2CB5A 1PPOA 3H6SA 1GMYA 2JQFR 3TNXA 4CDFB 3QSDA 1AYUA 2AYNA 2HHNA 2P86A 2YJ9A 1PCIA 4FK5A 3BPFA 3MHHA 1U9QX 1YT7A 1CJLA 4BSQA 4MSXA 1POPA 2NQAA 1CSBB 1KHQA 2FTDA 4BS6A 2R6NA 2B1NA 4BQVA 1PADA 1EF7A 3PNRA 3BC3A 4MZSA 5EGWA 3S3QA 2Y6EA 1PPDA 3KX1A 4YYVA 3V6CA 2O6XA 3MORA 2E00A 4YYUA 2DCDA 1PPPA 2XU1A 2CIOA 1MDWA 1PE6A 4PP2E 2P0RA 2AYOA 1QXPA 4QH6A 1YK8A 3RVVA 1U9XA 3WXGA 1AECA 1BY8A 3KW9A 5J94A 3U8EA 1KHPA 1KXRA 2DJFB 3IOQA 2ATOA 3D6SA 4KLBA 3NHEA 4QBBA 2HXZA 3N4CA 1QDQA 1F2BA 1JQPA 2HH5A 4I07A 3USVA 1MS6A 4PADA 2R9NA 3CH2X 4FIPA 3CH3X 1BQIA 2WBFX 4DMXA 3RVWA 1THEA 3N3GA 1CS8A 3WXEA 2R9CA 2G8EA 4PI3A 2F7DA 3V6EA 4W5BA 2G6DA 1QMYA 1PBHA 2GFOA 4W4UA 3OVZA 2AUZA 2ARYA 6PADA 1U5IA 1PIPA 3OVXA 1YVBA 2OULA 2HD5A 2AU1A 3MTNA 1DF0A 4XR7A 3N3KA 4PP1A 4CDEB 2FYEA 3LFYA 4YVAA 1YK7A 1ME3A 1AU4A 4N8WA 1AIMA 4CDDB 3IHPA 3IV2A 3OISA 4I05A 4G54A 2PADA 2DCCA 1AYWA 3QT4A 1ATKA 3RVXA 1AU3A 1MHWA 2E03A 1BGOA 4YYRA 1NL6A 2AS8A 5PADA 2FO5A 4Q8HA 2OZ2A 2GHUA 1O0EA 4BPVA 4K7CA 3PBHA 4P6GA 3KWBX
chains in the Genus database with same CATH superfamily
4MZOA 1CV8A 1NQCA 1CPJA 4FJCA 3OF8A 3ERVA 2BTWB 2VHSA 3C9EA 1PXVA 2P7UA 8PCHA 3PSEA 4CZWA 1NLJA 3BCNA 3H8CA 2FUDA 1MEGA 3PHUA 5CHVA 5CVOB 1CTEA 1Y4HA 2OP3A 2DCAA 2DZZA 2YJ8A 5F02A 3QJ3A 4W5CA 3P5XA 2B1MA 2R9FA 3MHSA 2DJGB 1HUCB 1Y08A 5E6JA 2VHFA 5A24A 2AGAA 1AYVA 2E02A 2AUXA 4HXDB 2ACTA 4GUAA 3BOWA 3I3TA 4BS5A 2DZYA 3OQCA 1GECE 2YJCA 3BWKA 1ICFA 1UKFA 3RNVA 2UZJA 2G7YA 3MTVA 3OF9A 3WXFA 4MM3B 1M6DA 4HWYA 4N4ZA 3KFQA 3F75A 2FT2A 3GCBA 4BOSA 1QOLA 1CB5A 1VSNA 2AVWA 1MEMA 3KWZA 3ZNHA 1AU0A 4M0WA 2HWKA 3HD3A 2FRQA 1ME4A 2XU4A 2BDZA 3DF0A 2JRIA 4RY2A 5K16A 3H8BA 2J7QA 1TL9A 1F2CA 1U9VA 1CVZA 3O0UA 2DC8A 2PBHA 1PVJA 4ZUXU 2BDLA 1K3BB 3PRPA 1XKGA 3K24A 7PCKA 1S4VA 1F2AA 1KFXL 1MIRA 2C0YA 3K9MA 1DEUA 2FE8A 3CBJA 1IWDA 2Y5BA 2H7JA 4IP3A 3S3RA 3M99A 4D8EA 4OW0A 1KFUL 4N79A 3MJ5A 4AXMA 2IPPB 2JQGR 4RF1A 5JH3A 4RF0A 4BOUA 4YYSA 1F29A 4Q8GA 3AI8A 2NQIA 3PHWA 4CDCB 2YJBA 2PNSA 4A5UA 3IUTA 4RNAA 2DC7A 1PPNA 2IBIA 1ZIVA 3W30A 4XZXA 4BOPA 4YYQA 5EF4A 2DC9A 2XU5A 3P5WA 1EWPA 3B79A 2DC6A 1STFE 3O1GA 4I04A 2JTCA 3PW3A 4BOZA 1Q6KA 4OVZA 1EWOA 4MI7A 3P5UA 3HHIA 4P6EA 5JA7A 5CVMA 2R9OA 1YALA 1CQDA 3E1ZB 3KSEA 2FQ9A 2F1GA 2YJ2A 4WA6A 3P5VA 4QRXA 4XUIA 2G8JA 4P16A 4OELA 1NPZA 3F5VA 2E01A 3H89A 9PAPA 1SNKA 1EWLA 5CHTA 2NQGA 4D8BA 3K8UA 1BP4A 4X6HA 4DMYA 1ZCMA 1EWMA 2NQDB 3BPMA 3W31A 1NB5A 3ZUAA 2PREA 4QRVA 1A6RA 2XU3A 2DCBA 1NB3A 5CVNB 1GCBA 2AIMA 3I06A 4X6IA 1GLOA 5EZQA 2FRAA 3C0RA 3HHAA 4X6JA 3LXSA 4AXLA 4OEMA 3PDFA 1X9YA 3PHXA 1VJVA 2Z84A 1FH0A 4YYWA 3IMAA 4YV8A 4REZA 1TU6A 1TLOA 3CBKA 2R9MA 1ITOA 3KKUA 3TMPA 3HWNA 3H7DA 5EZSA 1AU2A 5FPWA 3IEJA 1U9WA 1SP4B 4ZTBA 4QRGA 2CB5A 1PPOA 3H6SA 1GMYA 2JQFR 3TNXA 4CDFB 3QSDA 1AYUA 2AYNA 2HHNA 2P86A 2YJ9A 1PCIA 4FK5A 3BPFA 3MHHA 1U9QX 3PT2A 1YT7A 3B21A 3BB7A 1CJLA 4BSQA 4MSXA 1POPA 4OVZB 2J7QC 2NQAA 1DKIA 1CSBB 1KHQA 2FTDA 4BS6A 2R6NA 2B1NA 4BQVA 1PADA 1EF7A 3PNRA 4R3DA 3BC3A 4MZSA 5EGWA 3S3QA 5JZEA 2Y6EA 1PPDA 3KX1A 4YYVA 3V6CA 2O6XA 3MORA 2E00A 4YYUA 2DCDA 1PPPA 2XU1A 2CIOA 1MDWA 1PE6A 2BTWA 2P0RA 2AYOA 4PP2E 1QXPA 4QH6A 1YK8A 4RKXA 4PT5A 3RVVA 1U9XA 3WXGA 1AECA 2DOSA 1BY8A 3KW9A 5J94A 3TRKA 3U8EA 1KHPA 1KXRA 2DJFB 3IOQA 2ATOA 3D6SA 4KLBA 3NHEA 4QBBA 2HXZA 3N4CA 3IFUA 1QDQA 1F2BA 1JQPA 2HH5A 4I07A 5KO3A 3USVA 1MS6A 4PADA 2R9NA 3CH2X 4FIPA 3CH3X 1BQIA 2WBFX 4DMXA 3RVWA 1THEA 4D8IA 3N3GA 1CS8A 3WXEA 2R9CA 2G8EA 4PI3A 2F7DA 3V6EA 4W5BA 2G6DA 1QMYA 1PBHA 2GFOA 4IUMA 4W4UA 3OVZA 2AUZA 2ARYA 6PADA 4WURA 1U5IA 1PIPA 3OVXA 1YVBA 2OULA 2HD5A 2AU1A 2BU3A 3BBAA 3MTNA 1DF0A 4XR7A 3N3KA 4PP1A 4CDEB 2FYEA 3LFYA 4YVAA 1YK7A 1ME3A 1AU4A 4N8WA 1AIMA 3BY4A 4CDDB 3IHPA 3IV2A 3OISA 4I05A 4G54A 2PADA 2DCCA 1AYWA 3QT4A 1ATKA 3RVXA 3E9SA 1AU3A 1MHWA 3O65A 2E03A 1BGOA 4YYRA 4BOQA 1NL6A 2AS8A 5PADA 2FO5A 4Q8HA 2OZ2A 3MP2A 2GHUA 1YZBA 1O0EA 4BPVA 4K7CA 3PRMA 3PBHA 4P6GA 3KWBX
chains in the Genus database with same CATH topology
4MZOA 1CV8A 1NQCA 1CPJA 4FJCA 3OF8A 3ERVA 1W4TA 2VHSA 3C9EA 1PXVA 2P7UA 8PCHA 4CZWA 1NLJA 3BCNA 3H8CA 2FUDA 1MEGA 2BSZA 5CHVA 5CVOB 1CTEA 1Y4HA 2OP3A 2DCAA 2DZZA 2YJ8A 5F02A 3QJ3A 4W5CA 3P5XA 2B1MA 2R9FA 3MHSA 2DJGB 1HUCB 1Y08A 2VHFA 5A24A 1AYVA 2E02A 2AUXA 2ACTA 4B55A 3BOWA 3I3TA 4BS5A 2DZYA 1GECE 2YJCA 3BWKA 1ICFA 2G7YA 3OF9A 3WXFA 1M6DA 4HWYA 4N4ZA 3KFQA 3F75A 2FT2A 3GCBA 1QOLA 1CB5A 1VSNA 2AVWA 1MEMA 3KWZA 1AU0A 3HD3A 2FRQA 1ME4A 2XU4A 2BDZA 3DF0A 4RY2A 5K16A 3H8BA 1TL9A 1F2CA 1U9VA 1CVZA 2DC8A 3O0UA 2PBHA 4ZUXU 2BDLA 2VFBA 1K3BB 1XKGA 1E2TA 3K24A 7PCKA 1S4VA 1F2AA 1KFXL 1MIRA 2C0YA 2VFCA 1W6FA 3K9MA 1DEUA 3CBJA 1IWDA 2Y5BA 2H7JA 3S3RA 3M99A 1KFUL 4N79A 4AXMA 2IPPB 4NV8A 2JQGR 5JH3A 4YYSA 1F29A 4Q8GA 3AI8A 2NQIA 4CDCB 2YJBA 2PNSA 3IUTA 2DC7A 1PPNA 2IBIA 1ZIVA 4YYQA 5EF4A 2DC9A 2XU5A 3P5WA 1EWPA 3B79A 2DC6A 1STFE 3O1GA 4I04A 3PW3A 1Q6KA 1EWOA 3P5UA 3HHIA 4P6EA 5JA7A 5CVMA 2R9OA 1YALA 1CQDA 3E1ZB 3KSEA 2FQ9A 2F1GA 2YJ2A 4WA6A 3P5VA 4QRXA 4XUIA 2G8JA 4C5PA 4OELA 1NPZA 3F5VA 2E01A 3H89A 9PAPA 1SNKA 1EWLA 5CHTA 2NQGA 3K8UA 1BP4A 4X6HA 4DMYA 1ZCMA 4GUZA 1EWMA 2NQDB 3BPMA 1NB5A 3ZUAA 2PREA 4QRVA 1A6RA 2XU3A 2DCBA 1NB3A 5CVNB 1GCBA 2AIMA 3I06A 1GX3A 4X6IA 1GLOA 2FRAA 3HHAA 4X6JA 3LXSA 4AXLA 4OEMA 3PDFA 1X9YA 1VJVA 1FH0A 4YYWA 3IMAA 4YV8A 1TU6A 3D9WA 1TLOA 3CBKA 2R9MA 1ITOA 3KKUA 3HWNA 3H7DA 1AU2A 5FPWA 3IEJA 1U9WA 1SP4B 4QRGA 2CB5A 1PPOA 3H6SA 1GMYA 2JQFR 3TNXA 4CDFB 3QSDA 1AYUA 2AYNA 2HHNA 2P86A 2YJ9A 1PCIA 4FK5A 3BPFA 3MHHA 1U9QX 1YT7A 1CJLA 4BSQA 4MSXA 1POPA 2NQAA 1CSBB 4BGFA 1KHQA 2FTDA 4BS6A 2R6NA 2B1NA 4BQVA 1PADA 1EF7A 3PNRA 3BC3A 4MZSA 5EGWA 3S3QA 2Y6EA 1PPDA 3KX1A 4YYVA 4P6GA 3V6CA 2O6XA 3MORA 2E00A 4YYUA 2DCDA 1PPPA 2XU1A 2CIOA 1MDWA 1PE6A 4PP2E 2P0RA 2AYOA 1QXPA 4QH6A 1YK8A 3RVVA 1U9XA 3WXGA 1AECA 1BY8A 3KW9A 5J94A 3U8EA 1KHPA 1KXRA 2DJFB 3IOQA 2ATOA 3D6SA 4KLBA 3NHEA 4QBBA 2HXZA 3N4CA 1QDQA 1F2BA 1JQPA 2HH5A 4I07A 3USVA 1MS6A 1W5RA 4PADA 2R9NA 3CH2X 4FIPA 3CH3X 1BQIA 2WBFX 4DMXA 3RVWA 1THEA 3N3GA 1CS8A 3LTWA 3WXEA 2R9CA 2G8EA 4PI3A 2F7DA 3V6EA 4W5BA 2G6DA 1QMYA 1PBHA 2GFOA 4W4UA 3OVZA 2AUZA 2ARYA 6PADA 1U5IA 1PIPA 3OVXA 1YVBA 2OULA 2HD5A 2AU1A 3MTNA 1DF0A 4XR7A 3N3KA 4PP1A 4CDEB 2FYEA 3LFYA 4YVAA 1YK7A 1ME3A 1AU4A 4N8WA 1AIMA 4CDDB 3IHPA 3IV2A 3OISA 4I05A 4G54A 2PADA 2DCCA 1AYWA 3QT4A 1ATKA 3RVXA 1AU3A 1MHWA 2E03A 1BGOA 4YYRA 1NL6A 2AS8A 5PADA 2FO5A 4Q8HA 2OZ2A 2GHUA 1O0EA 4BPVA 4K7CA 3PBHA 4NV7A 3KWBX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MZO A;  1CV8 A;  1NQC A;  1CPJ A;  4FJC A;  3OF8 A;  3ERV A;  2VHS A;  3C9E A;  1PXV A;  2P7U A;  8PCH A;  4CZW A;  1NLJ A;  3BCN A;  3H8C A;  2FUD A;  1MEG A;  5CHV A;  5CVO B;  1CTE A;  1Y4H A;  2OP3 A;  2DCA A;  2DZZ A;  2YJ8 A;  5F02 A;  3QJ3 A;  4W5C A;  3P5X A;  2B1M A;  2R9F A;  3MHS A;  2DJG B;  1HUC B;  1Y08 A;  2VHF A;  5A24 A;  1AYV A;  2E02 A;  2AUX A;  2ACT A;  3BOW A;  3I3T A;  4BS5 A;  2DZY A;  1GEC E;  2YJC A;  3BWK A;  1ICF A;  2G7Y A;  3OF9 A;  3WXF A;  1M6D A;  4HWY A;  4N4Z A;  3KFQ A;  3F75 A;  2FT2 A;  3GCB A;  1QOL A;  1CB5 A;  1VSN A;  2AVW A;  1MEM A;  3KWZ A;  1AU0 A;  3HD3 A;  2FRQ A;  1ME4 A;  2XU4 A;  2BDZ A;  3DF0 A;  4RY2 A;  5K16 A;  3H8B A;  1TL9 A;  1F2C A;  1U9V A;  1CVZ A;  2DC8 A;  3O0U A;  2PBH A;  4ZUX U;  2BDL A;  1K3B B;  1XKG A;  3K24 A;  7PCK A;  1S4V A;  1F2A A;  1KFX L;  1MIR A;  2C0Y A;  3K9M A;  1DEU A;  3CBJ A;  1IWD A;  2Y5B A;  2H7J A;  3S3R A;  3M99 A;  1KFU L;  4N79 A;  4AXM A;  2IPP B;  2JQG R;  5JH3 A;  4YYS A;  1F29 A;  4Q8G A;  3AI8 A;  2NQI A;  4CDC B;  2YJB A;  2PNS A;  3IUT A;  2DC7 A;  1PPN A;  2IBI A;  1ZIV A;  4YYQ A;  5EF4 A;  2DC9 A;  2XU5 A;  3P5W A;  1EWP A;  3B79 A;  2DC6 A;  1STF E;  3O1G A;  4I04 A;  3PW3 A;  1Q6K A;  1EWO A;  3P5U A;  3HHI A;  4P6E A;  5JA7 A;  5CVM A;  2R9O A;  1YAL A;  1CQD A;  3E1Z B;  3KSE A;  2FQ9 A;  2F1G A;  2YJ2 A;  4WA6 A;  3P5V A;  4QRX A;  4XUI A;  2G8J A;  4OEL A;  1NPZ A;  3F5V A;  2E01 A;  3H89 A;  9PAP A;  1SNK A;  1EWL A;  5CHT A;  2NQG A;  3K8U A;  1BP4 A;  4X6H A;  4DMY A;  1ZCM A;  1EWM A;  2NQD B;  3BPM A;  1NB5 A;  3ZUA A;  2PRE A;  4QRV A;  1A6R A;  2XU3 A;  2DCB A;  1NB3 A;  5CVN B;  1GCB A;  2AIM A;  3I06 A;  4X6I A;  1GLO A;  2FRA A;  3HHA A;  4X6J A;  3LXS A;  4AXL A;  4OEM A;  3PDF A;  1X9Y A;  1VJV A;  1FH0 A;  4YYW A;  3IMA A;  4YV8 A;  1TU6 A;  1TLO A;  3CBK A;  2R9M A;  1ITO A;  3KKU A;  3HWN A;  3H7D A;  1AU2 A;  5FPW A;  3IEJ A;  1U9W A;  1SP4 B;  4QRG A;  2CB5 A;  1PPO A;  3H6S A;  1GMY A;  2JQF R;  3TNX A;  4CDF B;  3QSD A;  1AYU A;  2AYN A;  2HHN A;  2P86 A;  2YJ9 A;  1PCI A;  4FK5 A;  3BPF A;  3MHH A;  1U9Q X;  1YT7 A;  1CJL A;  4BSQ A;  4MSX A;  1POP A;  2NQA A;  1CSB B;  1KHQ A;  2FTD A;  4BS6 A;  2R6N A;  2B1N A;  4BQV A;  1PAD A;  1EF7 A;  3PNR A;  3BC3 A;  4MZS A;  5EGW A;  3S3Q A;  2Y6E A;  1PPD A;  3KX1 A;  4YYV A;  3V6C A;  2O6X A;  3MOR A;  2E00 A;  4YYU A;  2DCD A;  1PPP A;  2XU1 A;  2CIO A;  1MDW A;  1PE6 A;  4PP2 E;  2P0R A;  2AYO A;  1QXP A;  4QH6 A;  1YK8 A;  3RVV A;  1U9X A;  3WXG A;  1AEC A;  1BY8 A;  3KW9 A;  5J94 A;  3U8E A;  1KHP A;  1KXR A;  2DJF B;  3IOQ A;  2ATO A;  3D6S A;  4KLB A;  3NHE A;  4QBB A;  2HXZ A;  3N4C A;  1QDQ A;  1F2B A;  1JQP A;  2HH5 A;  4I07 A;  3USV A;  1MS6 A;  4PAD A;  2R9N A;  3CH2 X;  4FIP A;  3CH3 X;  1BQI A;  2WBF X;  4DMX A;  3RVW A;  1THE A;  3N3G A;  1CS8 A;  3WXE A;  2R9C A;  2G8E A;  4PI3 A;  2F7D A;  3V6E A;  4W5B A;  2G6D A;  1QMY A;  1PBH A;  2GFO A;  4W4U A;  3OVZ A;  2AUZ A;  2ARY A;  6PAD A;  1U5I A;  1PIP A;  3OVX A;  1YVB A;  2OUL A;  2HD5 A;  2AU1 A;  3MTN A;  1DF0 A;  4XR7 A;  3N3K A;  4PP1 A;  4CDE B;  2FYE A;  3LFY A;  4YVA A;  1YK7 A;  1ME3 A;  1AU4 A;  4N8W A;  1AIM A;  4CDD B;  3IHP A;  3IV2 A;  3OIS A;  4I05 A;  4G54 A;  2PAD A;  2DCC A;  1AYW A;  3QT4 A;  1ATK A;  3RVX A;  1AU3 A;  1MHW A;  2E03 A;  1BGO A;  4YYR A;  1NL6 A;  2AS8 A;  5PAD A;  2FO5 A;  4Q8H A;  2OZ2 A;  2GHU A;  1O0E A;  4BPV A;  4K7C A;  3PBH A;  4P6G A;  3KWB X; 
#chains in the Genus database with same CATH topology
 4MZO A;  1CV8 A;  1NQC A;  1CPJ A;  4FJC A;  3OF8 A;  3ERV A;  2BTW B;  2VHS A;  3C9E A;  1PXV A;  2P7U A;  8PCH A;  3PSE A;  4CZW A;  1NLJ A;  3BCN A;  3H8C A;  2FUD A;  1MEG A;  3PHU A;  5CHV A;  5CVO B;  1CTE A;  1Y4H A;  2OP3 A;  2DCA A;  2DZZ A;  2YJ8 A;  5F02 A;  3QJ3 A;  4W5C A;  3P5X A;  2B1M A;  2R9F A;  3MHS A;  2DJG B;  1HUC B;  1Y08 A;  5E6J A;  2VHF A;  5A24 A;  2AGA A;  1AYV A;  2E02 A;  2AUX A;  4HXD B;  2ACT A;  4GUA A;  3BOW A;  3I3T A;  4BS5 A;  2DZY A;  3OQC A;  1GEC E;  2YJC A;  3BWK A;  1ICF A;  1UKF A;  3RNV A;  2UZJ A;  2G7Y A;  3MTV A;  3OF9 A;  3WXF A;  4MM3 B;  1M6D A;  4HWY A;  4N4Z A;  3KFQ A;  3F75 A;  2FT2 A;  3GCB A;  4BOS A;  1QOL A;  1CB5 A;  1VSN A;  2AVW A;  1MEM A;  3KWZ A;  3ZNH A;  1AU0 A;  4M0W A;  2HWK A;  3HD3 A;  2FRQ A;  1ME4 A;  2XU4 A;  2BDZ A;  3DF0 A;  2JRI A;  4RY2 A;  5K16 A;  3H8B A;  2J7Q A;  1TL9 A;  1F2C A;  1U9V A;  1CVZ A;  3O0U A;  2DC8 A;  2PBH A;  1PVJ A;  4ZUX U;  2BDL A;  1K3B B;  3PRP A;  1XKG A;  3K24 A;  7PCK A;  1S4V A;  1F2A A;  1KFX L;  1MIR A;  2C0Y A;  3K9M A;  1DEU A;  2FE8 A;  3CBJ A;  1IWD A;  2Y5B A;  2H7J A;  4IP3 A;  3S3R A;  3M99 A;  4D8E A;  4OW0 A;  1KFU L;  4N79 A;  3MJ5 A;  4AXM A;  2IPP B;  2JQG R;  4RF1 A;  5JH3 A;  4RF0 A;  4BOU A;  4YYS A;  1F29 A;  4Q8G A;  3AI8 A;  2NQI A;  3PHW A;  4CDC B;  2YJB A;  2PNS A;  4A5U A;  3IUT A;  4RNA A;  2DC7 A;  1PPN A;  2IBI A;  1ZIV A;  3W30 A;  4XZX A;  4BOP A;  4YYQ A;  5EF4 A;  2DC9 A;  2XU5 A;  3P5W A;  1EWP A;  3B79 A;  2DC6 A;  1STF E;  3O1G A;  4I04 A;  2JTC A;  3PW3 A;  4BOZ A;  1Q6K A;  4OVZ A;  1EWO A;  4MI7 A;  3P5U A;  3HHI A;  4P6E A;  5JA7 A;  5CVM A;  2R9O A;  1YAL A;  1CQD A;  3E1Z B;  3KSE A;  2FQ9 A;  2F1G A;  2YJ2 A;  4WA6 A;  3P5V A;  4QRX A;  4XUI A;  2G8J A;  4P16 A;  4OEL A;  1NPZ A;  3F5V A;  2E01 A;  3H89 A;  9PAP A;  1SNK A;  1EWL A;  5CHT A;  2NQG A;  4D8B A;  3K8U A;  1BP4 A;  4X6H A;  4DMY A;  1ZCM A;  1EWM A;  2NQD B;  3BPM A;  3W31 A;  1NB5 A;  3ZUA A;  2PRE A;  4QRV A;  1A6R A;  2XU3 A;  2DCB A;  1NB3 A;  5CVN B;  1GCB A;  2AIM A;  3I06 A;  4X6I A;  1GLO A;  5EZQ A;  2FRA A;  3C0R A;  3HHA A;  4X6J A;  3LXS A;  4AXL A;  4OEM A;  3PDF A;  1X9Y A;  3PHX A;  1VJV A;  2Z84 A;  1FH0 A;  4YYW A;  3IMA A;  4YV8 A;  4REZ A;  1TU6 A;  1TLO A;  3CBK A;  2R9M A;  1ITO A;  3KKU A;  3TMP A;  3HWN A;  3H7D A;  5EZS A;  1AU2 A;  5FPW A;  3IEJ A;  1U9W A;  1SP4 B;  4ZTB A;  4QRG A;  2CB5 A;  1PPO A;  3H6S A;  1GMY A;  2JQF R;  3TNX A;  4CDF B;  3QSD A;  1AYU A;  2AYN A;  2HHN A;  2P86 A;  2YJ9 A;  1PCI A;  4FK5 A;  3BPF A;  3MHH A;  1U9Q X;  3PT2 A;  1YT7 A;  3B21 A;  3BB7 A;  1CJL A;  4BSQ A;  4MSX A;  1POP A;  4OVZ B;  2J7Q C;  2NQA A;  1DKI A;  1CSB B;  1KHQ A;  2FTD A;  4BS6 A;  2R6N A;  2B1N A;  4BQV A;  1PAD A;  1EF7 A;  3PNR A;  4R3D A;  3BC3 A;  4MZS A;  5EGW A;  3S3Q A;  5JZE A;  2Y6E A;  1PPD A;  3KX1 A;  4YYV A;  3V6C A;  2O6X A;  3MOR A;  2E00 A;  4YYU A;  2DCD A;  1PPP A;  2XU1 A;  2CIO A;  1MDW A;  1PE6 A;  2BTW A;  2P0R A;  2AYO A;  4PP2 E;  1QXP A;  4QH6 A;  1YK8 A;  4RKX A;  4PT5 A;  3RVV A;  1U9X A;  3WXG A;  1AEC A;  2DOS A;  1BY8 A;  3KW9 A;  5J94 A;  3TRK A;  3U8E A;  1KHP A;  1KXR A;  2DJF B;  3IOQ A;  2ATO A;  3D6S A;  4KLB A;  3NHE A;  4QBB A;  2HXZ A;  3N4C A;  3IFU A;  1QDQ A;  1F2B A;  1JQP A;  2HH5 A;  4I07 A;  5KO3 A;  3USV A;  1MS6 A;  4PAD A;  2R9N A;  3CH2 X;  4FIP A;  3CH3 X;  1BQI A;  2WBF X;  4DMX A;  3RVW A;  1THE A;  4D8I A;  3N3G A;  1CS8 A;  3WXE A;  2R9C A;  2G8E A;  4PI3 A;  2F7D A;  3V6E A;  4W5B A;  2G6D A;  1QMY A;  1PBH A;  2GFO A;  4IUM A;  4W4U A;  3OVZ A;  2AUZ A;  2ARY A;  6PAD A;  4WUR A;  1U5I A;  1PIP A;  3OVX A;  1YVB A;  2OUL A;  2HD5 A;  2AU1 A;  2BU3 A;  3BBA A;  3MTN A;  1DF0 A;  4XR7 A;  3N3K A;  4PP1 A;  4CDE B;  2FYE A;  3LFY A;  4YVA A;  1YK7 A;  1ME3 A;  1AU4 A;  4N8W A;  1AIM A;  3BY4 A;  4CDD B;  3IHP A;  3IV2 A;  3OIS A;  4I05 A;  4G54 A;  2PAD A;  2DCC A;  1AYW A;  3QT4 A;  1ATK A;  3RVX A;  3E9S A;  1AU3 A;  1MHW A;  3O65 A;  2E03 A;  1BGO A;  4YYR A;  4BOQ A;  1NL6 A;  2AS8 A;  5PAD A;  2FO5 A;  4Q8H A;  2OZ2 A;  3MP2 A;  2GHU A;  1YZB A;  1O0E A;  4BPV A;  4K7C A;  3PRM A;  3PBH A;  4P6G A;  3KWB X; 
#chains in the Genus database with same CATH homology
 4MZO A;  1CV8 A;  1NQC A;  1CPJ A;  4FJC A;  3OF8 A;  3ERV A;  1W4T A;  2VHS A;  3C9E A;  1PXV A;  2P7U A;  8PCH A;  4CZW A;  1NLJ A;  3BCN A;  3H8C A;  2FUD A;  1MEG A;  2BSZ A;  5CHV A;  5CVO B;  1CTE A;  1Y4H A;  2OP3 A;  2DCA A;  2DZZ A;  2YJ8 A;  5F02 A;  3QJ3 A;  4W5C A;  3P5X A;  2B1M A;  2R9F A;  3MHS A;  2DJG B;  1HUC B;  1Y08 A;  2VHF A;  5A24 A;  1AYV A;  2E02 A;  2AUX A;  2ACT A;  4B55 A;  3BOW A;  3I3T A;  4BS5 A;  2DZY A;  1GEC E;  2YJC A;  3BWK A;  1ICF A;  2G7Y A;  3OF9 A;  3WXF A;  1M6D A;  4HWY A;  4N4Z A;  3KFQ A;  3F75 A;  2FT2 A;  3GCB A;  1QOL A;  1CB5 A;  1VSN A;  2AVW A;  1MEM A;  3KWZ A;  1AU0 A;  3HD3 A;  2FRQ A;  1ME4 A;  2XU4 A;  2BDZ A;  3DF0 A;  4RY2 A;  5K16 A;  3H8B A;  1TL9 A;  1F2C A;  1U9V A;  1CVZ A;  2DC8 A;  3O0U A;  2PBH A;  4ZUX U;  2BDL A;  2VFB A;  1K3B B;  1XKG A;  1E2T A;  3K24 A;  7PCK A;  1S4V A;  1F2A A;  1KFX L;  1MIR A;  2C0Y A;  2VFC A;  1W6F A;  3K9M A;  1DEU A;  3CBJ A;  1IWD A;  2Y5B A;  2H7J A;  3S3R A;  3M99 A;  1KFU L;  4N79 A;  4AXM A;  2IPP B;  4NV8 A;  2JQG R;  5JH3 A;  4YYS A;  1F29 A;  4Q8G A;  3AI8 A;  2NQI A;  4CDC B;  2YJB A;  2PNS A;  3IUT A;  2DC7 A;  1PPN A;  2IBI A;  1ZIV A;  4YYQ A;  5EF4 A;  2DC9 A;  2XU5 A;  3P5W A;  1EWP A;  3B79 A;  2DC6 A;  1STF E;  3O1G A;  4I04 A;  3PW3 A;  1Q6K A;  1EWO A;  3P5U A;  3HHI A;  4P6E A;  5JA7 A;  5CVM A;  2R9O A;  1YAL A;  1CQD A;  3E1Z B;  3KSE A;  2FQ9 A;  2F1G A;  2YJ2 A;  4WA6 A;  3P5V A;  4QRX A;  4XUI A;  2G8J A;  4C5P A;  4OEL A;  1NPZ A;  3F5V A;  2E01 A;  3H89 A;  9PAP A;  1SNK A;  1EWL A;  5CHT A;  2NQG A;  3K8U A;  1BP4 A;  4X6H A;  4DMY A;  1ZCM A;  4GUZ A;  1EWM A;  2NQD B;  3BPM A;  1NB5 A;  3ZUA A;  2PRE A;  4QRV A;  1A6R A;  2XU3 A;  2DCB A;  1NB3 A;  5CVN B;  1GCB A;  2AIM A;  3I06 A;  1GX3 A;  4X6I A;  1GLO A;  2FRA A;  3HHA A;  4X6J A;  3LXS A;  4AXL A;  4OEM A;  3PDF A;  1X9Y A;  1VJV A;  1FH0 A;  4YYW A;  3IMA A;  4YV8 A;  1TU6 A;  3D9W A;  1TLO A;  3CBK A;  2R9M A;  1ITO A;  3KKU A;  3HWN A;  3H7D A;  1AU2 A;  5FPW A;  3IEJ A;  1U9W A;  1SP4 B;  4QRG A;  2CB5 A;  1PPO A;  3H6S A;  1GMY A;  2JQF R;  3TNX A;  4CDF B;  3QSD A;  1AYU A;  2AYN A;  2HHN A;  2P86 A;  2YJ9 A;  1PCI A;  4FK5 A;  3BPF A;  3MHH A;  1U9Q X;  1YT7 A;  1CJL A;  4BSQ A;  4MSX A;  1POP A;  2NQA A;  1CSB B;  4BGF A;  1KHQ A;  2FTD A;  4BS6 A;  2R6N A;  2B1N A;  4BQV A;  1PAD A;  1EF7 A;  3PNR A;  3BC3 A;  4MZS A;  5EGW A;  3S3Q A;  2Y6E A;  1PPD A;  3KX1 A;  4YYV A;  4P6G A;  3V6C A;  2O6X A;  3MOR A;  2E00 A;  4YYU A;  2DCD A;  1PPP A;  2XU1 A;  2CIO A;  1MDW A;  1PE6 A;  4PP2 E;  2P0R A;  2AYO A;  1QXP A;  4QH6 A;  1YK8 A;  3RVV A;  1U9X A;  3WXG A;  1AEC A;  1BY8 A;  3KW9 A;  5J94 A;  3U8E A;  1KHP A;  1KXR A;  2DJF B;  3IOQ A;  2ATO A;  3D6S A;  4KLB A;  3NHE A;  4QBB A;  2HXZ A;  3N4C A;  1QDQ A;  1F2B A;  1JQP A;  2HH5 A;  4I07 A;  3USV A;  1MS6 A;  1W5R A;  4PAD A;  2R9N A;  3CH2 X;  4FIP A;  3CH3 X;  1BQI A;  2WBF X;  4DMX A;  3RVW A;  1THE A;  3N3G A;  1CS8 A;  3LTW A;  3WXE A;  2R9C A;  2G8E A;  4PI3 A;  2F7D A;  3V6E A;  4W5B A;  2G6D A;  1QMY A;  1PBH A;  2GFO A;  4W4U A;  3OVZ A;  2AUZ A;  2ARY A;  6PAD A;  1U5I A;  1PIP A;  3OVX A;  1YVB A;  2OUL A;  2HD5 A;  2AU1 A;  3MTN A;  1DF0 A;  4XR7 A;  3N3K A;  4PP1 A;  4CDE B;  2FYE A;  3LFY A;  4YVA A;  1YK7 A;  1ME3 A;  1AU4 A;  4N8W A;  1AIM A;  4CDD B;  3IHP A;  3IV2 A;  3OIS A;  4I05 A;  4G54 A;  2PAD A;  2DCC A;  1AYW A;  3QT4 A;  1ATK A;  3RVX A;  1AU3 A;  1MHW A;  2E03 A;  1BGO A;  4YYR A;  1NL6 A;  2AS8 A;  5PAD A;  2FO5 A;  4Q8H A;  2OZ2 A;  2GHU A;  1O0E A;  4BPV A;  4K7C A;  3PBH A;  4NV7 A;  3KWB X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...