1EF7A

Crystal structure of human cathepsin x
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
242
structure length
242
Chain Sequence
LPKSWDWRNVDGVNYASITRNQHIPQYCGSCWAHASTSAMADRINIKRKGAWPSTLLSVQNVIDCGNAGSCEGGNDLSVWDYAHQHGIPDETCNNYQAKDQECDKFNQCGTCNEFKECHAIRNYTLWRVGDYGSLSGREKMMAEIYANGPISCGIMATERLANYTGGIYAEYQDTTYINHVVSVAGWGISDGTEYWIVRNSWGEPWGERGWLRIVTSTYKDGKGARYNLAIEEHCTFGDPIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of cathepsin X: a flip-flop of the ring of His23 allows carboxy-monopeptidase and carboxy-dipeptidase activity of the protease.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords CATHEPSIN X
total genus 75
structure length 242
sequence length 242
chains with identical sequence B
ec nomenclature ec 3.4.18.1: Cathepsin X.
pdb deposition date 2000-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1ef7A00
2AS8A 2CB5A 2DCDA 3QJ3A 4QRGA 2G8JA 3KW9A 4ZUXU 5CVNB 2NQIA 2HXZA 2AVWA 2YJ9A 1U9WA 4FJCA 1YT7A 1A6RA 2OULA 4BSQA 3V6EA 2XU3A 2FO5A 1ICFA 1QXPA 3MORA 3O1GA 5F02A 1DEUA 3OF9A 1DF0A 5FPWA 2DZYA 9PAPA 1IWDA 1CPJA 1U9VA 4MSXA 1NLJA 3CBJA 2B1NA 2R6NA 1AU3A 2BDLA 1PPOA 2PNSA 2R9OA 1TU6A 4DMXA 2AU1A 3KWZA 3S3QA 1QMYA 2YJ8A 2R9MA 1CVZA 2JQFR 2WBFX 1X9YA 3U8EA 1F2CA 4OELA 4PP1A 4PADA 3MHSA 3HHIA 1SP4B 2DC7A 3BCNA 3F75A 2P7UA 4W5BA 4YYSA 2E01A 1VJVA 1CSBB 3N3GA 3KKUA 2XU4A 2G7YA 2XU5A 3O0UA 1CTEA 3I06A 4YYQA 1KFXL 2NQGA 1TL9A 1PPDA 2C0YA 3H8BA 1NPZA 1AU4A 1QDQA 1EWMA 1YK7A 3OVXA 3P5WA 2DCAA 1EWLA 2HD5A 2AUXA 1K3BB 1JQPA 1MS6A 4MZSA 4WA6A 4X6HA 1F2AA 2BDZA 3KFQA 1PCIA 1BQIA 1U9QX 4XR7A 3E1ZB 1KXRA 3LFYA 3CH2X 4K7CA 3RVWA 4OEMA 2NQDB 2E03A 4I04A 4YV8A 1Y08A 4FK5A 4HWYA 1CV8A 5EGWA 2FYEA 1AIMA 2R9FA 1AYUA 2PADA 2AIMA 3QSDA 1ATKA 3PNRA 2O6XA 3D6SA 2G6DA 2FRAA 4CDCB 1U5IA 1GCBA 4QRXA 1NB5A 2YJ2A 4RY2A 1EF7A 1PE6A 2DZZA 4I07A 2P0RA 2DJGB 4CZWA 4YVAA 4KLBA 2FQ9A 1MEMA 4DMYA 1PIPA 2JQGR 2E02A 1NB3A 3HWNA 1Y4HA 2AYOA 2G8EA 1KFUL 1GMYA 1MEGA 1SNKA 1PADA 3TNXA 3WXEA 4I05A 4YYWA 5CHVA 3OVZA 3IUTA 4AXLA 3N4CA 2AUZA 1GECE 3IMAA 3HHAA 3QT4A 4YYVA 3K24A 5CVMA 3I3TA 3IEJA 2FTDA 3M99A 4BS6A 2FT2A 4MZOA 2FRQA 1NL6A 4PI3A 3P5VA 2YJBA 2DC9A 1PPNA 1CB5A 3BOWA 3H7DA 1THEA 1YALA 4AXMA 2F7DA 2GHUA 3H89A 1AU2A 1MDWA 2OP3A 1CQDA 3P5XA 1VSNA 1CJLA 1O0EA 5CHTA 3K9MA 1F2BA 1KHPA 5K16A 3MTNA 3OISA 2R9CA 4YYRA 1PPPA 4BQVA 3CBKA 2ACTA 1CS8A 2CIOA 4BS5A 3B79A 1YK8A 3K8UA 1MHWA 3KWBX 2DCCA 2IPPB 1BGOA 4YYUA 1PXVA 1BP4A 3CH3X 1XKGA 1M6DA 3USVA 1GLOA 1AYWA 2NQAA 1ME3A 2E00A 3IV2A 2DJFB 3RVXA 4QH6A 3BPFA 4N79A 2GFOA 3PDFA 1QOLA 5CVOB 2IBIA 1ZIVA 2VHSA 3ERVA 5JH3A 1BY8A 3PW3A 5J94A 3F5VA 4XUIA 4N8WA 3BC3A 3C9EA 1HUCB 2B1MA 5A24A 3NHEA 2Y5BA 4W4UA 2Y6EA 4P6EA 3IHPA 3GCBA 7PCKA 1AECA 4FIPA 4CDFB 2AYNA 3BWKA 1ME4A 3ZUAA 2XU1A 1S4VA 4CDDB 4PP2E 2ARYA 2DC6A 1KHQA 1TLOA 1PBHA 3BPMA 2R9NA 1MIRA 2VHFA 1EWOA 2ATOA 4G54A 4X6JA 1ZCMA 2P86A 3WXGA 2PBHA 8PCHA 2DC8A 1YVBA 3KX1A 1AYVA 2HH5A 4N4ZA 2DCBA 3IOQA 1U9XA 4P6GA 3LXSA 3HD3A 3N3KA 1FH0A 2F1GA 3H6SA 3OF8A 1F29A 3DF0A 1Q6KA 2H7JA 3MHHA 6PADA 2YJCA 2PREA 3AI8A 3S3RA 1AU0A 3KSEA 3P5UA 3H8CA 4QRVA 5PADA 4QBBA 5JA7A 1POPA 3WXFA 1STFE 3PBHA 4BPVA 4CDEB 2OZ2A 4W5CA 3V6CA 2FUDA 1NQCA 4Q8HA 5EF4A 3RVVA 1EWPA 4X6IA 4Q8GA 1ITOA 2HHNA
chains in the Genus database with same CATH superfamily
4BOSA 2AS8A 2CB5A 3MTVA 2DCDA 3QJ3A 4QRGA 2G8JA 3KW9A 4IUMA 4ZUXU 5CVNB 2NQIA 2HXZA 2AVWA 2YJ9A 1U9WA 4FJCA 1YT7A 1A6RA 2OULA 4BSQA 3V6EA 2XU3A 2FO5A 1ICFA 1QXPA 3MORA 3O1GA 2UZJA 5F02A 1DEUA 3OF9A 1DF0A 5FPWA 2DZYA 9PAPA 1IWDA 1CPJA 1U9VA 4MSXA 1NLJA 4BOQA 4MI7A 3CBJA 2B1NA 2R6NA 4BOPA 1AU3A 2BDLA 1PPOA 2PNSA 4XZXA 2R9OA 1TU6A 4DMXA 2AU1A 3KWZA 4RF1A 3C0RA 3S3QA 1QMYA 2YJ8A 2R9MA 1CVZA 2JQFR 2WBFX 1X9YA 3U8EA 1F2CA 5EZSA 4OELA 4PP1A 4PADA 3MHSA 3HHIA 1SP4B 2DC7A 3BCNA 3F75A 2P7UA 4W5BA 4YYSA 2E01A 1VJVA 1CSBB 3N3GA 3KKUA 2XU4A 3IFUA 4P16A 2G7YA 2XU5A 3O0UA 3PRPA 1CTEA 3I06A 3OQCA 4YYQA 1KFXL 2NQGA 1TL9A 1PPDA 4MM3B 4IP3A 2C0YA 3H8BA 1NPZA 1AU4A 1QDQA 1EWMA 1YK7A 3OVXA 3P5WA 2DCAA 1EWLA 2HD5A 2AUXA 1K3BB 1JQPA 1MS6A 4MZSA 4WA6A 4X6HA 1F2AA 2BDZA 3KFQA 1PCIA 1BQIA 4D8EA 1U9QX 4XR7A 3E1ZB 1KXRA 3LFYA 3CH2X 4K7CA 3RVWA 4OEMA 2NQDB 3PRMA 2E03A 4I04A 2DOSA 2BTWB 4YV8A 1PVJA 1Y08A 4OVZB 4FK5A 4HWYA 1CV8A 5EGWA 3PHXA 2FYEA 1AIMA 2R9FA 1AYUA 2PADA 4GUAA 2AIMA 3PHWA 5E6JA 3QSDA 1ATKA 3PNRA 2O6XA 3RNVA 3BB7A 3D6SA 2G6DA 2FRAA 4CDCB 1U5IA 1GCBA 4QRXA 1NB5A 2YJ2A 4RY2A 1EF7A 1PE6A 2DZZA 4I07A 2P0RA 2DJGB 4CZWA 4YVAA 4KLBA 2FQ9A 1MEMA 4DMYA 1PIPA 4HXDB 2JQGR 2E02A 1NB3A 3HWNA 1Y4HA 2AYOA 2G8EA 1KFUL 1GMYA 1MEGA 1SNKA 1PADA 3TNXA 3WXEA 4I05A 4YYWA 3W31A 5CHVA 3OVZA 3IUTA 4AXLA 3N4CA 2AUZA 3QT4A 1GECE 3HHAA 3IMAA 4YYVA 3K24A 3MJ5A 5CVMA 3I3TA 3IEJA 2FTDA 3TMPA 3M99A 4BS6A 2FT2A 4MZOA 2FRQA 3B21A 1NL6A 4PI3A 3P5VA 2YJBA 2DC9A 1PPNA 1CB5A 3BOWA 4REZA 3H7DA 1THEA 1YALA 4BOUA 4AXMA 2F7DA 2GHUA 3H89A 1AU2A 1MDWA 3TRKA 2OP3A 2J7QA 5EZQA 1CQDA 3P5XA 1VSNA 1CJLA 2Z84A 1O0EA 5CHTA 3K9MA 1F2BA 1KHPA 5K16A 3MTNA 3OISA 2R9CA 4YYRA 1PPPA 4BQVA 3CBKA 4OVZA 2ACTA 2J7QC 1CS8A 2CIOA 4BS5A 3B79A 1YK8A 3K8UA 1MHWA 3KWBX 2DCCA 2IPPB 1BGOA 4OW0A 4YYUA 1PXVA 1BP4A 3CH3X 1XKGA 1M6DA 3USVA 1GLOA 2AGAA 1AYWA 2NQAA 1ME3A 2E00A 3IV2A 2DJFB 3RVXA 4QH6A 3BPFA 4N79A 2GFOA 3PDFA 1QOLA 5CVOB 2IBIA 1ZIVA 2VHSA 4RNAA 2BTWA 3ERVA 5JH3A 1BY8A 3PW3A 5J94A 3F5VA 3O65A 1DKIA 3MP2A 4WURA 3PT2A 4XUIA 4N8WA 4ZTBA 3BC3A 3C9EA 1HUCB 2B1MA 4D8IA 4A5UA 5A24A 3NHEA 4R3DA 2Y5BA 4W4UA 2Y6EA 4P6EA 3IHPA 3GCBA 7PCKA 1AECA 4FIPA 4CDFB 3W30A 4BOZA 2AYNA 3BWKA 1UKFA 2BU3A 1ME4A 2JRIA 3ZUAA 4D8BA 2XU1A 1S4VA 4CDDB 4PP2E 2ARYA 2DC6A 1KHQA 1TLOA 1PBHA 3BPMA 2R9NA 1MIRA 2VHFA 1EWOA 2ATOA 3ZNHA 2JTCA 4G54A 4X6JA 1ZCMA 3PHUA 2P86A 3WXGA 2PBHA 5JZEA 8PCHA 2DC8A 1YVBA 3KX1A 1AYVA 4RKXA 4M0WA 2HH5A 4N4ZA 2DCBA 3IOQA 1U9XA 4P6GA 3LXSA 3HD3A 3N3KA 1FH0A 2F1GA 3H6SA 3OF8A 3BBAA 4PT5A 1F29A 3E9SA 1YZBA 3DF0A 1Q6KA 2H7JA 3MHHA 2FE8A 6PADA 2YJCA 2PREA 3BY4A 3AI8A 2HWKA 3S3RA 1AU0A 3KSEA 3P5UA 3H8CA 4QRVA 5PADA 4QBBA 5JA7A 1POPA 3WXFA 1STFE 3PBHA 4BPVA 4CDEB 2OZ2A 4W5CA 3V6CA 5KO3A 2FUDA 1NQCA 4Q8HA 5EF4A 3PSEA 3RVVA 1EWPA 4X6IA 4Q8GA 4RF0A 1ITOA 2HHNA
chains in the Genus database with same CATH topology
2AS8A 2CB5A 2DCDA 3QJ3A 4QRGA 2G8JA 3KW9A 4ZUXU 5CVNB 2NQIA 2HXZA 2AVWA 2YJ9A 1U9WA 4FJCA 4BGFA 1YT7A 1A6RA 2OULA 4BSQA 3V6EA 2XU3A 2FO5A 1ICFA 1QXPA 2VFCA 3MORA 3O1GA 5F02A 1DEUA 3OF9A 1DF0A 5FPWA 2DZYA 9PAPA 1IWDA 1CPJA 1U9VA 4MSXA 1NLJA 3CBJA 4B55A 2B1NA 2R6NA 1AU3A 2BDLA 1PPOA 2PNSA 2R9OA 1TU6A 2BSZA 4DMXA 2AU1A 3KWZA 3S3QA 1QMYA 2YJ8A 2R9MA 1CVZA 2JQFR 2WBFX 1X9YA 3U8EA 1F2CA 4OELA 4PP1A 4PADA 3MHSA 3HHIA 1SP4B 2DC7A 3BCNA 3F75A 2P7UA 4W5BA 4YYSA 2E01A 1VJVA 1CSBB 3N3GA 3KKUA 2XU4A 2G7YA 2XU5A 3O0UA 1CTEA 3I06A 4YYQA 1KFXL 2NQGA 1TL9A 1PPDA 2C0YA 3H8BA 1NPZA 1AU4A 1QDQA 1EWMA 1YK7A 3OVXA 3P5WA 2DCAA 1EWLA 2HD5A 2AUXA 1K3BB 1JQPA 1MS6A 4MZSA 4WA6A 4X6HA 1F2AA 2BDZA 3KFQA 1PCIA 1BQIA 1U9QX 4XR7A 3E1ZB 1KXRA 3LFYA 3CH2X 4K7CA 3RVWA 4OEMA 2NQDB 2E03A 4I04A 4NV8A 4YV8A 1Y08A 4FK5A 4HWYA 1CV8A 5EGWA 2FYEA 1AIMA 2R9FA 1W6FA 1AYUA 2PADA 2AIMA 3QSDA 1W4TA 1ATKA 3PNRA 2O6XA 3D6SA 2G6DA 2FRAA 4CDCB 1U5IA 1GCBA 4QRXA 1NB5A 2YJ2A 4RY2A 1EF7A 1PE6A 2DZZA 4GUZA 4I07A 2P0RA 2DJGB 4CZWA 4YVAA 4KLBA 2FQ9A 1MEMA 4DMYA 1PIPA 2JQGR 2E02A 1NB3A 3HWNA 1Y4HA 2AYOA 2G8EA 1KFUL 1GMYA 1MEGA 1SNKA 1PADA 3TNXA 3WXEA 4I05A 4YYWA 4C5PA 5CHVA 3OVZA 3IUTA 4AXLA 4NV7A 3N4CA 2AUZA 1GECE 3IMAA 3HHAA 3QT4A 4YYVA 3K24A 5CVMA 3I3TA 3IEJA 2FTDA 3M99A 1W5RA 1GX3A 4BS6A 2FT2A 4MZOA 2FRQA 1NL6A 4PI3A 3P5VA 2YJBA 2DC9A 1PPNA 1CB5A 3BOWA 3H7DA 1THEA 1YALA 4AXMA 2F7DA 2GHUA 3LTWA 3H89A 1AU2A 1MDWA 2OP3A 1CQDA 3P5XA 1VSNA 1CJLA 1O0EA 5CHTA 3K9MA 1F2BA 1KHPA 5K16A 3MTNA 3OISA 2R9CA 4YYRA 1PPPA 4BQVA 3CBKA 2ACTA 1CS8A 2CIOA 4BS5A 3B79A 1YK8A 3K8UA 1MHWA 3KWBX 2DCCA 2IPPB 1BGOA 4YYUA 1PXVA 1BP4A 3CH3X 1XKGA 1M6DA 3USVA 1GLOA 1AYWA 2NQAA 1ME3A 2E00A 3IV2A 2DJFB 3RVXA 4QH6A 3BPFA 4N79A 2GFOA 3PDFA 1QOLA 5CVOB 2IBIA 1ZIVA 2VHSA 3ERVA 5JH3A 1BY8A 3PW3A 5J94A 3F5VA 4XUIA 4N8WA 3BC3A 3C9EA 1HUCB 2B1MA 5A24A 3NHEA 2Y5BA 4W4UA 2Y6EA 4P6EA 3IHPA 3GCBA 1E2TA 7PCKA 1AECA 4FIPA 4CDFB 2AYNA 3BWKA 1ME4A 3ZUAA 2XU1A 1S4VA 4CDDB 4PP2E 2ARYA 3D9WA 2DC6A 1KHQA 1TLOA 1PBHA 3BPMA 2R9NA 1MIRA 2VHFA 1EWOA 2ATOA 4G54A 4X6JA 1ZCMA 2VFBA 2P86A 3WXGA 2PBHA 8PCHA 2DC8A 1YVBA 3KX1A 1AYVA 2HH5A 4N4ZA 2DCBA 3IOQA 1U9XA 4P6GA 3LXSA 3HD3A 3N3KA 1FH0A 2F1GA 3H6SA 3OF8A 1F29A 3DF0A 1Q6KA 2H7JA 3MHHA 6PADA 2YJCA 2PREA 3AI8A 3S3RA 1AU0A 3KSEA 3P5UA 3H8CA 4QRVA 5PADA 4QBBA 5JA7A 1POPA 3WXFA 1STFE 3PBHA 4BPVA 4CDEB 2OZ2A 4W5CA 3V6CA 2FUDA 1NQCA 4Q8HA 5EF4A 3RVVA 1EWPA 4X6IA 4Q8GA 1ITOA 2HHNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AS8 A;  2CB5 A;  2DCD A;  3QJ3 A;  4QRG A;  2G8J A;  3KW9 A;  4ZUX U;  5CVN B;  2NQI A;  2HXZ A;  2AVW A;  2YJ9 A;  1U9W A;  4FJC A;  1YT7 A;  1A6R A;  2OUL A;  4BSQ A;  3V6E A;  2XU3 A;  2FO5 A;  1ICF A;  1QXP A;  3MOR A;  3O1G A;  5F02 A;  1DEU A;  3OF9 A;  1DF0 A;  5FPW A;  2DZY A;  9PAP A;  1IWD A;  1CPJ A;  1U9V A;  4MSX A;  1NLJ A;  3CBJ A;  2B1N A;  2R6N A;  1AU3 A;  2BDL A;  1PPO A;  2PNS A;  2R9O A;  1TU6 A;  4DMX A;  2AU1 A;  3KWZ A;  3S3Q A;  1QMY A;  2YJ8 A;  2R9M A;  1CVZ A;  2JQF R;  2WBF X;  1X9Y A;  3U8E A;  1F2C A;  4OEL A;  4PP1 A;  4PAD A;  3MHS A;  3HHI A;  1SP4 B;  2DC7 A;  3BCN A;  3F75 A;  2P7U A;  4W5B A;  4YYS A;  2E01 A;  1VJV A;  1CSB B;  3N3G A;  3KKU A;  2XU4 A;  2G7Y A;  2XU5 A;  3O0U A;  1CTE A;  3I06 A;  4YYQ A;  1KFX L;  2NQG A;  1TL9 A;  1PPD A;  2C0Y A;  3H8B A;  1NPZ A;  1AU4 A;  1QDQ A;  1EWM A;  1YK7 A;  3OVX A;  3P5W A;  2DCA A;  1EWL A;  2HD5 A;  2AUX A;  1K3B B;  1JQP A;  1MS6 A;  4MZS A;  4WA6 A;  4X6H A;  1F2A A;  2BDZ A;  3KFQ A;  1PCI A;  1BQI A;  1U9Q X;  4XR7 A;  3E1Z B;  1KXR A;  3LFY A;  3CH2 X;  4K7C A;  3RVW A;  4OEM A;  2NQD B;  2E03 A;  4I04 A;  4YV8 A;  1Y08 A;  4FK5 A;  4HWY A;  1CV8 A;  5EGW A;  2FYE A;  1AIM A;  2R9F A;  1AYU A;  2PAD A;  2AIM A;  3QSD A;  1ATK A;  3PNR A;  2O6X A;  3D6S A;  2G6D A;  2FRA A;  4CDC B;  1U5I A;  1GCB A;  4QRX A;  1NB5 A;  2YJ2 A;  4RY2 A;  1EF7 A;  1PE6 A;  2DZZ A;  4I07 A;  2P0R A;  2DJG B;  4CZW A;  4YVA A;  4KLB A;  2FQ9 A;  1MEM A;  4DMY A;  1PIP A;  2JQG R;  2E02 A;  1NB3 A;  3HWN A;  1Y4H A;  2AYO A;  2G8E A;  1KFU L;  1GMY A;  1MEG A;  1SNK A;  1PAD A;  3TNX A;  3WXE A;  4I05 A;  4YYW A;  5CHV A;  3OVZ A;  3IUT A;  4AXL A;  3N4C A;  2AUZ A;  1GEC E;  3IMA A;  3HHA A;  3QT4 A;  4YYV A;  3K24 A;  5CVM A;  3I3T A;  3IEJ A;  2FTD A;  3M99 A;  4BS6 A;  2FT2 A;  4MZO A;  2FRQ A;  1NL6 A;  4PI3 A;  3P5V A;  2YJB A;  2DC9 A;  1PPN A;  1CB5 A;  3BOW A;  3H7D A;  1THE A;  1YAL A;  4AXM A;  2F7D A;  2GHU A;  3H89 A;  1AU2 A;  1MDW A;  2OP3 A;  1CQD A;  3P5X A;  1VSN A;  1CJL A;  1O0E A;  5CHT A;  3K9M A;  1F2B A;  1KHP A;  5K16 A;  3MTN A;  3OIS A;  2R9C A;  4YYR A;  1PPP A;  4BQV A;  3CBK A;  2ACT A;  1CS8 A;  2CIO A;  4BS5 A;  3B79 A;  1YK8 A;  3K8U A;  1MHW A;  3KWB X;  2DCC A;  2IPP B;  1BGO A;  4YYU A;  1PXV A;  1BP4 A;  3CH3 X;  1XKG A;  1M6D A;  3USV A;  1GLO A;  1AYW A;  2NQA A;  1ME3 A;  2E00 A;  3IV2 A;  2DJF B;  3RVX A;  4QH6 A;  3BPF A;  4N79 A;  2GFO A;  3PDF A;  1QOL A;  5CVO B;  2IBI A;  1ZIV A;  2VHS A;  3ERV A;  5JH3 A;  1BY8 A;  3PW3 A;  5J94 A;  3F5V A;  4XUI A;  4N8W A;  3BC3 A;  3C9E A;  1HUC B;  2B1M A;  5A24 A;  3NHE A;  2Y5B A;  4W4U A;  2Y6E A;  4P6E A;  3IHP A;  3GCB A;  7PCK A;  1AEC A;  4FIP A;  4CDF B;  2AYN A;  3BWK A;  1ME4 A;  3ZUA A;  2XU1 A;  1S4V A;  4CDD B;  4PP2 E;  2ARY A;  2DC6 A;  1KHQ A;  1TLO A;  1PBH A;  3BPM A;  2R9N A;  1MIR A;  2VHF A;  1EWO A;  2ATO A;  4G54 A;  4X6J A;  1ZCM A;  2P86 A;  3WXG A;  2PBH A;  8PCH A;  2DC8 A;  1YVB A;  3KX1 A;  1AYV A;  2HH5 A;  4N4Z A;  2DCB A;  3IOQ A;  1U9X A;  4P6G A;  3LXS A;  3HD3 A;  3N3K A;  1FH0 A;  2F1G A;  3H6S A;  3OF8 A;  1F29 A;  3DF0 A;  1Q6K A;  2H7J A;  3MHH A;  6PAD A;  2YJC A;  2PRE A;  3AI8 A;  3S3R A;  1AU0 A;  3KSE A;  3P5U A;  3H8C A;  4QRV A;  5PAD A;  4QBB A;  5JA7 A;  1POP A;  3WXF A;  1STF E;  3PBH A;  4BPV A;  4CDE B;  2OZ2 A;  4W5C A;  3V6C A;  2FUD A;  1NQC A;  4Q8H A;  5EF4 A;  3RVV A;  1EWP A;  4X6I A;  4Q8G A;  1ITO A;  2HHN A; 
#chains in the Genus database with same CATH topology
 4BOS A;  2AS8 A;  2CB5 A;  3MTV A;  2DCD A;  3QJ3 A;  4QRG A;  2G8J A;  3KW9 A;  4IUM A;  4ZUX U;  5CVN B;  2NQI A;  2HXZ A;  2AVW A;  2YJ9 A;  1U9W A;  4FJC A;  1YT7 A;  1A6R A;  2OUL A;  4BSQ A;  3V6E A;  2XU3 A;  2FO5 A;  1ICF A;  1QXP A;  3MOR A;  3O1G A;  2UZJ A;  5F02 A;  1DEU A;  3OF9 A;  1DF0 A;  5FPW A;  2DZY A;  9PAP A;  1IWD A;  1CPJ A;  1U9V A;  4MSX A;  1NLJ A;  4BOQ A;  4MI7 A;  3CBJ A;  2B1N A;  2R6N A;  4BOP A;  1AU3 A;  2BDL A;  1PPO A;  2PNS A;  4XZX A;  2R9O A;  1TU6 A;  4DMX A;  2AU1 A;  3KWZ A;  4RF1 A;  3C0R A;  3S3Q A;  1QMY A;  2YJ8 A;  2R9M A;  1CVZ A;  2JQF R;  2WBF X;  1X9Y A;  3U8E A;  1F2C A;  5EZS A;  4OEL A;  4PP1 A;  4PAD A;  3MHS A;  3HHI A;  1SP4 B;  2DC7 A;  3BCN A;  3F75 A;  2P7U A;  4W5B A;  4YYS A;  2E01 A;  1VJV A;  1CSB B;  3N3G A;  3KKU A;  2XU4 A;  3IFU A;  4P16 A;  2G7Y A;  2XU5 A;  3O0U A;  3PRP A;  1CTE A;  3I06 A;  3OQC A;  4YYQ A;  1KFX L;  2NQG A;  1TL9 A;  1PPD A;  4MM3 B;  4IP3 A;  2C0Y A;  3H8B A;  1NPZ A;  1AU4 A;  1QDQ A;  1EWM A;  1YK7 A;  3OVX A;  3P5W A;  2DCA A;  1EWL A;  2HD5 A;  2AUX A;  1K3B B;  1JQP A;  1MS6 A;  4MZS A;  4WA6 A;  4X6H A;  1F2A A;  2BDZ A;  3KFQ A;  1PCI A;  1BQI A;  4D8E A;  1U9Q X;  4XR7 A;  3E1Z B;  1KXR A;  3LFY A;  3CH2 X;  4K7C A;  3RVW A;  4OEM A;  2NQD B;  3PRM A;  2E03 A;  4I04 A;  2DOS A;  2BTW B;  4YV8 A;  1PVJ A;  1Y08 A;  4OVZ B;  4FK5 A;  4HWY A;  1CV8 A;  5EGW A;  3PHX A;  2FYE A;  1AIM A;  2R9F A;  1AYU A;  2PAD A;  4GUA A;  2AIM A;  3PHW A;  5E6J A;  3QSD A;  1ATK A;  3PNR A;  2O6X A;  3RNV A;  3BB7 A;  3D6S A;  2G6D A;  2FRA A;  4CDC B;  1U5I A;  1GCB A;  4QRX A;  1NB5 A;  2YJ2 A;  4RY2 A;  1EF7 A;  1PE6 A;  2DZZ A;  4I07 A;  2P0R A;  2DJG B;  4CZW A;  4YVA A;  4KLB A;  2FQ9 A;  1MEM A;  4DMY A;  1PIP A;  4HXD B;  2JQG R;  2E02 A;  1NB3 A;  3HWN A;  1Y4H A;  2AYO A;  2G8E A;  1KFU L;  1GMY A;  1MEG A;  1SNK A;  1PAD A;  3TNX A;  3WXE A;  4I05 A;  4YYW A;  3W31 A;  5CHV A;  3OVZ A;  3IUT A;  4AXL A;  3N4C A;  2AUZ A;  3QT4 A;  1GEC E;  3HHA A;  3IMA A;  4YYV A;  3K24 A;  3MJ5 A;  5CVM A;  3I3T A;  3IEJ A;  2FTD A;  3TMP A;  3M99 A;  4BS6 A;  2FT2 A;  4MZO A;  2FRQ A;  3B21 A;  1NL6 A;  4PI3 A;  3P5V A;  2YJB A;  2DC9 A;  1PPN A;  1CB5 A;  3BOW A;  4REZ A;  3H7D A;  1THE A;  1YAL A;  4BOU A;  4AXM A;  2F7D A;  2GHU A;  3H89 A;  1AU2 A;  1MDW A;  3TRK A;  2OP3 A;  2J7Q A;  5EZQ A;  1CQD A;  3P5X A;  1VSN A;  1CJL A;  2Z84 A;  1O0E A;  5CHT A;  3K9M A;  1F2B A;  1KHP A;  5K16 A;  3MTN A;  3OIS A;  2R9C A;  4YYR A;  1PPP A;  4BQV A;  3CBK A;  4OVZ A;  2ACT A;  2J7Q C;  1CS8 A;  2CIO A;  4BS5 A;  3B79 A;  1YK8 A;  3K8U A;  1MHW A;  3KWB X;  2DCC A;  2IPP B;  1BGO A;  4OW0 A;  4YYU A;  1PXV A;  1BP4 A;  3CH3 X;  1XKG A;  1M6D A;  3USV A;  1GLO A;  2AGA A;  1AYW A;  2NQA A;  1ME3 A;  2E00 A;  3IV2 A;  2DJF B;  3RVX A;  4QH6 A;  3BPF A;  4N79 A;  2GFO A;  3PDF A;  1QOL A;  5CVO B;  2IBI A;  1ZIV A;  2VHS A;  4RNA A;  2BTW A;  3ERV A;  5JH3 A;  1BY8 A;  3PW3 A;  5J94 A;  3F5V A;  3O65 A;  1DKI A;  3MP2 A;  4WUR A;  3PT2 A;  4XUI A;  4N8W A;  4ZTB A;  3BC3 A;  3C9E A;  1HUC B;  2B1M A;  4D8I A;  4A5U A;  5A24 A;  3NHE A;  4R3D A;  2Y5B A;  4W4U A;  2Y6E A;  4P6E A;  3IHP A;  3GCB A;  7PCK A;  1AEC A;  4FIP A;  4CDF B;  3W30 A;  4BOZ A;  2AYN A;  3BWK A;  1UKF A;  2BU3 A;  1ME4 A;  2JRI A;  3ZUA A;  4D8B A;  2XU1 A;  1S4V A;  4CDD B;  4PP2 E;  2ARY A;  2DC6 A;  1KHQ A;  1TLO A;  1PBH A;  3BPM A;  2R9N A;  1MIR A;  2VHF A;  1EWO A;  2ATO A;  3ZNH A;  2JTC A;  4G54 A;  4X6J A;  1ZCM A;  3PHU A;  2P86 A;  3WXG A;  2PBH A;  5JZE A;  8PCH A;  2DC8 A;  1YVB A;  3KX1 A;  1AYV A;  4RKX A;  4M0W A;  2HH5 A;  4N4Z A;  2DCB A;  3IOQ A;  1U9X A;  4P6G A;  3LXS A;  3HD3 A;  3N3K A;  1FH0 A;  2F1G A;  3H6S A;  3OF8 A;  3BBA A;  4PT5 A;  1F29 A;  3E9S A;  1YZB A;  3DF0 A;  1Q6K A;  2H7J A;  3MHH A;  2FE8 A;  6PAD A;  2YJC A;  2PRE A;  3BY4 A;  3AI8 A;  2HWK A;  3S3R A;  1AU0 A;  3KSE A;  3P5U A;  3H8C A;  4QRV A;  5PAD A;  4QBB A;  5JA7 A;  1POP A;  3WXF A;  1STF E;  3PBH A;  4BPV A;  4CDE B;  2OZ2 A;  4W5C A;  3V6C A;  5KO3 A;  2FUD A;  1NQC A;  4Q8H A;  5EF4 A;  3PSE A;  3RVV A;  1EWP A;  4X6I A;  4Q8G A;  4RF0 A;  1ITO A;  2HHN A; 
#chains in the Genus database with same CATH homology
 2AS8 A;  2CB5 A;  2DCD A;  3QJ3 A;  4QRG A;  2G8J A;  3KW9 A;  4ZUX U;  5CVN B;  2NQI A;  2HXZ A;  2AVW A;  2YJ9 A;  1U9W A;  4FJC A;  4BGF A;  1YT7 A;  1A6R A;  2OUL A;  4BSQ A;  3V6E A;  2XU3 A;  2FO5 A;  1ICF A;  1QXP A;  2VFC A;  3MOR A;  3O1G A;  5F02 A;  1DEU A;  3OF9 A;  1DF0 A;  5FPW A;  2DZY A;  9PAP A;  1IWD A;  1CPJ A;  1U9V A;  4MSX A;  1NLJ A;  3CBJ A;  4B55 A;  2B1N A;  2R6N A;  1AU3 A;  2BDL A;  1PPO A;  2PNS A;  2R9O A;  1TU6 A;  2BSZ A;  4DMX A;  2AU1 A;  3KWZ A;  3S3Q A;  1QMY A;  2YJ8 A;  2R9M A;  1CVZ A;  2JQF R;  2WBF X;  1X9Y A;  3U8E A;  1F2C A;  4OEL A;  4PP1 A;  4PAD A;  3MHS A;  3HHI A;  1SP4 B;  2DC7 A;  3BCN A;  3F75 A;  2P7U A;  4W5B A;  4YYS A;  2E01 A;  1VJV A;  1CSB B;  3N3G A;  3KKU A;  2XU4 A;  2G7Y A;  2XU5 A;  3O0U A;  1CTE A;  3I06 A;  4YYQ A;  1KFX L;  2NQG A;  1TL9 A;  1PPD A;  2C0Y A;  3H8B A;  1NPZ A;  1AU4 A;  1QDQ A;  1EWM A;  1YK7 A;  3OVX A;  3P5W A;  2DCA A;  1EWL A;  2HD5 A;  2AUX A;  1K3B B;  1JQP A;  1MS6 A;  4MZS A;  4WA6 A;  4X6H A;  1F2A A;  2BDZ A;  3KFQ A;  1PCI A;  1BQI A;  1U9Q X;  4XR7 A;  3E1Z B;  1KXR A;  3LFY A;  3CH2 X;  4K7C A;  3RVW A;  4OEM A;  2NQD B;  2E03 A;  4I04 A;  4NV8 A;  4YV8 A;  1Y08 A;  4FK5 A;  4HWY A;  1CV8 A;  5EGW A;  2FYE A;  1AIM A;  2R9F A;  1W6F A;  1AYU A;  2PAD A;  2AIM A;  3QSD A;  1W4T A;  1ATK A;  3PNR A;  2O6X A;  3D6S A;  2G6D A;  2FRA A;  4CDC B;  1U5I A;  1GCB A;  4QRX A;  1NB5 A;  2YJ2 A;  4RY2 A;  1EF7 A;  1PE6 A;  2DZZ A;  4GUZ A;  4I07 A;  2P0R A;  2DJG B;  4CZW A;  4YVA A;  4KLB A;  2FQ9 A;  1MEM A;  4DMY A;  1PIP A;  2JQG R;  2E02 A;  1NB3 A;  3HWN A;  1Y4H A;  2AYO A;  2G8E A;  1KFU L;  1GMY A;  1MEG A;  1SNK A;  1PAD A;  3TNX A;  3WXE A;  4I05 A;  4YYW A;  4C5P A;  5CHV A;  3OVZ A;  3IUT A;  4AXL A;  4NV7 A;  3N4C A;  2AUZ A;  1GEC E;  3IMA A;  3HHA A;  3QT4 A;  4YYV A;  3K24 A;  5CVM A;  3I3T A;  3IEJ A;  2FTD A;  3M99 A;  1W5R A;  1GX3 A;  4BS6 A;  2FT2 A;  4MZO A;  2FRQ A;  1NL6 A;  4PI3 A;  3P5V A;  2YJB A;  2DC9 A;  1PPN A;  1CB5 A;  3BOW A;  3H7D A;  1THE A;  1YAL A;  4AXM A;  2F7D A;  2GHU A;  3LTW A;  3H89 A;  1AU2 A;  1MDW A;  2OP3 A;  1CQD A;  3P5X A;  1VSN A;  1CJL A;  1O0E A;  5CHT A;  3K9M A;  1F2B A;  1KHP A;  5K16 A;  3MTN A;  3OIS A;  2R9C A;  4YYR A;  1PPP A;  4BQV A;  3CBK A;  2ACT A;  1CS8 A;  2CIO A;  4BS5 A;  3B79 A;  1YK8 A;  3K8U A;  1MHW A;  3KWB X;  2DCC A;  2IPP B;  1BGO A;  4YYU A;  1PXV A;  1BP4 A;  3CH3 X;  1XKG A;  1M6D A;  3USV A;  1GLO A;  1AYW A;  2NQA A;  1ME3 A;  2E00 A;  3IV2 A;  2DJF B;  3RVX A;  4QH6 A;  3BPF A;  4N79 A;  2GFO A;  3PDF A;  1QOL A;  5CVO B;  2IBI A;  1ZIV A;  2VHS A;  3ERV A;  5JH3 A;  1BY8 A;  3PW3 A;  5J94 A;  3F5V A;  4XUI A;  4N8W A;  3BC3 A;  3C9E A;  1HUC B;  2B1M A;  5A24 A;  3NHE A;  2Y5B A;  4W4U A;  2Y6E A;  4P6E A;  3IHP A;  3GCB A;  1E2T A;  7PCK A;  1AEC A;  4FIP A;  4CDF B;  2AYN A;  3BWK A;  1ME4 A;  3ZUA A;  2XU1 A;  1S4V A;  4CDD B;  4PP2 E;  2ARY A;  3D9W A;  2DC6 A;  1KHQ A;  1TLO A;  1PBH A;  3BPM A;  2R9N A;  1MIR A;  2VHF A;  1EWO A;  2ATO A;  4G54 A;  4X6J A;  1ZCM A;  2VFB A;  2P86 A;  3WXG A;  2PBH A;  8PCH A;  2DC8 A;  1YVB A;  3KX1 A;  1AYV A;  2HH5 A;  4N4Z A;  2DCB A;  3IOQ A;  1U9X A;  4P6G A;  3LXS A;  3HD3 A;  3N3K A;  1FH0 A;  2F1G A;  3H6S A;  3OF8 A;  1F29 A;  3DF0 A;  1Q6K A;  2H7J A;  3MHH A;  6PAD A;  2YJC A;  2PRE A;  3AI8 A;  3S3R A;  1AU0 A;  3KSE A;  3P5U A;  3H8C A;  4QRV A;  5PAD A;  4QBB A;  5JA7 A;  1POP A;  3WXF A;  1STF E;  3PBH A;  4BPV A;  4CDE B;  2OZ2 A;  4W5C A;  3V6C A;  2FUD A;  1NQC A;  4Q8H A;  5EF4 A;  3RVV A;  1EWP A;  4X6I A;  4Q8G A;  1ITO A;  2HHN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...