1EF7A

Crystal structure of human cathepsin x
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
242
structure length
242
Chain Sequence
b'LPKSWDWRNVDGVNYASITRNQHIPQYCGSCWAHASTSAMADRINIKRKGAWPSTLLSVQNVIDCGNAGSCEGGNDLSVWDYAHQHGIPDETCNNYQAKDQECDKFNQCGTCNEFKECHAIRNYTLWRVGDYGSLSGREKMMAEIYANGPISCGIMATERLANYTGGIYAEYQDTTYINHVVSVAGWGISDGTEYWIVRNSWGEPWGERGWLRIVTSTYKDGKGARYNLAIEEHCTFGDPIV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CATHEPSIN X
publication title Crystal structure of cathepsin X: a flip-flop of the ring of His23 allows carboxy-monopeptidase and carboxy-dipeptidase activity of the protease.
pubmed doi rcsb
molecule tags Hydrolase
total genus 75
structure length 242
sequence length 242
chains with identical sequence B
ec nomenclature ec 3.4.18.1: Cathepsin X.
pdb deposition date 2000-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1ef7A00
1A6RA 4I04A 2PADA 3S3RA 1ME3A 1STFE 3H89A 5K16A 4PP2E 1X9YA 1SP4B 3K24A 2R9MA 2H7JA 5JA7A 2DC6A 1PBHA 1GCBA 3WXEA 1EWLA 4YYWA 3ERVA 3KKUA 3HWNA 2AYOA 2AYNA 2ARYA 3P5UA 4Q8HA 5PADA 1YT7A 1ATKA 2YJ2A 1AIMA 2GFOA 1VSNA 4FK5A 4K7CA 1PPPA 2C0YA 1BGOA 3MHHA 1Y4HA 1PPOA 1KHQA 3P5VA 4YYSA 2AU1A 1CJLA 1AU4A 3BOWA 3H8BA 4MZOA 1U9WA 1K3BB 3WXGA 1NQCA 1YK8A 1O0EA 1MS6A 2DJFB 2CB5A 1AYUA 1BY8A 3RVVA 3TNXA 3I06A 2YJBA 4WA6A 1M6DA 4QBBA 1GMYA 2NQDB 4QRXA 1U5IA 4YVAA 1VJVA 3U8EA 2ACTA 3KX1A 2IBIA 3HD3A 3H8CA 4N8WA 3PDFA 3BPFA 4W5BA 2DCDA 1NLJA 3GCBA 5CVNB 3OVZA 2AS8A 1POPA 2NQIA 1F2BA 1GLOA 1HUCB 2YJ9A 3WXFA 2P7UA 3IOQA 1NB3A 2E01A 1TL9A 2XU1A 1F2AA 2GHUA 2BDZA 1QMYA 4YYUA 2BDLA 3PW3A 1KHPA 2FRAA 4MSXA 3CH2X 4FJCA 3N4CA 3D6SA 2DZYA 3H7DA 3I3TA 2FUDA 4N4ZA 2PBHA 1Q6KA 2OP3A 1DEUA 2DZZA 3HHIA 3K8UA 4CDCB 1AYVA 2Y6EA 5A24A 5JH3A 2FO5A 3OISA 3E1ZB 4PI3A 4QH6A 2FYEA 1KXRA 1S4VA 2HH5A 4X6HA 3KFQA 1Y08A 5FPWA 3IUTA 4PP1A 5EGWA 1AYWA 2P0RA 1U9QX 3MHSA 5CVMA 3IHPA 1U9XA 3RVWA 3M99A 1CVZA 1NB5A 1QDQA 4YYQA 2G8JA 2HD5A 4ZUXU 5EF4A 3V6EA 4X6JA 1CSBB 1MDWA 1CV8A 1DF0A 1CB5A 3N3KA 2IPPB 4W4UA 3KWBX 3QJ3A 3RVXA 2O6XA 2XU4A 3BC3A 2FQ9A 3F75A 3IV2A 2P86A 3CBJA 4YYVA 1F29A 3MTNA 3ZUAA 4BPVA 2R9OA 1MEMA 2PREA 1EF7A 3H6SA 2YJCA 2FRQA 4BSQA 4XUIA 3N3GA 2DJGB 3BCNA 1PPNA 3LXSA 4CDDB 2YJ8A 2DCAA 6PADA 1EWOA 5CHVA 2R9CA 3MORA 2HHNA 3CBKA 3PNRA 4PADA 4AXMA 2AUZA 1PE6A 2F7DA 4I05A 2R9FA 1AU3A 3USVA 3CH3X 3OF8A 5F02A 1AECA 1CQDA 3IEJA 4OEMA 1NPZA 2DC7A 2G7YA 4I07A 1ITOA 2E00A 4XR7A 4FIPA 1TLOA 1PADA 1BP4A 1EWPA 1ME4A 2XU5A 2WBFX 4RY2A 1PXVA 4N79A 2NQGA 9PAPA 4QRVA 1MIRA 1QOLA 2G6DA 2FT2A 1XKGA 4OELA 2R9NA 1ICFA 3P5XA 3KSEA 3S3QA 5CVOB 4DMYA 1F2CA 1JQPA 1YVBA 4CDFB 2B1NA 2VHSA 3B79A 3V6CA 2NQAA 3OVXA 2OZ2A 4W5CA 4CDEB 4BS5A 3KW9A 4BQVA 1CS8A 1BQIA 4X6IA 2R6NA 4QRGA 2Y5BA 5J94A 3KWZA 3BPMA 1IWDA 3OF9A 3QT4A 2E02A 1AU2A 8PCHA 2AVWA 5CHTA 4DMXA 1MHWA 2F1GA 1U9VA 3DF0A 1PIPA 2E03A 1PPDA 4G54A 2DCCA 3O0UA 2XU3A 1EWMA 1YALA 2HXZA 3P5WA 2G8EA 4MZSA 1TU6A 2JQGR 2DCBA 1ZIVA 4HWYA 1FH0A 3AI8A 3NHEA 2JQFR 4CZWA 1AU0A 2CIOA 3K9MA 4AXLA 2DC9A 1YK7A 3BWKA 4P6GA 3LFYA 3HHAA 2DC8A 4BS6A 1QXPA 2PNSA 4YV8A 4YYRA 1NL6A 2OULA 4P6EA 4KLBA 2FTDA 3QSDA 2AUXA 3C9EA 7PCKA 4Q8GA 1KFUL 1CPJA 3O1GA 1KFXL 1THEA 2B1MA 2VHFA 1PCIA 1ZCMA 1MEGA 1CTEA 3F5VA 2AIMA 3IMAA 1GECE 2ATOA 3PBHA 1SNKA
chains in the Genus database with same CATH superfamily
1A6RA 4I04A 2PADA 3S3RA 1ME3A 1STFE 3H89A 5K16A 4PP2E 1X9YA 1SP4B 4RF0A 1YZBA 2R9MA 3K24A 2H7JA 5JA7A 2DC6A 1PBHA 1GCBA 3WXEA 4BOZA 1EWLA 4YYWA 3ERVA 3KKUA 3HWNA 2AYOA 2AYNA 2ARYA 3P5UA 4Q8HA 5PADA 1YT7A 1ATKA 2FE8A 2YJ2A 1AIMA 2GFOA 1VSNA 4FK5A 4K7CA 1PPPA 2C0YA 1BGOA 3MHHA 1Y4HA 1PPOA 4OVZA 1KHQA 3P5VA 4YYSA 2AU1A 1CJLA 3W30A 1AU4A 3BOWA 3H8BA 4MZOA 1U9WA 4BOSA 1K3BB 5KO3A 3WXGA 4GUAA 1NQCA 1YK8A 1O0EA 5EZQA 3PHXA 1MS6A 4MI7A 3W31A 3PHUA 5E6JA 2DJFB 2CB5A 1AYUA 1BY8A 3MJ5A 3RVVA 3TNXA 3B21A 3I06A 2YJBA 4WA6A 1M6DA 4QBBA 3C0RA 1GMYA 2NQDB 4QRXA 1U5IA 4YVAA 1VJVA 3U8EA 2ACTA 3KX1A 4OVZB 2IBIA 3HD3A 3H8CA 4N8WA 3PDFA 3BPFA 4W5BA 2DCDA 1NLJA 5JZEA 3GCBA 5CVNB 3OVZA 4IP3A 2AS8A 1POPA 2NQIA 1F2BA 1GLOA 1HUCB 2YJ9A 3WXFA 2P7UA 3IOQA 2HWKA 1NB3A 2E01A 1TL9A 2XU1A 1F2AA 2GHUA 2BDZA 3BB7A 1QMYA 4YYUA 2BDLA 3PW3A 1KHPA 2FRAA 4MSXA 3CH2X 3N4CA 4FJCA 3D6SA 4A5UA 2DZYA 3H7DA 3I3TA 2FUDA 4N4ZA 2PBHA 1Q6KA 2OP3A 1DEUA 2DZZA 3HHIA 3K8UA 4CDCB 1AYVA 2Y6EA 5A24A 5JH3A 2FO5A 3OISA 3E1ZB 4PI3A 4QH6A 2FYEA 1KXRA 1S4VA 2HH5A 4X6HA 4XZXA 3KFQA 1Y08A 5FPWA 3IUTA 4PP1A 5EGWA 1AYWA 3MTVA 2J7QA 1U9QX 2P0RA 3MHSA 5CVMA 3IHPA 1U9XA 3RVWA 3M99A 1CVZA 1NB5A 1QDQA 4YYQA 2G8JA 2HD5A 4ZUXU 5EF4A 3V6EA 4X6JA 1CSBB 3PT2A 1MDWA 5EZSA 1CV8A 4RF1A 1DF0A 2Z84A 1CB5A 3N3KA 2IPPB 4W4UA 3KWBX 2JRIA 4HXDB 3OQCA 2BTWA 3QJ3A 3MP2A 3RVXA 1UKFA 2O6XA 2XU4A 3BC3A 2FQ9A 3F75A 3IV2A 2P86A 3CBJA 4YYVA 1F29A 3MTNA 3ZUAA 4BPVA 2R9OA 1MEMA 2BU3A 2PREA 1EF7A 3H6SA 2YJCA 4IUMA 2FRQA 4BSQA 4XUIA 3N3GA 3PHWA 4D8EA 4PT5A 4WURA 2DJGB 3BCNA 1PPNA 3LXSA 4CDDB 3TRKA 2YJ8A 2DCAA 6PADA 1EWOA 5CHVA 2R9CA 3MORA 2HHNA 3RNVA 3CBKA 3PNRA 4PADA 4AXMA 2AUZA 1PE6A 2F7DA 4I05A 2R9FA 1AU3A 3O65A 3USVA 3CH3X 3OF8A 5F02A 1AECA 1CQDA 3BY4A 3IEJA 4OEMA 1NPZA 2DC7A 2G7YA 3E9SA 4I07A 4BOPA 1ITOA 2E00A 4XR7A 2BTWB 4FIPA 1TLOA 3PSEA 1PADA 1BP4A 1EWPA 1ME4A 2XU5A 4BOQA 2WBFX 4RY2A 1PXVA 4N79A 2NQGA 9PAPA 4QRVA 1MIRA 1QOLA 2G6DA 2FT2A 2JTCA 1XKGA 4OELA 2R9NA 1ICFA 3P5XA 3KSEA 4ZTBA 5CVOB 3S3QA 4DMYA 1F2CA 1JQPA 1YVBA 4CDFB 2B1NA 2VHSA 2AGAA 3B79A 3V6CA 4OW0A 3PRPA 2NQAA 3OVXA 2OZ2A 4W5CA 4CDEB 4RKXA 3KW9A 4BS5A 4BQVA 1CS8A 4MM3B 1BQIA 4X6IA 2R6NA 4QRGA 4D8BA 2Y5BA 5J94A 3KWZA 3BPMA 1IWDA 3ZNHA 4P16A 4BOUA 3OF9A 3QT4A 2E02A 1AU2A 8PCHA 2AVWA 5CHTA 4DMXA 1MHWA 3IFUA 2F1GA 1U9VA 3DF0A 1PIPA 2E03A 1PPDA 4G54A 2DOSA 2DCCA 3O0UA 4D8IA 2XU3A 1EWMA 1YALA 2HXZA 3P5WA 2G8EA 2UZJA 4MZSA 1TU6A 2JQGR 2DCBA 1ZIVA 4HWYA 1FH0A 3AI8A 3NHEA 2JQFR 4CZWA 1AU0A 2CIOA 1DKIA 3K9MA 4AXLA 2DC9A 1YK7A 3BWKA 3PRMA 4P6GA 3LFYA 3HHAA 2DC8A 4BS6A 1QXPA 2PNSA 4R3DA 4YV8A 4YYRA 1NL6A 2OULA 4P6EA 4KLBA 2FTDA 3QSDA 2AUXA 2J7QC 3C9EA 4M0WA 7PCKA 4REZA 4Q8GA 1KFUL 1CPJA 3O1GA 1KFXL 3BBAA 1THEA 3TMPA 2B1MA 2VHFA 1PCIA 1ZCMA 1MEGA 1CTEA 3F5VA 2AIMA 4RNAA 3IMAA 1PVJA 1GECE 2ATOA 3PBHA 1SNKA
chains in the Genus database with same CATH topology
1A6RA 4I04A 2PADA 3S3RA 1ME3A 1STFE 3H89A 5K16A 4PP2E 1X9YA 1SP4B 1W6FA 3K24A 2R9MA 2H7JA 5JA7A 2DC6A 1PBHA 1GCBA 3WXEA 1EWLA 4YYWA 3ERVA 3KKUA 3HWNA 2AYOA 2AYNA 2ARYA 3P5UA 4Q8HA 5PADA 1YT7A 1ATKA 2YJ2A 1AIMA 2GFOA 1VSNA 4FK5A 4K7CA 1PPPA 2C0YA 1BGOA 3MHHA 1Y4HA 1PPOA 1KHQA 3P5VA 4YYSA 2AU1A 1CJLA 1AU4A 3BOWA 3H8BA 4MZOA 1U9WA 1K3BB 3WXGA 1NQCA 1YK8A 1O0EA 1MS6A 3D9WA 2DJFB 2CB5A 1AYUA 1BY8A 3RVVA 3TNXA 3I06A 2YJBA 4WA6A 1M6DA 4QBBA 1GMYA 2NQDB 4QRXA 1U5IA 4YVAA 1VJVA 3U8EA 2ACTA 3KX1A 2IBIA 3HD3A 3H8CA 4N8WA 3PDFA 3BPFA 4W5BA 2DCDA 1NLJA 3GCBA 5CVNB 3OVZA 2AS8A 1POPA 2NQIA 1F2BA 1GLOA 1HUCB 2YJ9A 3WXFA 2P7UA 3IOQA 4GUZA 1NB3A 2E01A 1TL9A 2XU1A 1F2AA 2GHUA 2BDZA 1QMYA 4YYUA 2BDLA 3PW3A 1KHPA 2FRAA 4MSXA 3CH2X 4FJCA 3N4CA 3D6SA 2DZYA 3H7DA 3I3TA 2FUDA 4N4ZA 2PBHA 1Q6KA 2OP3A 1DEUA 2DZZA 3HHIA 4NV7A 3K8UA 4CDCB 1AYVA 2Y6EA 5A24A 5JH3A 2FO5A 3OISA 3E1ZB 4PI3A 4QH6A 2FYEA 2BSZA 4C5PA 1KXRA 1S4VA 2HH5A 4X6HA 3KFQA 1Y08A 5FPWA 3IUTA 4PP1A 1W4TA 5EGWA 1AYWA 2P0RA 1U9QX 3MHSA 5CVMA 3IHPA 1U9XA 3RVWA 3M99A 1CVZA 1NB5A 1QDQA 4YYQA 2G8JA 2HD5A 4ZUXU 5EF4A 3V6EA 4X6JA 1CSBB 1MDWA 1CV8A 1DF0A 1CB5A 3N3KA 2IPPB 4W4UA 3KWBX 3QJ3A 3RVXA 2O6XA 2XU4A 3BC3A 2FQ9A 3F75A 3IV2A 2P86A 3CBJA 4YYVA 1F29A 3MTNA 4NV8A 2VFCA 3ZUAA 4BPVA 2R9OA 1MEMA 2PREA 1EF7A 3H6SA 2YJCA 2FRQA 4BSQA 4XUIA 3N3GA 2DJGB 3BCNA 1PPNA 3LXSA 4CDDB 2YJ8A 2DCAA 6PADA 1EWOA 5CHVA 2R9CA 3MORA 2HHNA 3CBKA 3PNRA 4PADA 4AXMA 2AUZA 1PE6A 2F7DA 4I05A 2R9FA 1AU3A 3USVA 3CH3X 3OF8A 5F02A 1AECA 1CQDA 3IEJA 4OEMA 1NPZA 2DC7A 4BGFA 2G7YA 4I07A 1ITOA 2E00A 4XR7A 4FIPA 1TLOA 1PADA 1BP4A 1EWPA 1ME4A 2XU5A 2WBFX 4RY2A 1PXVA 4N79A 2NQGA 9PAPA 4QRVA 1MIRA 1QOLA 2G6DA 2FT2A 1XKGA 4OELA 2R9NA 1ICFA 3P5XA 3KSEA 3S3QA 5CVOB 4DMYA 1F2CA 1JQPA 1YVBA 4CDFB 2B1NA 2VHSA 3B79A 3V6CA 2NQAA 3OVXA 2OZ2A 4W5CA 4CDEB 4BS5A 3KW9A 4BQVA 1CS8A 1BQIA 4X6IA 2R6NA 4QRGA 2Y5BA 5J94A 3KWZA 3BPMA 1IWDA 3OF9A 3QT4A 2E02A 1AU2A 1W5RA 8PCHA 2AVWA 5CHTA 4DMXA 2VFBA 1MHWA 2F1GA 1U9VA 3DF0A 1PIPA 2E03A 1PPDA 4G54A 2DCCA 3O0UA 2XU3A 1EWMA 1YALA 2HXZA 3P5WA 2G8EA 4MZSA 1TU6A 2JQGR 2DCBA 1ZIVA 4HWYA 1FH0A 3AI8A 3NHEA 2JQFR 4CZWA 1AU0A 2CIOA 3K9MA 4AXLA 2DC9A 4B55A 1YK7A 3BWKA 4P6GA 3LFYA 3HHAA 2DC8A 4BS6A 1QXPA 2PNSA 4YV8A 4YYRA 1NL6A 2OULA 4P6EA 4KLBA 2FTDA 1E2TA 3QSDA 2AUXA 3C9EA 7PCKA 4Q8GA 1KFUL 1CPJA 3O1GA 1KFXL 1THEA 2B1MA 2VHFA 1GX3A 1PCIA 3LTWA 1ZCMA 1MEGA 1CTEA 3F5VA 2AIMA 3IMAA 1GECE 2ATOA 3PBHA 1SNKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A6R A;  4I04 A;  2PAD A;  3S3R A;  1ME3 A;  1STF E;  3H89 A;  5K16 A;  4PP2 E;  1X9Y A;  1SP4 B;  3K24 A;  2R9M A;  2H7J A;  5JA7 A;  2DC6 A;  1PBH A;  1GCB A;  3WXE A;  1EWL A;  4YYW A;  3ERV A;  3KKU A;  3HWN A;  2AYO A;  2AYN A;  2ARY A;  3P5U A;  4Q8H A;  5PAD A;  1YT7 A;  1ATK A;  2YJ2 A;  1AIM A;  2GFO A;  1VSN A;  4FK5 A;  4K7C A;  1PPP A;  2C0Y A;  1BGO A;  3MHH A;  1Y4H A;  1PPO A;  1KHQ A;  3P5V A;  4YYS A;  2AU1 A;  1CJL A;  1AU4 A;  3BOW A;  3H8B A;  4MZO A;  1U9W A;  1K3B B;  3WXG A;  1NQC A;  1YK8 A;  1O0E A;  1MS6 A;  2DJF B;  2CB5 A;  1AYU A;  1BY8 A;  3RVV A;  3TNX A;  3I06 A;  2YJB A;  4WA6 A;  1M6D A;  4QBB A;  1GMY A;  2NQD B;  4QRX A;  1U5I A;  4YVA A;  1VJV A;  3U8E A;  2ACT A;  3KX1 A;  2IBI A;  3HD3 A;  3H8C A;  4N8W A;  3PDF A;  3BPF A;  4W5B A;  2DCD A;  1NLJ A;  3GCB A;  5CVN B;  3OVZ A;  2AS8 A;  1POP A;  2NQI A;  1F2B A;  1GLO A;  1HUC B;  2YJ9 A;  3WXF A;  2P7U A;  3IOQ A;  1NB3 A;  2E01 A;  1TL9 A;  2XU1 A;  1F2A A;  2GHU A;  2BDZ A;  1QMY A;  4YYU A;  2BDL A;  3PW3 A;  1KHP A;  2FRA A;  4MSX A;  3CH2 X;  4FJC A;  3N4C A;  3D6S A;  2DZY A;  3H7D A;  3I3T A;  2FUD A;  4N4Z A;  2PBH A;  1Q6K A;  2OP3 A;  1DEU A;  2DZZ A;  3HHI A;  3K8U A;  4CDC B;  1AYV A;  2Y6E A;  5A24 A;  5JH3 A;  2FO5 A;  3OIS A;  3E1Z B;  4PI3 A;  4QH6 A;  2FYE A;  1KXR A;  1S4V A;  2HH5 A;  4X6H A;  3KFQ A;  1Y08 A;  5FPW A;  3IUT A;  4PP1 A;  5EGW A;  1AYW A;  2P0R A;  1U9Q X;  3MHS A;  5CVM A;  3IHP A;  1U9X A;  3RVW A;  3M99 A;  1CVZ A;  1NB5 A;  1QDQ A;  4YYQ A;  2G8J A;  2HD5 A;  4ZUX U;  5EF4 A;  3V6E A;  4X6J A;  1CSB B;  1MDW A;  1CV8 A;  1DF0 A;  1CB5 A;  3N3K A;  2IPP B;  4W4U A;  3KWB X;  3QJ3 A;  3RVX A;  2O6X A;  2XU4 A;  3BC3 A;  2FQ9 A;  3F75 A;  3IV2 A;  2P86 A;  3CBJ A;  4YYV A;  1F29 A;  3MTN A;  3ZUA A;  4BPV A;  2R9O A;  1MEM A;  2PRE A;  1EF7 A;  3H6S A;  2YJC A;  2FRQ A;  4BSQ A;  4XUI A;  3N3G A;  2DJG B;  3BCN A;  1PPN A;  3LXS A;  4CDD B;  2YJ8 A;  2DCA A;  6PAD A;  1EWO A;  5CHV A;  2R9C A;  3MOR A;  2HHN A;  3CBK A;  3PNR A;  4PAD A;  4AXM A;  2AUZ A;  1PE6 A;  2F7D A;  4I05 A;  2R9F A;  1AU3 A;  3USV A;  3CH3 X;  3OF8 A;  5F02 A;  1AEC A;  1CQD A;  3IEJ A;  4OEM A;  1NPZ A;  2DC7 A;  2G7Y A;  4I07 A;  1ITO A;  2E00 A;  4XR7 A;  4FIP A;  1TLO A;  1PAD A;  1BP4 A;  1EWP A;  1ME4 A;  2XU5 A;  2WBF X;  4RY2 A;  1PXV A;  4N79 A;  2NQG A;  9PAP A;  4QRV A;  1MIR A;  1QOL A;  2G6D A;  2FT2 A;  1XKG A;  4OEL A;  2R9N A;  1ICF A;  3P5X A;  3KSE A;  3S3Q A;  5CVO B;  4DMY A;  1F2C A;  1JQP A;  1YVB A;  4CDF B;  2B1N A;  2VHS A;  3B79 A;  3V6C A;  2NQA A;  3OVX A;  2OZ2 A;  4W5C A;  4CDE B;  4BS5 A;  3KW9 A;  4BQV A;  1CS8 A;  1BQI A;  4X6I A;  2R6N A;  4QRG A;  2Y5B A;  5J94 A;  3KWZ A;  3BPM A;  1IWD A;  3OF9 A;  3QT4 A;  2E02 A;  1AU2 A;  8PCH A;  2AVW A;  5CHT A;  4DMX A;  1MHW A;  2F1G A;  1U9V A;  3DF0 A;  1PIP A;  2E03 A;  1PPD A;  4G54 A;  2DCC A;  3O0U A;  2XU3 A;  1EWM A;  1YAL A;  2HXZ A;  3P5W A;  2G8E A;  4MZS A;  1TU6 A;  2JQG R;  2DCB A;  1ZIV A;  4HWY A;  1FH0 A;  3AI8 A;  3NHE A;  2JQF R;  4CZW A;  1AU0 A;  2CIO A;  3K9M A;  4AXL A;  2DC9 A;  1YK7 A;  3BWK A;  4P6G A;  3LFY A;  3HHA A;  2DC8 A;  4BS6 A;  1QXP A;  2PNS A;  4YV8 A;  4YYR A;  1NL6 A;  2OUL A;  4P6E A;  4KLB A;  2FTD A;  3QSD A;  2AUX A;  3C9E A;  7PCK A;  4Q8G A;  1KFU L;  1CPJ A;  3O1G A;  1KFX L;  1THE A;  2B1M A;  2VHF A;  1PCI A;  1ZCM A;  1MEG A;  1CTE A;  3F5V A;  2AIM A;  3IMA A;  1GEC E;  2ATO A;  3PBH A;  1SNK A; 
#chains in the Genus database with same CATH topology
 1A6R A;  4I04 A;  2PAD A;  3S3R A;  1ME3 A;  1STF E;  3H89 A;  5K16 A;  4PP2 E;  1X9Y A;  1SP4 B;  4RF0 A;  1YZB A;  2R9M A;  3K24 A;  2H7J A;  5JA7 A;  2DC6 A;  1PBH A;  1GCB A;  3WXE A;  4BOZ A;  1EWL A;  4YYW A;  3ERV A;  3KKU A;  3HWN A;  2AYO A;  2AYN A;  2ARY A;  3P5U A;  4Q8H A;  5PAD A;  1YT7 A;  1ATK A;  2FE8 A;  2YJ2 A;  1AIM A;  2GFO A;  1VSN A;  4FK5 A;  4K7C A;  1PPP A;  2C0Y A;  1BGO A;  3MHH A;  1Y4H A;  1PPO A;  4OVZ A;  1KHQ A;  3P5V A;  4YYS A;  2AU1 A;  1CJL A;  3W30 A;  1AU4 A;  3BOW A;  3H8B A;  4MZO A;  1U9W A;  4BOS A;  1K3B B;  5KO3 A;  3WXG A;  4GUA A;  1NQC A;  1YK8 A;  1O0E A;  5EZQ A;  3PHX A;  1MS6 A;  4MI7 A;  3W31 A;  3PHU A;  5E6J A;  2DJF B;  2CB5 A;  1AYU A;  1BY8 A;  3MJ5 A;  3RVV A;  3TNX A;  3B21 A;  3I06 A;  2YJB A;  4WA6 A;  1M6D A;  4QBB A;  3C0R A;  1GMY A;  2NQD B;  4QRX A;  1U5I A;  4YVA A;  1VJV A;  3U8E A;  2ACT A;  3KX1 A;  4OVZ B;  2IBI A;  3HD3 A;  3H8C A;  4N8W A;  3PDF A;  3BPF A;  4W5B A;  2DCD A;  1NLJ A;  5JZE A;  3GCB A;  5CVN B;  3OVZ A;  4IP3 A;  2AS8 A;  1POP A;  2NQI A;  1F2B A;  1GLO A;  1HUC B;  2YJ9 A;  3WXF A;  2P7U A;  3IOQ A;  2HWK A;  1NB3 A;  2E01 A;  1TL9 A;  2XU1 A;  1F2A A;  2GHU A;  2BDZ A;  3BB7 A;  1QMY A;  4YYU A;  2BDL A;  3PW3 A;  1KHP A;  2FRA A;  4MSX A;  3CH2 X;  3N4C A;  4FJC A;  3D6S A;  4A5U A;  2DZY A;  3H7D A;  3I3T A;  2FUD A;  4N4Z A;  2PBH A;  1Q6K A;  2OP3 A;  1DEU A;  2DZZ A;  3HHI A;  3K8U A;  4CDC B;  1AYV A;  2Y6E A;  5A24 A;  5JH3 A;  2FO5 A;  3OIS A;  3E1Z B;  4PI3 A;  4QH6 A;  2FYE A;  1KXR A;  1S4V A;  2HH5 A;  4X6H A;  4XZX A;  3KFQ A;  1Y08 A;  5FPW A;  3IUT A;  4PP1 A;  5EGW A;  1AYW A;  3MTV A;  2J7Q A;  1U9Q X;  2P0R A;  3MHS A;  5CVM A;  3IHP A;  1U9X A;  3RVW A;  3M99 A;  1CVZ A;  1NB5 A;  1QDQ A;  4YYQ A;  2G8J A;  2HD5 A;  4ZUX U;  5EF4 A;  3V6E A;  4X6J A;  1CSB B;  3PT2 A;  1MDW A;  5EZS A;  1CV8 A;  4RF1 A;  1DF0 A;  2Z84 A;  1CB5 A;  3N3K A;  2IPP B;  4W4U A;  3KWB X;  2JRI A;  4HXD B;  3OQC A;  2BTW A;  3QJ3 A;  3MP2 A;  3RVX A;  1UKF A;  2O6X A;  2XU4 A;  3BC3 A;  2FQ9 A;  3F75 A;  3IV2 A;  2P86 A;  3CBJ A;  4YYV A;  1F29 A;  3MTN A;  3ZUA A;  4BPV A;  2R9O A;  1MEM A;  2BU3 A;  2PRE A;  1EF7 A;  3H6S A;  2YJC A;  4IUM A;  2FRQ A;  4BSQ A;  4XUI A;  3N3G A;  3PHW A;  4D8E A;  4PT5 A;  4WUR A;  2DJG B;  3BCN A;  1PPN A;  3LXS A;  4CDD B;  3TRK A;  2YJ8 A;  2DCA A;  6PAD A;  1EWO A;  5CHV A;  2R9C A;  3MOR A;  2HHN A;  3RNV A;  3CBK A;  3PNR A;  4PAD A;  4AXM A;  2AUZ A;  1PE6 A;  2F7D A;  4I05 A;  2R9F A;  1AU3 A;  3O65 A;  3USV A;  3CH3 X;  3OF8 A;  5F02 A;  1AEC A;  1CQD A;  3BY4 A;  3IEJ A;  4OEM A;  1NPZ A;  2DC7 A;  2G7Y A;  3E9S A;  4I07 A;  4BOP A;  1ITO A;  2E00 A;  4XR7 A;  2BTW B;  4FIP A;  1TLO A;  3PSE A;  1PAD A;  1BP4 A;  1EWP A;  1ME4 A;  2XU5 A;  4BOQ A;  2WBF X;  4RY2 A;  1PXV A;  4N79 A;  2NQG A;  9PAP A;  4QRV A;  1MIR A;  1QOL A;  2G6D A;  2FT2 A;  2JTC A;  1XKG A;  4OEL A;  2R9N A;  1ICF A;  3P5X A;  3KSE A;  4ZTB A;  5CVO B;  3S3Q A;  4DMY A;  1F2C A;  1JQP A;  1YVB A;  4CDF B;  2B1N A;  2VHS A;  2AGA A;  3B79 A;  3V6C A;  4OW0 A;  3PRP A;  2NQA A;  3OVX A;  2OZ2 A;  4W5C A;  4CDE B;  4RKX A;  3KW9 A;  4BS5 A;  4BQV A;  1CS8 A;  4MM3 B;  1BQI A;  4X6I A;  2R6N A;  4QRG A;  4D8B A;  2Y5B A;  5J94 A;  3KWZ A;  3BPM A;  1IWD A;  3ZNH A;  4P16 A;  4BOU A;  3OF9 A;  3QT4 A;  2E02 A;  1AU2 A;  8PCH A;  2AVW A;  5CHT A;  4DMX A;  1MHW A;  3IFU A;  2F1G A;  1U9V A;  3DF0 A;  1PIP A;  2E03 A;  1PPD A;  4G54 A;  2DOS A;  2DCC A;  3O0U A;  4D8I A;  2XU3 A;  1EWM A;  1YAL A;  2HXZ A;  3P5W A;  2G8E A;  2UZJ A;  4MZS A;  1TU6 A;  2JQG R;  2DCB A;  1ZIV A;  4HWY A;  1FH0 A;  3AI8 A;  3NHE A;  2JQF R;  4CZW A;  1AU0 A;  2CIO A;  1DKI A;  3K9M A;  4AXL A;  2DC9 A;  1YK7 A;  3BWK A;  3PRM A;  4P6G A;  3LFY A;  3HHA A;  2DC8 A;  4BS6 A;  1QXP A;  2PNS A;  4R3D A;  4YV8 A;  4YYR A;  1NL6 A;  2OUL A;  4P6E A;  4KLB A;  2FTD A;  3QSD A;  2AUX A;  2J7Q C;  3C9E A;  4M0W A;  7PCK A;  4REZ A;  4Q8G A;  1KFU L;  1CPJ A;  3O1G A;  1KFX L;  3BBA A;  1THE A;  3TMP A;  2B1M A;  2VHF A;  1PCI A;  1ZCM A;  1MEG A;  1CTE A;  3F5V A;  2AIM A;  4RNA A;  3IMA A;  1PVJ A;  1GEC E;  2ATO A;  3PBH A;  1SNK A; 
#chains in the Genus database with same CATH homology
 1A6R A;  4I04 A;  2PAD A;  3S3R A;  1ME3 A;  1STF E;  3H89 A;  5K16 A;  4PP2 E;  1X9Y A;  1SP4 B;  1W6F A;  3K24 A;  2R9M A;  2H7J A;  5JA7 A;  2DC6 A;  1PBH A;  1GCB A;  3WXE A;  1EWL A;  4YYW A;  3ERV A;  3KKU A;  3HWN A;  2AYO A;  2AYN A;  2ARY A;  3P5U A;  4Q8H A;  5PAD A;  1YT7 A;  1ATK A;  2YJ2 A;  1AIM A;  2GFO A;  1VSN A;  4FK5 A;  4K7C A;  1PPP A;  2C0Y A;  1BGO A;  3MHH A;  1Y4H A;  1PPO A;  1KHQ A;  3P5V A;  4YYS A;  2AU1 A;  1CJL A;  1AU4 A;  3BOW A;  3H8B A;  4MZO A;  1U9W A;  1K3B B;  3WXG A;  1NQC A;  1YK8 A;  1O0E A;  1MS6 A;  3D9W A;  2DJF B;  2CB5 A;  1AYU A;  1BY8 A;  3RVV A;  3TNX A;  3I06 A;  2YJB A;  4WA6 A;  1M6D A;  4QBB A;  1GMY A;  2NQD B;  4QRX A;  1U5I A;  4YVA A;  1VJV A;  3U8E A;  2ACT A;  3KX1 A;  2IBI A;  3HD3 A;  3H8C A;  4N8W A;  3PDF A;  3BPF A;  4W5B A;  2DCD A;  1NLJ A;  3GCB A;  5CVN B;  3OVZ A;  2AS8 A;  1POP A;  2NQI A;  1F2B A;  1GLO A;  1HUC B;  2YJ9 A;  3WXF A;  2P7U A;  3IOQ A;  4GUZ A;  1NB3 A;  2E01 A;  1TL9 A;  2XU1 A;  1F2A A;  2GHU A;  2BDZ A;  1QMY A;  4YYU A;  2BDL A;  3PW3 A;  1KHP A;  2FRA A;  4MSX A;  3CH2 X;  4FJC A;  3N4C A;  3D6S A;  2DZY A;  3H7D A;  3I3T A;  2FUD A;  4N4Z A;  2PBH A;  1Q6K A;  2OP3 A;  1DEU A;  2DZZ A;  3HHI A;  4NV7 A;  3K8U A;  4CDC B;  1AYV A;  2Y6E A;  5A24 A;  5JH3 A;  2FO5 A;  3OIS A;  3E1Z B;  4PI3 A;  4QH6 A;  2FYE A;  2BSZ A;  4C5P A;  1KXR A;  1S4V A;  2HH5 A;  4X6H A;  3KFQ A;  1Y08 A;  5FPW A;  3IUT A;  4PP1 A;  1W4T A;  5EGW A;  1AYW A;  2P0R A;  1U9Q X;  3MHS A;  5CVM A;  3IHP A;  1U9X A;  3RVW A;  3M99 A;  1CVZ A;  1NB5 A;  1QDQ A;  4YYQ A;  2G8J A;  2HD5 A;  4ZUX U;  5EF4 A;  3V6E A;  4X6J A;  1CSB B;  1MDW A;  1CV8 A;  1DF0 A;  1CB5 A;  3N3K A;  2IPP B;  4W4U A;  3KWB X;  3QJ3 A;  3RVX A;  2O6X A;  2XU4 A;  3BC3 A;  2FQ9 A;  3F75 A;  3IV2 A;  2P86 A;  3CBJ A;  4YYV A;  1F29 A;  3MTN A;  4NV8 A;  2VFC A;  3ZUA A;  4BPV A;  2R9O A;  1MEM A;  2PRE A;  1EF7 A;  3H6S A;  2YJC A;  2FRQ A;  4BSQ A;  4XUI A;  3N3G A;  2DJG B;  3BCN A;  1PPN A;  3LXS A;  4CDD B;  2YJ8 A;  2DCA A;  6PAD A;  1EWO A;  5CHV A;  2R9C A;  3MOR A;  2HHN A;  3CBK A;  3PNR A;  4PAD A;  4AXM A;  2AUZ A;  1PE6 A;  2F7D A;  4I05 A;  2R9F A;  1AU3 A;  3USV A;  3CH3 X;  3OF8 A;  5F02 A;  1AEC A;  1CQD A;  3IEJ A;  4OEM A;  1NPZ A;  2DC7 A;  4BGF A;  2G7Y A;  4I07 A;  1ITO A;  2E00 A;  4XR7 A;  4FIP A;  1TLO A;  1PAD A;  1BP4 A;  1EWP A;  1ME4 A;  2XU5 A;  2WBF X;  4RY2 A;  1PXV A;  4N79 A;  2NQG A;  9PAP A;  4QRV A;  1MIR A;  1QOL A;  2G6D A;  2FT2 A;  1XKG A;  4OEL A;  2R9N A;  1ICF A;  3P5X A;  3KSE A;  3S3Q A;  5CVO B;  4DMY A;  1F2C A;  1JQP A;  1YVB A;  4CDF B;  2B1N A;  2VHS A;  3B79 A;  3V6C A;  2NQA A;  3OVX A;  2OZ2 A;  4W5C A;  4CDE B;  4BS5 A;  3KW9 A;  4BQV A;  1CS8 A;  1BQI A;  4X6I A;  2R6N A;  4QRG A;  2Y5B A;  5J94 A;  3KWZ A;  3BPM A;  1IWD A;  3OF9 A;  3QT4 A;  2E02 A;  1AU2 A;  1W5R A;  8PCH A;  2AVW A;  5CHT A;  4DMX A;  2VFB A;  1MHW A;  2F1G A;  1U9V A;  3DF0 A;  1PIP A;  2E03 A;  1PPD A;  4G54 A;  2DCC A;  3O0U A;  2XU3 A;  1EWM A;  1YAL A;  2HXZ A;  3P5W A;  2G8E A;  4MZS A;  1TU6 A;  2JQG R;  2DCB A;  1ZIV A;  4HWY A;  1FH0 A;  3AI8 A;  3NHE A;  2JQF R;  4CZW A;  1AU0 A;  2CIO A;  3K9M A;  4AXL A;  2DC9 A;  4B55 A;  1YK7 A;  3BWK A;  4P6G A;  3LFY A;  3HHA A;  2DC8 A;  4BS6 A;  1QXP A;  2PNS A;  4YV8 A;  4YYR A;  1NL6 A;  2OUL A;  4P6E A;  4KLB A;  2FTD A;  1E2T A;  3QSD A;  2AUX A;  3C9E A;  7PCK A;  4Q8G A;  1KFU L;  1CPJ A;  3O1G A;  1KFX L;  1THE A;  2B1M A;  2VHF A;  1GX3 A;  1PCI A;  3LTW A;  1ZCM A;  1MEG A;  1CTE A;  3F5V A;  2AIM A;  3IMA A;  1GEC E;  2ATO A;  3PBH A;  1SNK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...