1EF7A

Crystal structure of human cathepsin x
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
242
structure length
242
Chain Sequence
LPKSWDWRNVDGVNYASITRNQHIPQYCGSCWAHASTSAMADRINIKRKGAWPSTLLSVQNVIDCGNAGSCEGGNDLSVWDYAHQHGIPDETCNNYQAKDQECDKFNQCGTCNEFKECHAIRNYTLWRVGDYGSLSGREKMMAEIYANGPISCGIMATERLANYTGGIYAEYQDTTYINHVVSVAGWGISDGTEYWIVRNSWGEPWGERGWLRIVTSTYKDGKGARYNLAIEEHCTFGDPIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of cathepsin X: a flip-flop of the ring of His23 allows carboxy-monopeptidase and carboxy-dipeptidase activity of the protease.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords CATHEPSIN X
total genus 75
structure length 242
sequence length 242
chains with identical sequence B
ec nomenclature ec 3.4.18.1: Cathepsin X.
pdb deposition date 2000-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1ef7A00
5JA7A 3KSEA 2P86A 4YYSA 2JQGR 1AIMA 4K7CA 2XU4A 3ERVA 1KHQA 1AYUA 2HD5A 2XU5A 1GLOA 3LFYA 4AXLA 3GCBA 2PREA 4BS5A 2AYNA 1VSNA 1YVBA 4MZSA 1YT7A 1QDQA 4HWYA 1BGOA 9PAPA 4DMXA 3M99A 1AECA 3BWKA 3WXFA 1SNKA 4QRVA 2G7YA 1CJLA 1U5IA 2G8JA 2AIMA 4OEMA 2F7DA 1S4VA 1ME4A 2C0YA 3PBHA 4XR7A 4YYVA 4PADA 1PE6A 8PCHA 5J94A 3OISA 4BPVA 1TL9A 3OVXA 1PCIA 2YJ2A 3OVZA 4KLBA 4YV8A 1PPOA 1NB3A 4XUIA 5A24A 1EWOA 2DC7A 2OULA 4YYRA 2G6DA 1VJVA 1BP4A 1XKGA 2R6NA 4I04A 5JH3A 5CVOB 2E01A 3IOQA 4YYUA 4QRGA 3IV2A 3USVA 3IMAA 4Q8GA 3S3RA 2AUXA 1U9XA 3KWBX 3P5UA 3V6EA 3CH2X 4BS6A 6PADA 1MHWA 1DEUA 1Y4HA 3P5XA 2F1GA 2Y5BA 2DCCA 2R9CA 3NHEA 3KFQA 3CH3X 2ATOA 3BPFA 1IWDA 3V6CA 1YK7A 1MIRA 5PADA 2PNSA 3C9EA 2OP3A 3BC3A 3BOWA 3CBJA 4CDDB 2R9NA 3U8EA 2DJGB 4FIPA 1ME3A 3IHPA 3ZUAA 3F75A 1TLOA 1PPPA 1PBHA 2NQIA 4MZOA 1MEGA 3PW3A 3F5VA 1PPDA 3IEJA 4FK5A 3HWNA 3H8CA 4W5BA 3RVXA 2DCBA 2E02A 2R9FA 2DCDA 3BPMA 4I07A 3OF9A 4CZWA 2E03A 1CB5A 1YK8A 3WXEA 4N79A 2DZZA 3O0UA 4N8WA 1GMYA 2VHFA 2HXZA 2DJFB 1NLJA 3KX1A 4W4UA 1Q6KA 5FPWA 3AI8A 4BSQA 5CHVA 4P6EA 2IPPB 3B79A 3QSDA 1CVZA 5CHTA 3MTNA 1HUCB 4DMYA 1PPNA 2DZYA 4BQVA 1F2CA 1O0EA 5CVNB 4WA6A 1U9VA 2VHSA 3K9MA 3DF0A 3N4CA 4AXMA 1STFE 3O1GA 4Q8HA 1TU6A 2BDZA 2JQFR 3WXGA 4PI3A 3N3GA 4ZUXU 2OZ2A 2PBHA 3CBKA 1CPJA 2CIOA 1U9WA 1CS8A 1NL6A 1U9QX 1GCBA 1ATKA 1KHPA 3PNRA 4P6GA 3TNXA 3IUTA 2G8EA 2NQGA 5EGWA 2B1MA 5K16A 2FO5A 3HHAA 4G54A 3P5WA 3H8BA 3OF8A 5CVMA 2H7JA 1ITOA 4CDFB 3D6SA 2Y6EA 3KWZA 4YVAA 1KFXL 1PADA 3I06A 2FUDA 1NPZA 4FJCA 4X6IA 1EWMA 1AU2A 2FT2A 1ZCMA 4QRXA 1BY8A 3H7DA 1QMYA 3N3KA 3MHHA 1F2AA 1POPA 3PDFA 5F02A 2P7UA 1AYVA 3BCNA 4CDEB 3LXSA 2XU1A 1PIPA 5EF4A 2DC9A 1EF7A 2FYEA 2YJ9A 4QH6A 3QT4A 2DC6A 3E1ZB 4PP1A 1Y08A 2P0RA 7PCKA 2R9OA 1NB5A 2ARYA 3HD3A 4YYWA 2O6XA 2GFOA 3K24A 1AU4A 1CQDA 1MDWA 3MHSA 1QXPA 1K3BB 1NQCA 1MS6A 2NQDB 1MEMA 4X6HA 4I05A 3P5VA 1SP4B 4PP2E 1F2BA 3KW9A 1AU3A 1AYWA 2NQAA 1CSBB 4MSXA 1CV8A 3H6SA 2AYOA 2AU1A 1THEA 2FTDA 2AS8A 2FQ9A 3QJ3A 3H89A 2IBIA 1ICFA 3K8UA 1KFUL 3HHIA 1CTEA 1F29A 2E00A 2AUZA 1A6RA 1ZIVA 4RY2A 1AU0A 2GHUA 4CDCB 2XU3A 2HHNA 2AVWA 3I3TA 3RVWA 1QOLA 1BQIA 1JQPA 2HH5A 2B1NA 1PXVA 1EWLA 1FH0A 2BDLA 3RVVA 2YJCA 4W5CA 3MORA 2PADA 3S3QA 4OELA 4X6JA 2FRAA 1M6DA 2CB5A 2DCAA 1EWPA 4QBBA 1DF0A 1X9YA 3KKUA 4YYQA 1YALA 2YJBA 2R9MA 1KXRA 1GECE 2WBFX 4N4ZA 2ACTA 2FRQA 2DC8A 2YJ8A
chains in the Genus database with same CATH superfamily
4D8BA 5JA7A 4MI7A 3KSEA 2P86A 4YYSA 3W30A 2JQGR 1AIMA 3IFUA 4K7CA 2XU4A 3PSEA 3ERVA 1KHQA 1AYUA 2BU3A 2HD5A 2XU5A 1GLOA 4XZXA 3LFYA 2J7QA 4AXLA 3GCBA 2PREA 4BS5A 2AYNA 2DOSA 1VSNA 1YVBA 4MZSA 2UZJA 1YT7A 1QDQA 5E6JA 4HWYA 1BGOA 9PAPA 4DMXA 3M99A 1AECA 3BWKA 3OQCA 3WXFA 1SNKA 4QRVA 2G7YA 1CJLA 1U5IA 2G8JA 2AIMA 4OEMA 2F7DA 1S4VA 1ME4A 2C0YA 3PBHA 4XR7A 4YYVA 4PADA 1PE6A 3BB7A 8PCHA 4BOPA 5J94A 3OISA 4BPVA 1TL9A 3OVXA 1PCIA 2YJ2A 3OVZA 4KLBA 4YV8A 1PPOA 1NB3A 1UKFA 4XUIA 5A24A 1EWOA 2DC7A 2OULA 1YZBA 4YYRA 2G6DA 1VJVA 3RNVA 1BP4A 1XKGA 4WURA 2R6NA 4I04A 5JH3A 5CVOB 2E01A 3IOQA 4YYUA 4QRGA 3IV2A 3USVA 3IMAA 4Q8GA 3S3RA 2AUXA 4D8IA 1U9XA 3KWBX 3P5UA 4OW0A 3V6EA 3CH2X 4BS6A 6PADA 3MTVA 1MHWA 1DEUA 1Y4HA 4RKXA 3P5XA 2F1GA 2Y5BA 2DCCA 2R9CA 3NHEA 4BOQA 3E9SA 3KFQA 3CH3X 2ATOA 4RNAA 3BPFA 1IWDA 3V6CA 1YK7A 1MIRA 5PADA 2PNSA 4REZA 3C9EA 2OP3A 3BC3A 3TMPA 3BOWA 3BBAA 3CBJA 4CDDB 2R9NA 3U8EA 2DJGB 4FIPA 1ME3A 3IHPA 3ZUAA 3F75A 1TLOA 1PPPA 1PBHA 2NQIA 4MZOA 1MEGA 2HWKA 4GUAA 3PW3A 3F5VA 1PPDA 3IEJA 4FK5A 3HWNA 3H8CA 4W5BA 3RVXA 2DCBA 2E02A 2R9FA 2DCDA 3BPMA 4I07A 3OF9A 4CZWA 4RF1A 2E03A 1CB5A 1YK8A 3WXEA 4N79A 2DZZA 3O0UA 4N8WA 1GMYA 2VHFA 2HXZA 2DJFB 4PT5A 1NLJA 3KX1A 4W4UA 1Q6KA 5FPWA 3AI8A 4BSQA 4ZTBA 5CHVA 2IPPB 3B79A 4P6EA 3QSDA 1PVJA 1CVZA 5CHTA 4D8EA 3MTNA 1HUCB 4DMYA 1PPNA 2DZYA 4BQVA 1F2CA 4HXDB 1O0EA 5CVNB 4WA6A 1U9VA 2Z84A 2VHSA 3K9MA 3DF0A 3BY4A 3N4CA 4AXMA 1STFE 3O1GA 4Q8HA 1TU6A 2BDZA 2JQFR 4BOSA 3WXGA 2FE8A 4PI3A 3N3GA 4M0WA 4ZUXU 2OZ2A 2PBHA 3CBKA 1CPJA 4A5UA 2CIOA 1U9WA 1CS8A 3MJ5A 3ZNHA 1NL6A 1U9QX 3PRPA 4BOUA 1GCBA 1ATKA 1KHPA 3PHUA 3W31A 3PNRA 4P6GA 3TNXA 3IUTA 2G8EA 2NQGA 5EGWA 2B1MA 5K16A 2FO5A 3HHAA 4G54A 4R3DA 3O65A 3P5WA 3H8BA 3OF8A 5CVMA 2H7JA 1ITOA 4CDFB 3D6SA 2Y6EA 3KWZA 4YVAA 1KFXL 1PADA 3I06A 2FUDA 1NPZA 5JZEA 2JRIA 4FJCA 1EWMA 4X6IA 4RF0A 1AU2A 2FT2A 1ZCMA 4QRXA 1BY8A 3H7DA 3PHXA 1QMYA 3N3KA 3MHHA 1F2AA 3PRMA 1POPA 3PDFA 4P16A 4MM3B 2BTWB 5F02A 2P7UA 1AYVA 3BCNA 4CDEB 3LXSA 2XU1A 1PIPA 5EF4A 2DC9A 1EF7A 2FYEA 2YJ9A 4QH6A 3QT4A 2DC6A 4OVZA 3E1ZB 4PP1A 1Y08A 2P0RA 7PCKA 2R9OA 1NB5A 2ARYA 3HD3A 4YYWA 2O6XA 2GFOA 3K24A 1AU4A 1CQDA 3MHSA 1MDWA 1QXPA 1K3BB 1NQCA 1MS6A 2NQDB 1MEMA 4X6HA 3C0RA 4I05A 3P5VA 1SP4B 4PP2E 1F2BA 3KW9A 1AU3A 1AYWA 2NQAA 1CSBB 4MSXA 4IP3A 1CV8A 3H6SA 2AYOA 2AU1A 1THEA 2FTDA 2AS8A 2FQ9A 3QJ3A 5EZSA 3PHWA 3H89A 2IBIA 1ICFA 3K8UA 1KFUL 3HHIA 1CTEA 1F29A 2E00A 3B21A 3MP2A 2AUZA 1DKIA 1A6RA 1ZIVA 4RY2A 2J7QC 1AU0A 2GHUA 4CDCB 5EZQA 2XU3A 5KO3A 2HHNA 2AVWA 3I3TA 3RVWA 1QOLA 1BQIA 1JQPA 2HH5A 2B1NA 1PXVA 1EWLA 1FH0A 2BDLA 3RVVA 2YJCA 4W5CA 4IUMA 3MORA 4OVZB 3TRKA 2PADA 3S3QA 4OELA 4X6JA 2FRAA 1M6DA 2CB5A 2DCAA 1EWPA 4QBBA 1DF0A 1X9YA 2BTWA 3KKUA 4YYQA 1YALA 2YJBA 2R9MA 2AGAA 1KXRA 3PT2A 1GECE 4BOZA 2WBFX 4N4ZA 2ACTA 2FRQA 2JTCA 2DC8A 2YJ8A
chains in the Genus database with same CATH topology
5JA7A 3KSEA 2P86A 4YYSA 2JQGR 1AIMA 4K7CA 2XU4A 3ERVA 2BSZA 1KHQA 1AYUA 2HD5A 2XU5A 1GLOA 3LFYA 4AXLA 3GCBA 2PREA 4BS5A 2AYNA 1VSNA 1YVBA 4MZSA 1W6FA 1YT7A 1QDQA 4HWYA 1BGOA 9PAPA 4DMXA 3M99A 1AECA 3BWKA 3WXFA 1SNKA 4QRVA 2G7YA 1CJLA 1U5IA 2G8JA 2AIMA 4OEMA 4C5PA 2F7DA 1S4VA 1ME4A 2C0YA 3PBHA 4XR7A 4YYVA 4PADA 1PE6A 8PCHA 5J94A 3OISA 4BPVA 1TL9A 3OVXA 1PCIA 2YJ2A 3OVZA 4KLBA 4YV8A 1PPOA 1NB3A 1W4TA 4XUIA 5A24A 1EWOA 2DC7A 2OULA 4YYRA 2G6DA 1VJVA 1BP4A 1XKGA 2R6NA 4I04A 5JH3A 5CVOB 2E01A 3IOQA 4YYUA 4QRGA 3IV2A 3USVA 3IMAA 4Q8GA 3D9WA 3S3RA 2AUXA 1U9XA 2VFBA 3KWBX 3P5UA 3V6EA 3CH2X 4BS6A 6PADA 1MHWA 1DEUA 1Y4HA 3P5XA 2F1GA 2Y5BA 2DCCA 2R9CA 3NHEA 3KFQA 3CH3X 2ATOA 3BPFA 1IWDA 3V6CA 1YK7A 1MIRA 5PADA 2PNSA 3C9EA 2OP3A 3BC3A 3BOWA 3CBJA 4CDDB 2R9NA 3U8EA 2DJGB 4FIPA 1ME3A 3IHPA 3ZUAA 3F75A 1TLOA 1PPPA 1PBHA 2NQIA 4MZOA 1MEGA 3PW3A 3F5VA 1PPDA 3IEJA 4FK5A 3HWNA 3H8CA 4W5BA 3RVXA 2DCBA 1GX3A 2E02A 2R9FA 2DCDA 3BPMA 4I07A 3OF9A 4CZWA 2E03A 1CB5A 1YK8A 3WXEA 4N79A 2DZZA 3O0UA 4N8WA 1GMYA 2VHFA 2HXZA 2DJFB 1NLJA 3KX1A 4W4UA 1Q6KA 5FPWA 3AI8A 4BSQA 5CHVA 4P6EA 2IPPB 3B79A 3QSDA 1CVZA 5CHTA 3MTNA 1HUCB 4DMYA 1PPNA 2DZYA 4BQVA 1F2CA 1O0EA 5CVNB 4WA6A 1U9VA 2VHSA 3K9MA 3DF0A 3N4CA 4AXMA 1STFE 3O1GA 4Q8HA 1TU6A 2BDZA 2JQFR 3WXGA 4PI3A 3N3GA 4ZUXU 2OZ2A 4NV7A 2PBHA 3CBKA 1CPJA 2CIOA 1U9WA 1CS8A 1NL6A 1U9QX 1GCBA 1ATKA 1KHPA 4BGFA 1E2TA 3PNRA 4P6GA 3TNXA 3IUTA 5EGWA 2G8EA 2NQGA 2B1MA 5K16A 2FO5A 3HHAA 4G54A 3P5WA 3H8BA 3OF8A 5CVMA 2H7JA 1ITOA 4CDFB 3D6SA 2Y6EA 3KWZA 4YVAA 1KFXL 1PADA 3I06A 2FUDA 1NPZA 4FJCA 4X6IA 1EWMA 1AU2A 2FT2A 1ZCMA 4QRXA 1BY8A 3H7DA 1QMYA 3N3KA 3MHHA 1F2AA 1POPA 3PDFA 5F02A 2P7UA 1AYVA 3BCNA 4CDEB 3LXSA 2XU1A 1PIPA 5EF4A 2DC9A 3LTWA 1EF7A 2FYEA 2YJ9A 4QH6A 2VFCA 3QT4A 2DC6A 3E1ZB 4PP1A 1Y08A 2P0RA 7PCKA 2R9OA 1NB5A 2ARYA 3HD3A 4YYWA 2O6XA 2GFOA 3K24A 1AU4A 1CQDA 3MHSA 1MDWA 1QXPA 1K3BB 1NQCA 1MS6A 2NQDB 1MEMA 4X6HA 4I05A 4GUZA 3P5VA 1SP4B 4PP2E 1F2BA 3KW9A 1AU3A 1AYWA 2NQAA 1CSBB 4MSXA 1CV8A 3H6SA 2AYOA 2AU1A 1THEA 2FTDA 2AS8A 2FQ9A 3QJ3A 3H89A 2IBIA 1ICFA 3K8UA 1KFUL 3HHIA 1CTEA 1F29A 2E00A 2AUZA 1A6RA 1ZIVA 4RY2A 1AU0A 2GHUA 4CDCB 2XU3A 2HHNA 2AVWA 3I3TA 3RVWA 1W5RA 1QOLA 1BQIA 1JQPA 2HH5A 2B1NA 1PXVA 1EWLA 1FH0A 2BDLA 3RVVA 2YJCA 4W5CA 3MORA 4B55A 2PADA 3S3QA 4OELA 4X6JA 2FRAA 1M6DA 2CB5A 2DCAA 1EWPA 4QBBA 1DF0A 1X9YA 3KKUA 4YYQA 1YALA 2YJBA 2R9MA 1KXRA 1GECE 4NV8A 2WBFX 4N4ZA 2ACTA 2FRQA 2DC8A 2YJ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JA7 A;  3KSE A;  2P86 A;  4YYS A;  2JQG R;  1AIM A;  4K7C A;  2XU4 A;  3ERV A;  1KHQ A;  1AYU A;  2HD5 A;  2XU5 A;  1GLO A;  3LFY A;  4AXL A;  3GCB A;  2PRE A;  4BS5 A;  2AYN A;  1VSN A;  1YVB A;  4MZS A;  1YT7 A;  1QDQ A;  4HWY A;  1BGO A;  9PAP A;  4DMX A;  3M99 A;  1AEC A;  3BWK A;  3WXF A;  1SNK A;  4QRV A;  2G7Y A;  1CJL A;  1U5I A;  2G8J A;  2AIM A;  4OEM A;  2F7D A;  1S4V A;  1ME4 A;  2C0Y A;  3PBH A;  4XR7 A;  4YYV A;  4PAD A;  1PE6 A;  8PCH A;  5J94 A;  3OIS A;  4BPV A;  1TL9 A;  3OVX A;  1PCI A;  2YJ2 A;  3OVZ A;  4KLB A;  4YV8 A;  1PPO A;  1NB3 A;  4XUI A;  5A24 A;  1EWO A;  2DC7 A;  2OUL A;  4YYR A;  2G6D A;  1VJV A;  1BP4 A;  1XKG A;  2R6N A;  4I04 A;  5JH3 A;  5CVO B;  2E01 A;  3IOQ A;  4YYU A;  4QRG A;  3IV2 A;  3USV A;  3IMA A;  4Q8G A;  3S3R A;  2AUX A;  1U9X A;  3KWB X;  3P5U A;  3V6E A;  3CH2 X;  4BS6 A;  6PAD A;  1MHW A;  1DEU A;  1Y4H A;  3P5X A;  2F1G A;  2Y5B A;  2DCC A;  2R9C A;  3NHE A;  3KFQ A;  3CH3 X;  2ATO A;  3BPF A;  1IWD A;  3V6C A;  1YK7 A;  1MIR A;  5PAD A;  2PNS A;  3C9E A;  2OP3 A;  3BC3 A;  3BOW A;  3CBJ A;  4CDD B;  2R9N A;  3U8E A;  2DJG B;  4FIP A;  1ME3 A;  3IHP A;  3ZUA A;  3F75 A;  1TLO A;  1PPP A;  1PBH A;  2NQI A;  4MZO A;  1MEG A;  3PW3 A;  3F5V A;  1PPD A;  3IEJ A;  4FK5 A;  3HWN A;  3H8C A;  4W5B A;  3RVX A;  2DCB A;  2E02 A;  2R9F A;  2DCD A;  3BPM A;  4I07 A;  3OF9 A;  4CZW A;  2E03 A;  1CB5 A;  1YK8 A;  3WXE A;  4N79 A;  2DZZ A;  3O0U A;  4N8W A;  1GMY A;  2VHF A;  2HXZ A;  2DJF B;  1NLJ A;  3KX1 A;  4W4U A;  1Q6K A;  5FPW A;  3AI8 A;  4BSQ A;  5CHV A;  4P6E A;  2IPP B;  3B79 A;  3QSD A;  1CVZ A;  5CHT A;  3MTN A;  1HUC B;  4DMY A;  1PPN A;  2DZY A;  4BQV A;  1F2C A;  1O0E A;  5CVN B;  4WA6 A;  1U9V A;  2VHS A;  3K9M A;  3DF0 A;  3N4C A;  4AXM A;  1STF E;  3O1G A;  4Q8H A;  1TU6 A;  2BDZ A;  2JQF R;  3WXG A;  4PI3 A;  3N3G A;  4ZUX U;  2OZ2 A;  2PBH A;  3CBK A;  1CPJ A;  2CIO A;  1U9W A;  1CS8 A;  1NL6 A;  1U9Q X;  1GCB A;  1ATK A;  1KHP A;  3PNR A;  4P6G A;  3TNX A;  3IUT A;  2G8E A;  2NQG A;  5EGW A;  2B1M A;  5K16 A;  2FO5 A;  3HHA A;  4G54 A;  3P5W A;  3H8B A;  3OF8 A;  5CVM A;  2H7J A;  1ITO A;  4CDF B;  3D6S A;  2Y6E A;  3KWZ A;  4YVA A;  1KFX L;  1PAD A;  3I06 A;  2FUD A;  1NPZ A;  4FJC A;  4X6I A;  1EWM A;  1AU2 A;  2FT2 A;  1ZCM A;  4QRX A;  1BY8 A;  3H7D A;  1QMY A;  3N3K A;  3MHH A;  1F2A A;  1POP A;  3PDF A;  5F02 A;  2P7U A;  1AYV A;  3BCN A;  4CDE B;  3LXS A;  2XU1 A;  1PIP A;  5EF4 A;  2DC9 A;  1EF7 A;  2FYE A;  2YJ9 A;  4QH6 A;  3QT4 A;  2DC6 A;  3E1Z B;  4PP1 A;  1Y08 A;  2P0R A;  7PCK A;  2R9O A;  1NB5 A;  2ARY A;  3HD3 A;  4YYW A;  2O6X A;  2GFO A;  3K24 A;  1AU4 A;  1CQD A;  1MDW A;  3MHS A;  1QXP A;  1K3B B;  1NQC A;  1MS6 A;  2NQD B;  1MEM A;  4X6H A;  4I05 A;  3P5V A;  1SP4 B;  4PP2 E;  1F2B A;  3KW9 A;  1AU3 A;  1AYW A;  2NQA A;  1CSB B;  4MSX A;  1CV8 A;  3H6S A;  2AYO A;  2AU1 A;  1THE A;  2FTD A;  2AS8 A;  2FQ9 A;  3QJ3 A;  3H89 A;  2IBI A;  1ICF A;  3K8U A;  1KFU L;  3HHI A;  1CTE A;  1F29 A;  2E00 A;  2AUZ A;  1A6R A;  1ZIV A;  4RY2 A;  1AU0 A;  2GHU A;  4CDC B;  2XU3 A;  2HHN A;  2AVW A;  3I3T A;  3RVW A;  1QOL A;  1BQI A;  1JQP A;  2HH5 A;  2B1N A;  1PXV A;  1EWL A;  1FH0 A;  2BDL A;  3RVV A;  2YJC A;  4W5C A;  3MOR A;  2PAD A;  3S3Q A;  4OEL A;  4X6J A;  2FRA A;  1M6D A;  2CB5 A;  2DCA A;  1EWP A;  4QBB A;  1DF0 A;  1X9Y A;  3KKU A;  4YYQ A;  1YAL A;  2YJB A;  2R9M A;  1KXR A;  1GEC E;  2WBF X;  4N4Z A;  2ACT A;  2FRQ A;  2DC8 A;  2YJ8 A; 
#chains in the Genus database with same CATH topology
 4D8B A;  5JA7 A;  4MI7 A;  3KSE A;  2P86 A;  4YYS A;  3W30 A;  2JQG R;  1AIM A;  3IFU A;  4K7C A;  2XU4 A;  3PSE A;  3ERV A;  1KHQ A;  1AYU A;  2BU3 A;  2HD5 A;  2XU5 A;  1GLO A;  4XZX A;  3LFY A;  2J7Q A;  4AXL A;  3GCB A;  2PRE A;  4BS5 A;  2AYN A;  2DOS A;  1VSN A;  1YVB A;  4MZS A;  2UZJ A;  1YT7 A;  1QDQ A;  5E6J A;  4HWY A;  1BGO A;  9PAP A;  4DMX A;  3M99 A;  1AEC A;  3BWK A;  3OQC A;  3WXF A;  1SNK A;  4QRV A;  2G7Y A;  1CJL A;  1U5I A;  2G8J A;  2AIM A;  4OEM A;  2F7D A;  1S4V A;  1ME4 A;  2C0Y A;  3PBH A;  4XR7 A;  4YYV A;  4PAD A;  1PE6 A;  3BB7 A;  8PCH A;  4BOP A;  5J94 A;  3OIS A;  4BPV A;  1TL9 A;  3OVX A;  1PCI A;  2YJ2 A;  3OVZ A;  4KLB A;  4YV8 A;  1PPO A;  1NB3 A;  1UKF A;  4XUI A;  5A24 A;  1EWO A;  2DC7 A;  2OUL A;  1YZB A;  4YYR A;  2G6D A;  1VJV A;  3RNV A;  1BP4 A;  1XKG A;  4WUR A;  2R6N A;  4I04 A;  5JH3 A;  5CVO B;  2E01 A;  3IOQ A;  4YYU A;  4QRG A;  3IV2 A;  3USV A;  3IMA A;  4Q8G A;  3S3R A;  2AUX A;  4D8I A;  1U9X A;  3KWB X;  3P5U A;  4OW0 A;  3V6E A;  3CH2 X;  4BS6 A;  6PAD A;  3MTV A;  1MHW A;  1DEU A;  1Y4H A;  4RKX A;  3P5X A;  2F1G A;  2Y5B A;  2DCC A;  2R9C A;  3NHE A;  4BOQ A;  3E9S A;  3KFQ A;  3CH3 X;  2ATO A;  4RNA A;  3BPF A;  1IWD A;  3V6C A;  1YK7 A;  1MIR A;  5PAD A;  2PNS A;  4REZ A;  3C9E A;  2OP3 A;  3BC3 A;  3TMP A;  3BOW A;  3BBA A;  3CBJ A;  4CDD B;  2R9N A;  3U8E A;  2DJG B;  4FIP A;  1ME3 A;  3IHP A;  3ZUA A;  3F75 A;  1TLO A;  1PPP A;  1PBH A;  2NQI A;  4MZO A;  1MEG A;  2HWK A;  4GUA A;  3PW3 A;  3F5V A;  1PPD A;  3IEJ A;  4FK5 A;  3HWN A;  3H8C A;  4W5B A;  3RVX A;  2DCB A;  2E02 A;  2R9F A;  2DCD A;  3BPM A;  4I07 A;  3OF9 A;  4CZW A;  4RF1 A;  2E03 A;  1CB5 A;  1YK8 A;  3WXE A;  4N79 A;  2DZZ A;  3O0U A;  4N8W A;  1GMY A;  2VHF A;  2HXZ A;  2DJF B;  4PT5 A;  1NLJ A;  3KX1 A;  4W4U A;  1Q6K A;  5FPW A;  3AI8 A;  4BSQ A;  4ZTB A;  5CHV A;  2IPP B;  3B79 A;  4P6E A;  3QSD A;  1PVJ A;  1CVZ A;  5CHT A;  4D8E A;  3MTN A;  1HUC B;  4DMY A;  1PPN A;  2DZY A;  4BQV A;  1F2C A;  4HXD B;  1O0E A;  5CVN B;  4WA6 A;  1U9V A;  2Z84 A;  2VHS A;  3K9M A;  3DF0 A;  3BY4 A;  3N4C A;  4AXM A;  1STF E;  3O1G A;  4Q8H A;  1TU6 A;  2BDZ A;  2JQF R;  4BOS A;  3WXG A;  2FE8 A;  4PI3 A;  3N3G A;  4M0W A;  4ZUX U;  2OZ2 A;  2PBH A;  3CBK A;  1CPJ A;  4A5U A;  2CIO A;  1U9W A;  1CS8 A;  3MJ5 A;  3ZNH A;  1NL6 A;  1U9Q X;  3PRP A;  4BOU A;  1GCB A;  1ATK A;  1KHP A;  3PHU A;  3W31 A;  3PNR A;  4P6G A;  3TNX A;  3IUT A;  2G8E A;  2NQG A;  5EGW A;  2B1M A;  5K16 A;  2FO5 A;  3HHA A;  4G54 A;  4R3D A;  3O65 A;  3P5W A;  3H8B A;  3OF8 A;  5CVM A;  2H7J A;  1ITO A;  4CDF B;  3D6S A;  2Y6E A;  3KWZ A;  4YVA A;  1KFX L;  1PAD A;  3I06 A;  2FUD A;  1NPZ A;  5JZE A;  2JRI A;  4FJC A;  1EWM A;  4X6I A;  4RF0 A;  1AU2 A;  2FT2 A;  1ZCM A;  4QRX A;  1BY8 A;  3H7D A;  3PHX A;  1QMY A;  3N3K A;  3MHH A;  1F2A A;  3PRM A;  1POP A;  3PDF A;  4P16 A;  4MM3 B;  2BTW B;  5F02 A;  2P7U A;  1AYV A;  3BCN A;  4CDE B;  3LXS A;  2XU1 A;  1PIP A;  5EF4 A;  2DC9 A;  1EF7 A;  2FYE A;  2YJ9 A;  4QH6 A;  3QT4 A;  2DC6 A;  4OVZ A;  3E1Z B;  4PP1 A;  1Y08 A;  2P0R A;  7PCK A;  2R9O A;  1NB5 A;  2ARY A;  3HD3 A;  4YYW A;  2O6X A;  2GFO A;  3K24 A;  1AU4 A;  1CQD A;  3MHS A;  1MDW A;  1QXP A;  1K3B B;  1NQC A;  1MS6 A;  2NQD B;  1MEM A;  4X6H A;  3C0R A;  4I05 A;  3P5V A;  1SP4 B;  4PP2 E;  1F2B A;  3KW9 A;  1AU3 A;  1AYW A;  2NQA A;  1CSB B;  4MSX A;  4IP3 A;  1CV8 A;  3H6S A;  2AYO A;  2AU1 A;  1THE A;  2FTD A;  2AS8 A;  2FQ9 A;  3QJ3 A;  5EZS A;  3PHW A;  3H89 A;  2IBI A;  1ICF A;  3K8U A;  1KFU L;  3HHI A;  1CTE A;  1F29 A;  2E00 A;  3B21 A;  3MP2 A;  2AUZ A;  1DKI A;  1A6R A;  1ZIV A;  4RY2 A;  2J7Q C;  1AU0 A;  2GHU A;  4CDC B;  5EZQ A;  2XU3 A;  5KO3 A;  2HHN A;  2AVW A;  3I3T A;  3RVW A;  1QOL A;  1BQI A;  1JQP A;  2HH5 A;  2B1N A;  1PXV A;  1EWL A;  1FH0 A;  2BDL A;  3RVV A;  2YJC A;  4W5C A;  4IUM A;  3MOR A;  4OVZ B;  3TRK A;  2PAD A;  3S3Q A;  4OEL A;  4X6J A;  2FRA A;  1M6D A;  2CB5 A;  2DCA A;  1EWP A;  4QBB A;  1DF0 A;  1X9Y A;  2BTW A;  3KKU A;  4YYQ A;  1YAL A;  2YJB A;  2R9M A;  2AGA A;  1KXR A;  3PT2 A;  1GEC E;  4BOZ A;  2WBF X;  4N4Z A;  2ACT A;  2FRQ A;  2JTC A;  2DC8 A;  2YJ8 A; 
#chains in the Genus database with same CATH homology
 5JA7 A;  3KSE A;  2P86 A;  4YYS A;  2JQG R;  1AIM A;  4K7C A;  2XU4 A;  3ERV A;  2BSZ A;  1KHQ A;  1AYU A;  2HD5 A;  2XU5 A;  1GLO A;  3LFY A;  4AXL A;  3GCB A;  2PRE A;  4BS5 A;  2AYN A;  1VSN A;  1YVB A;  4MZS A;  1W6F A;  1YT7 A;  1QDQ A;  4HWY A;  1BGO A;  9PAP A;  4DMX A;  3M99 A;  1AEC A;  3BWK A;  3WXF A;  1SNK A;  4QRV A;  2G7Y A;  1CJL A;  1U5I A;  2G8J A;  2AIM A;  4OEM A;  4C5P A;  2F7D A;  1S4V A;  1ME4 A;  2C0Y A;  3PBH A;  4XR7 A;  4YYV A;  4PAD A;  1PE6 A;  8PCH A;  5J94 A;  3OIS A;  4BPV A;  1TL9 A;  3OVX A;  1PCI A;  2YJ2 A;  3OVZ A;  4KLB A;  4YV8 A;  1PPO A;  1NB3 A;  1W4T A;  4XUI A;  5A24 A;  1EWO A;  2DC7 A;  2OUL A;  4YYR A;  2G6D A;  1VJV A;  1BP4 A;  1XKG A;  2R6N A;  4I04 A;  5JH3 A;  5CVO B;  2E01 A;  3IOQ A;  4YYU A;  4QRG A;  3IV2 A;  3USV A;  3IMA A;  4Q8G A;  3D9W A;  3S3R A;  2AUX A;  1U9X A;  2VFB A;  3KWB X;  3P5U A;  3V6E A;  3CH2 X;  4BS6 A;  6PAD A;  1MHW A;  1DEU A;  1Y4H A;  3P5X A;  2F1G A;  2Y5B A;  2DCC A;  2R9C A;  3NHE A;  3KFQ A;  3CH3 X;  2ATO A;  3BPF A;  1IWD A;  3V6C A;  1YK7 A;  1MIR A;  5PAD A;  2PNS A;  3C9E A;  2OP3 A;  3BC3 A;  3BOW A;  3CBJ A;  4CDD B;  2R9N A;  3U8E A;  2DJG B;  4FIP A;  1ME3 A;  3IHP A;  3ZUA A;  3F75 A;  1TLO A;  1PPP A;  1PBH A;  2NQI A;  4MZO A;  1MEG A;  3PW3 A;  3F5V A;  1PPD A;  3IEJ A;  4FK5 A;  3HWN A;  3H8C A;  4W5B A;  3RVX A;  2DCB A;  1GX3 A;  2E02 A;  2R9F A;  2DCD A;  3BPM A;  4I07 A;  3OF9 A;  4CZW A;  2E03 A;  1CB5 A;  1YK8 A;  3WXE A;  4N79 A;  2DZZ A;  3O0U A;  4N8W A;  1GMY A;  2VHF A;  2HXZ A;  2DJF B;  1NLJ A;  3KX1 A;  4W4U A;  1Q6K A;  5FPW A;  3AI8 A;  4BSQ A;  5CHV A;  4P6E A;  2IPP B;  3B79 A;  3QSD A;  1CVZ A;  5CHT A;  3MTN A;  1HUC B;  4DMY A;  1PPN A;  2DZY A;  4BQV A;  1F2C A;  1O0E A;  5CVN B;  4WA6 A;  1U9V A;  2VHS A;  3K9M A;  3DF0 A;  3N4C A;  4AXM A;  1STF E;  3O1G A;  4Q8H A;  1TU6 A;  2BDZ A;  2JQF R;  3WXG A;  4PI3 A;  3N3G A;  4ZUX U;  2OZ2 A;  4NV7 A;  2PBH A;  3CBK A;  1CPJ A;  2CIO A;  1U9W A;  1CS8 A;  1NL6 A;  1U9Q X;  1GCB A;  1ATK A;  1KHP A;  4BGF A;  1E2T A;  3PNR A;  4P6G A;  3TNX A;  3IUT A;  5EGW A;  2G8E A;  2NQG A;  2B1M A;  5K16 A;  2FO5 A;  3HHA A;  4G54 A;  3P5W A;  3H8B A;  3OF8 A;  5CVM A;  2H7J A;  1ITO A;  4CDF B;  3D6S A;  2Y6E A;  3KWZ A;  4YVA A;  1KFX L;  1PAD A;  3I06 A;  2FUD A;  1NPZ A;  4FJC A;  4X6I A;  1EWM A;  1AU2 A;  2FT2 A;  1ZCM A;  4QRX A;  1BY8 A;  3H7D A;  1QMY A;  3N3K A;  3MHH A;  1F2A A;  1POP A;  3PDF A;  5F02 A;  2P7U A;  1AYV A;  3BCN A;  4CDE B;  3LXS A;  2XU1 A;  1PIP A;  5EF4 A;  2DC9 A;  3LTW A;  1EF7 A;  2FYE A;  2YJ9 A;  4QH6 A;  2VFC A;  3QT4 A;  2DC6 A;  3E1Z B;  4PP1 A;  1Y08 A;  2P0R A;  7PCK A;  2R9O A;  1NB5 A;  2ARY A;  3HD3 A;  4YYW A;  2O6X A;  2GFO A;  3K24 A;  1AU4 A;  1CQD A;  3MHS A;  1MDW A;  1QXP A;  1K3B B;  1NQC A;  1MS6 A;  2NQD B;  1MEM A;  4X6H A;  4I05 A;  4GUZ A;  3P5V A;  1SP4 B;  4PP2 E;  1F2B A;  3KW9 A;  1AU3 A;  1AYW A;  2NQA A;  1CSB B;  4MSX A;  1CV8 A;  3H6S A;  2AYO A;  2AU1 A;  1THE A;  2FTD A;  2AS8 A;  2FQ9 A;  3QJ3 A;  3H89 A;  2IBI A;  1ICF A;  3K8U A;  1KFU L;  3HHI A;  1CTE A;  1F29 A;  2E00 A;  2AUZ A;  1A6R A;  1ZIV A;  4RY2 A;  1AU0 A;  2GHU A;  4CDC B;  2XU3 A;  2HHN A;  2AVW A;  3I3T A;  3RVW A;  1W5R A;  1QOL A;  1BQI A;  1JQP A;  2HH5 A;  2B1N A;  1PXV A;  1EWL A;  1FH0 A;  2BDL A;  3RVV A;  2YJC A;  4W5C A;  3MOR A;  4B55 A;  2PAD A;  3S3Q A;  4OEL A;  4X6J A;  2FRA A;  1M6D A;  2CB5 A;  2DCA A;  1EWP A;  4QBB A;  1DF0 A;  1X9Y A;  3KKU A;  4YYQ A;  1YAL A;  2YJB A;  2R9M A;  1KXR A;  1GEC E;  4NV8 A;  2WBF X;  4N4Z A;  2ACT A;  2FRQ A;  2DC8 A;  2YJ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...