4XUIA

Crystal structure analysis of cruzain bound to the no-covalent analog of wrr-483 (wrr-669)
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
215
structure length
215
Chain Sequence
APAAVDWRARGAVTAVKDQGQCGSCWAFSAIGNVECQWFLAGHPLTNLSEQMLVSCDKTDSGCSGGLMNNAFEWIVQENNGAVYTEDSYPYASGEGISPPCTTSGHTVGATITGHVELPQDEAQIAAWLAVNGPVAVAVDASSWMTYTGGVMTSCVSEQLDHGVLLVGYNDSAAVPYWIIKNSWTTQWGEEGYIRIAKGSNQCLVKEEASSAVVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Synthesis and Evaluation of Oxyguanidine Analogues of the Cysteine Protease Inhibitor WRR-483 against Cruzain.
pubmed doi rcsb
molecule keywords Cruzipain
molecule tags Hydrolase/hydrolase inhibitor
source organism Trypanosoma cruzi
total genus 62
structure length 215
sequence length 215
chains with identical sequence B, C
ec nomenclature ec 3.4.22.51: Cruzipain.
pdb deposition date 2015-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 4xuiA00
8PCHA 2AVWA 4CDEB 2DCCA 2R9CA 4PP1A 4X6HA 1PCIA 1Y08A 4YVAA 1AECA 1CJLA 1XKGA 3HHIA 2AUXA 2PBHA 2B1NA 3WXGA 3OF8A 3ZUAA 2AU1A 2JQGR 2YJ9A 3S3QA 2Y5BA 2YJBA 3S3RA 1SP4B 4PP2E 2G7YA 3OF9A 1ZIVA 1K3BB 2HXZA 3NHEA 3KW9A 4N79A 1CSBB 3KWZA 1F29A 1ITOA 3N4CA 1KHQA 4XR7A 2FT2A 3ERVA 4YYQA 1U9QX 4DMXA 1PE6A 2DC9A 4BS6A 1KFXL 2DJGB 1MDWA 2HD5A 1X9YA 3N3KA 1GECE 1CB5A 3PNRA 4FK5A 2ATOA 1AU2A 1ATKA 4CDDB 4PADA 3HHAA 3F5VA 1Q6KA 1ME3A 1KHPA 1BQIA 1VJVA 3H8BA 3K9MA 4I05A 3LFYA 5FPWA 1SNKA 1YK8A 2FTDA 7PCKA 5F02A 1CS8A 2FUDA 1FH0A 4CZWA 4KLBA 4QH6A 1AU0A 3P5VA 1CPJA 3HWNA 5EF4A 1TU6A 6PADA 2R9FA 1YVBA 1AYVA 3I06A 3B79A 1PPNA 1YK7A 3CH2X 1NPZA 3MORA 5A24A 4QRGA 1QMYA 3MHHA 1CVZA 4MZOA 2NQAA 1MIRA 3PBHA 2GHUA 2WBFX 4I04A 3MHSA 2OULA 1IWDA 4AXLA 1THEA 1TLOA 2PREA 3IEJA 4Q8HA 2R9OA 2C0YA 3KFQA 5CVOB 2DC8A 1PIPA 3P5XA 1ZCMA 1BGOA 2DC6A 2DJFB 1Y4HA 3H6SA 1MHWA 2HHNA 2Y6EA 3QSDA 4MZSA 1KXRA 1MS6A 1TL9A 4OELA 3IUTA 2FQ9A 1NB3A 5JH3A 3P5UA 3BOWA 3O0UA 4YYVA 4X6JA 2DCAA 1S4VA 4CDCB 2E03A 3C9EA 3O1GA 5PADA 1MEGA 4P6EA 4BPVA 4YV8A 2XU3A 4RY2A 3U8EA 1STFE 4YYUA 2G8EA 5EGWA 4AXMA 3IOQA 4FJCA 2DZZA 4WA6A 1ME4A 2XU1A 2ARYA 1F2BA 1PPDA 3WXFA 2NQIA 1F2AA 1BP4A 3PDFA 3QJ3A 2P7UA 2P86A 3AI8A 1MEMA 2AYNA 3N3GA 1EWOA 4W5CA 1PXVA 3DF0A 1AYUA 2F1GA 1GCBA 2FYEA 2OP3A 2HH5A 3BWKA 2R9NA 2BDZA 3QT4A 1QXPA 2G8JA 2O6XA 4FIPA 1NB5A 1GMYA 3M99A 2XU5A 4YYWA 3KSEA 3RVXA 2F7DA 4QBBA 4PI3A 1O0EA 2DCDA 3KWBX 1CQDA 3E1ZB 1EWLA 3CBJA 3KKUA 1ICFA 4QRVA 3LXSA 2PNSA 3P5WA 2JQFR 2IPPB 5K16A 2ACTA 3IV2A 1A6RA 1CTEA 2E02A 3H7DA 2G6DA 5CVMA 2E01A 4Q8GA 4BSQA 2XU4A 5J94A 1CV8A 3OISA 2AUZA 1EWPA 4X6IA 1YALA 1KFUL 3OVZA 4N4ZA 3K8UA 3BPMA 4BQVA 2AYOA 2OZ2A 2YJCA 1DEUA 2VHSA 3OVXA 1AU4A 3MTNA 1BY8A 2DC7A 3BPFA 3GCBA 3RVVA 4XUIA 1U9XA 3K24A 3CBKA 2VHFA 3TNXA 2DCBA 1M6DA 3BCNA 1GLOA 2NQGA 1U5IA 4YYRA 5JA7A 3H89A 1PPPA 4G54A 2PADA 3V6EA 1YT7A 1PPOA 4K7CA 3IMAA 1PADA 2FO5A 4P6GA 3IHPA 1NL6A 1U9VA 1POPA 1QOLA 1NLJA 2YJ8A 1F2CA 1EF7A 2H7JA 3CH3X 3D6SA 3PW3A 1EWMA 4QRXA 3USVA 1AIMA 2B1MA 1U9WA 4OEMA 4MSXA 5CVNB 2GFOA 2E00A 2R6NA 2NQDB 3HD3A 4W5BA 3RVWA 4DMYA 1AYWA 4N8WA 1JQPA 1HUCB 3WXEA 3BC3A 1PBHA 2AIMA 4ZUXU 1DF0A 2DZYA 4HWYA 2P0RA 5CHTA 2CIOA 2IBIA 3KX1A 2FRQA 2YJ2A 3F75A 2AS8A 2FRAA 3V6CA 3H8CA 4CDFB 9PAPA 4YYSA 2BDLA 4W4UA 2R9MA 1NQCA 3I3TA 1VSNA 5CHVA 1QDQA 2CB5A 4I07A 1AU3A 4BS5A
chains in the Genus database with same CATH superfamily
3PRPA 8PCHA 2AVWA 4CDEB 2DCCA 2R9CA 4PP1A 4X6HA 1PCIA 1Y08A 4YVAA 1AECA 1CJLA 4XZXA 1XKGA 3HHIA 2AUXA 2PBHA 2B1NA 3WXGA 3OF8A 3ZUAA 2AU1A 2JQGR 4PT5A 2YJ9A 3S3QA 4RKXA 2BTWB 3TMPA 2Y5BA 2YJBA 3PHUA 3S3RA 4D8BA 1SP4B 4PP2E 2G7YA 3OF9A 1ZIVA 1K3BB 4BOPA 2HXZA 3NHEA 3KW9A 4N79A 1CSBB 1UKFA 3KWZA 1F29A 1ITOA 3N4CA 1KHQA 4XR7A 3PHWA 2FT2A 3ERVA 4YYQA 1U9QX 4DMXA 4WURA 1PE6A 2DC9A 3MP2A 4BS6A 1KFXL 2DJGB 1MDWA 2HD5A 1X9YA 3BY4A 1GECE 3N3KA 1CB5A 3PNRA 4FK5A 2ATOA 1AU2A 1ATKA 4BOSA 4PADA 4CDDB 3HHAA 3F5VA 1Q6KA 1ME3A 3RNVA 1KHPA 1BQIA 1VJVA 3H8BA 3K9MA 4I05A 3LFYA 5FPWA 5JZEA 4BOQA 1SNKA 1YK8A 2FTDA 7PCKA 5F02A 1CS8A 2FUDA 1FH0A 4CZWA 3MJ5A 4KLBA 4QH6A 1AU0A 3P5VA 1CPJA 3HWNA 5EF4A 1TU6A 6PADA 2R9FA 1YVBA 1AYVA 4IUMA 3I06A 3B79A 1PPNA 1YK7A 3CH2X 1NPZA 3MORA 3E9SA 5A24A 4QRGA 1QMYA 3MHHA 3W30A 1CVZA 4MZOA 2NQAA 1MIRA 3PBHA 2GHUA 2WBFX 3O65A 4I04A 3MHSA 2OULA 1IWDA 4AXLA 1THEA 1TLOA 2PREA 3IEJA 4Q8HA 2R9OA 2C0YA 3KFQA 5CVOB 2DC8A 4GUAA 1PIPA 3P5XA 4HXDB 1ZCMA 1BGOA 2DC6A 2DJFB 1Y4HA 3H6SA 4A5UA 1MHWA 2HHNA 2Y6EA 3QSDA 4MZSA 1KXRA 1MS6A 1TL9A 4OELA 3IUTA 2FQ9A 1NB3A 5JH3A 3P5UA 3BOWA 3O0UA 4YYVA 4X6JA 2DCAA 1S4VA 4CDCB 2E03A 3C9EA 3O1GA 5PADA 1MEGA 4P6EA 4BPVA 4YV8A 2XU3A 4RY2A 3U8EA 1STFE 4YYUA 2G8EA 5EGWA 4AXMA 3IOQA 4FJCA 2Z84A 2DZZA 4WA6A 1ME4A 2XU1A 2ARYA 1F2BA 1PPDA 2JTCA 3WXFA 2NQIA 2J7QA 1F2AA 1BP4A 3PT2A 3PDFA 3QJ3A 2P7UA 3BBAA 2P86A 3AI8A 1MEMA 2AYNA 2BU3A 3N3GA 1EWOA 2JRIA 4W5CA 1PXVA 3DF0A 1AYUA 2F1GA 2UZJA 1GCBA 2FYEA 2OP3A 2HH5A 3BWKA 2R9NA 2BDZA 3QT4A 4IP3A 1QXPA 4R3DA 2G8JA 2O6XA 4FIPA 1NB5A 1GMYA 4RNAA 3M99A 2XU5A 4YYWA 3KSEA 2J7QC 3MTVA 3RVXA 2F7DA 4QBBA 4PI3A 1O0EA 2DCDA 3IFUA 4BOUA 3KWBX 1CQDA 3E1ZB 1EWLA 3CBJA 4P16A 3KKUA 1ICFA 2DOSA 4QRVA 3LXSA 2PNSA 3P5WA 2JQFR 2IPPB 5K16A 2ACTA 3IV2A 1A6RA 1CTEA 2E02A 3H7DA 2G6DA 5CVMA 2E01A 4Q8GA 4BSQA 5KO3A 2XU4A 4REZA 5E6JA 5J94A 1CV8A 3OISA 2AUZA 1EWPA 4RF1A 4X6IA 1YALA 4ZTBA 1KFUL 3OVZA 4N4ZA 3K8UA 3BPMA 4RF0A 4BQVA 2AYOA 2OZ2A 2YJCA 1DEUA 2VHSA 4D8EA 3OVXA 1AU4A 3MTNA 1BY8A 2DC7A 3C0RA 3BPFA 4OW0A 3GCBA 3RVVA 4XUIA 1U9XA 3ZNHA 3K24A 3CBKA 2VHFA 3TNXA 2DCBA 1M6DA 3BCNA 1GLOA 2BTWA 2NQGA 3W31A 1U5IA 4YYRA 4MM3B 3PRMA 5JA7A 3H89A 1PPPA 4G54A 2PADA 3V6EA 1YT7A 1PPOA 4K7CA 3IMAA 1PADA 2FO5A 4D8IA 4P6GA 3IHPA 1NL6A 1U9VA 1POPA 1PVJA 1QOLA 1NLJA 2YJ8A 2FE8A 1F2CA 1EF7A 2H7JA 3CH3X 3D6SA 3PW3A 1EWMA 4QRXA 3USVA 1AIMA 2B1MA 3PSEA 3TRKA 1U9WA 4OEMA 4MSXA 5CVNB 3PHXA 2GFOA 2E00A 2R6NA 3B21A 2NQDB 2HWKA 3HD3A 4W5BA 3RVWA 4DMYA 1AYWA 4N8WA 1JQPA 1HUCB 3WXEA 3BC3A 3OQCA 1PBHA 2AIMA 1DKIA 4ZUXU 1DF0A 2DZYA 4HWYA 2P0RA 5CHTA 2CIOA 2AGAA 2IBIA 3KX1A 2FRQA 2YJ2A 3F75A 2AS8A 2FRAA 3V6CA 3H8CA 4CDFB 9PAPA 4YYSA 2BDLA 4W4UA 2R9MA 1NQCA 4MI7A 3BB7A 3I3TA 4M0WA 1VSNA 5CHVA 1YZBA 5EZQA 4BOZA 1QDQA 2CB5A 5EZSA 4I07A 4OVZB 1AU3A 4OVZA 4BS5A
chains in the Genus database with same CATH topology
8PCHA 2AVWA 4CDEB 2DCCA 3D9WA 2R9CA 4PP1A 4X6HA 1PCIA 1Y08A 4YVAA 1AECA 1CJLA 1XKGA 3HHIA 2AUXA 2PBHA 2B1NA 3WXGA 4NV8A 3OF8A 3ZUAA 2AU1A 2JQGR 2YJ9A 3S3QA 1E2TA 2Y5BA 2YJBA 3S3RA 1SP4B 4PP2E 2G7YA 3OF9A 1ZIVA 1K3BB 2VFBA 2HXZA 3NHEA 3KW9A 4N79A 1CSBB 3KWZA 1F29A 1ITOA 3N4CA 1KHQA 4XR7A 2FT2A 3ERVA 4YYQA 1U9QX 4DMXA 1PE6A 2DC9A 4BS6A 1KFXL 2DJGB 1MDWA 2HD5A 1X9YA 3N3KA 1GECE 1CB5A 3PNRA 4FK5A 2ATOA 1AU2A 1ATKA 4CDDB 4PADA 3HHAA 3F5VA 1Q6KA 1ME3A 1KHPA 1BQIA 1VJVA 3H8BA 3K9MA 4I05A 3LFYA 5FPWA 1SNKA 1YK8A 2FTDA 7PCKA 5F02A 1CS8A 2FUDA 1FH0A 4CZWA 4KLBA 4QH6A 1AU0A 3P5VA 1CPJA 3HWNA 4BGFA 2BSZA 5EF4A 1TU6A 6PADA 2R9FA 1YVBA 1AYVA 3I06A 3B79A 1PPNA 1YK7A 3CH2X 1NPZA 3MORA 5A24A 4QRGA 1QMYA 3MHHA 1CVZA 4MZOA 2NQAA 1MIRA 3PBHA 2GHUA 2WBFX 4GUZA 4I04A 3MHSA 2OULA 1IWDA 4AXLA 1THEA 1TLOA 2PREA 3IEJA 4Q8HA 2R9OA 1GX3A 2C0YA 3KFQA 5CVOB 2DC8A 1PIPA 3P5XA 1ZCMA 1BGOA 4B55A 2DC6A 2DJFB 1Y4HA 3H6SA 1MHWA 2HHNA 2Y6EA 3QSDA 4MZSA 1KXRA 1MS6A 1TL9A 4OELA 3IUTA 2FQ9A 1NB3A 5JH3A 3P5UA 3BOWA 3O0UA 4YYVA 4X6JA 2VFCA 2DCAA 1S4VA 4CDCB 2E03A 3C9EA 3O1GA 5PADA 1MEGA 4P6EA 4BPVA 4YV8A 2XU3A 4RY2A 3U8EA 1STFE 4YYUA 2G8EA 5EGWA 4AXMA 3IOQA 4FJCA 2DZZA 4WA6A 1ME4A 2XU1A 2ARYA 1F2BA 1PPDA 3WXFA 2NQIA 1F2AA 1BP4A 1W6FA 3PDFA 3QJ3A 2P7UA 2P86A 3AI8A 1MEMA 2AYNA 3N3GA 1EWOA 4W5CA 1PXVA 3DF0A 1AYUA 2F1GA 1GCBA 2FYEA 2OP3A 2HH5A 3BWKA 2R9NA 2BDZA 3QT4A 1QXPA 2G8JA 2O6XA 4FIPA 1NB5A 1GMYA 3M99A 2XU5A 4YYWA 3KSEA 3RVXA 3LTWA 2F7DA 4QBBA 4PI3A 1O0EA 2DCDA 3KWBX 1CQDA 3E1ZB 1EWLA 3CBJA 1W5RA 3KKUA 1ICFA 4QRVA 3LXSA 2PNSA 3P5WA 2JQFR 2IPPB 5K16A 2ACTA 3IV2A 1A6RA 1CTEA 2E02A 3H7DA 2G6DA 5CVMA 2E01A 4Q8GA 4BSQA 2XU4A 5J94A 1CV8A 3OISA 2AUZA 1EWPA 4X6IA 1YALA 1KFUL 3OVZA 4C5PA 4N4ZA 3K8UA 3BPMA 4BQVA 2AYOA 2OZ2A 2YJCA 1DEUA 2VHSA 3OVXA 1AU4A 3MTNA 1BY8A 2DC7A 1W4TA 3BPFA 3GCBA 3RVVA 4XUIA 1U9XA 3K24A 3CBKA 2VHFA 3TNXA 2DCBA 1M6DA 3BCNA 1GLOA 2NQGA 1U5IA 4YYRA 5JA7A 3H89A 1PPPA 4G54A 2PADA 3V6EA 1YT7A 1PPOA 4K7CA 3IMAA 1PADA 2FO5A 4P6GA 3IHPA 1NL6A 1U9VA 1POPA 1QOLA 1NLJA 2YJ8A 1F2CA 1EF7A 2H7JA 3CH3X 3D6SA 3PW3A 1EWMA 4QRXA 3USVA 1AIMA 2B1MA 1U9WA 4OEMA 4MSXA 5CVNB 2GFOA 2E00A 2R6NA 2NQDB 3HD3A 4W5BA 3RVWA 4DMYA 1AYWA 4N8WA 1JQPA 1HUCB 3WXEA 3BC3A 1PBHA 2AIMA 4ZUXU 1DF0A 2DZYA 4HWYA 2P0RA 5CHTA 2CIOA 2IBIA 3KX1A 2FRQA 2YJ2A 3F75A 2AS8A 2FRAA 3V6CA 3H8CA 4NV7A 4CDFB 9PAPA 4YYSA 2BDLA 4W4UA 2R9MA 1NQCA 3I3TA 1VSNA 5CHVA 1QDQA 2CB5A 4I07A 1AU3A 4BS5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 8PCH A;  2AVW A;  4CDE B;  2DCC A;  2R9C A;  4PP1 A;  4X6H A;  1PCI A;  1Y08 A;  4YVA A;  1AEC A;  1CJL A;  1XKG A;  3HHI A;  2AUX A;  2PBH A;  2B1N A;  3WXG A;  3OF8 A;  3ZUA A;  2AU1 A;  2JQG R;  2YJ9 A;  3S3Q A;  2Y5B A;  2YJB A;  3S3R A;  1SP4 B;  4PP2 E;  2G7Y A;  3OF9 A;  1ZIV A;  1K3B B;  2HXZ A;  3NHE A;  3KW9 A;  4N79 A;  1CSB B;  3KWZ A;  1F29 A;  1ITO A;  3N4C A;  1KHQ A;  4XR7 A;  2FT2 A;  3ERV A;  4YYQ A;  1U9Q X;  4DMX A;  1PE6 A;  2DC9 A;  4BS6 A;  1KFX L;  2DJG B;  1MDW A;  2HD5 A;  1X9Y A;  3N3K A;  1GEC E;  1CB5 A;  3PNR A;  4FK5 A;  2ATO A;  1AU2 A;  1ATK A;  4CDD B;  4PAD A;  3HHA A;  3F5V A;  1Q6K A;  1ME3 A;  1KHP A;  1BQI A;  1VJV A;  3H8B A;  3K9M A;  4I05 A;  3LFY A;  5FPW A;  1SNK A;  1YK8 A;  2FTD A;  7PCK A;  5F02 A;  1CS8 A;  2FUD A;  1FH0 A;  4CZW A;  4KLB A;  4QH6 A;  1AU0 A;  3P5V A;  1CPJ A;  3HWN A;  5EF4 A;  1TU6 A;  6PAD A;  2R9F A;  1YVB A;  1AYV A;  3I06 A;  3B79 A;  1PPN A;  1YK7 A;  3CH2 X;  1NPZ A;  3MOR A;  5A24 A;  4QRG A;  1QMY A;  3MHH A;  1CVZ A;  4MZO A;  2NQA A;  1MIR A;  3PBH A;  2GHU A;  2WBF X;  4I04 A;  3MHS A;  2OUL A;  1IWD A;  4AXL A;  1THE A;  1TLO A;  2PRE A;  3IEJ A;  4Q8H A;  2R9O A;  2C0Y A;  3KFQ A;  5CVO B;  2DC8 A;  1PIP A;  3P5X A;  1ZCM A;  1BGO A;  2DC6 A;  2DJF B;  1Y4H A;  3H6S A;  1MHW A;  2HHN A;  2Y6E A;  3QSD A;  4MZS A;  1KXR A;  1MS6 A;  1TL9 A;  4OEL A;  3IUT A;  2FQ9 A;  1NB3 A;  5JH3 A;  3P5U A;  3BOW A;  3O0U A;  4YYV A;  4X6J A;  2DCA A;  1S4V A;  4CDC B;  2E03 A;  3C9E A;  3O1G A;  5PAD A;  1MEG A;  4P6E A;  4BPV A;  4YV8 A;  2XU3 A;  4RY2 A;  3U8E A;  1STF E;  4YYU A;  2G8E A;  5EGW A;  4AXM A;  3IOQ A;  4FJC A;  2DZZ A;  4WA6 A;  1ME4 A;  2XU1 A;  2ARY A;  1F2B A;  1PPD A;  3WXF A;  2NQI A;  1F2A A;  1BP4 A;  3PDF A;  3QJ3 A;  2P7U A;  2P86 A;  3AI8 A;  1MEM A;  2AYN A;  3N3G A;  1EWO A;  4W5C A;  1PXV A;  3DF0 A;  1AYU A;  2F1G A;  1GCB A;  2FYE A;  2OP3 A;  2HH5 A;  3BWK A;  2R9N A;  2BDZ A;  3QT4 A;  1QXP A;  2G8J A;  2O6X A;  4FIP A;  1NB5 A;  1GMY A;  3M99 A;  2XU5 A;  4YYW A;  3KSE A;  3RVX A;  2F7D A;  4QBB A;  4PI3 A;  1O0E A;  2DCD A;  3KWB X;  1CQD A;  3E1Z B;  1EWL A;  3CBJ A;  3KKU A;  1ICF A;  4QRV A;  3LXS A;  2PNS A;  3P5W A;  2JQF R;  2IPP B;  5K16 A;  2ACT A;  3IV2 A;  1A6R A;  1CTE A;  2E02 A;  3H7D A;  2G6D A;  5CVM A;  2E01 A;  4Q8G A;  4BSQ A;  2XU4 A;  5J94 A;  1CV8 A;  3OIS A;  2AUZ A;  1EWP A;  4X6I A;  1YAL A;  1KFU L;  3OVZ A;  4N4Z A;  3K8U A;  3BPM A;  4BQV A;  2AYO A;  2OZ2 A;  2YJC A;  1DEU A;  2VHS A;  3OVX A;  1AU4 A;  3MTN A;  1BY8 A;  2DC7 A;  3BPF A;  3GCB A;  3RVV A;  4XUI A;  1U9X A;  3K24 A;  3CBK A;  2VHF A;  3TNX A;  2DCB A;  1M6D A;  3BCN A;  1GLO A;  2NQG A;  1U5I A;  4YYR A;  5JA7 A;  3H89 A;  1PPP A;  4G54 A;  2PAD A;  3V6E A;  1YT7 A;  1PPO A;  4K7C A;  3IMA A;  1PAD A;  2FO5 A;  4P6G A;  3IHP A;  1NL6 A;  1U9V A;  1POP A;  1QOL A;  1NLJ A;  2YJ8 A;  1F2C A;  1EF7 A;  2H7J A;  3CH3 X;  3D6S A;  3PW3 A;  1EWM A;  4QRX A;  3USV A;  1AIM A;  2B1M A;  1U9W A;  4OEM A;  4MSX A;  5CVN B;  2GFO A;  2E00 A;  2R6N A;  2NQD B;  3HD3 A;  4W5B A;  3RVW A;  4DMY A;  1AYW A;  4N8W A;  1JQP A;  1HUC B;  3WXE A;  3BC3 A;  1PBH A;  2AIM A;  4ZUX U;  1DF0 A;  2DZY A;  4HWY A;  2P0R A;  5CHT A;  2CIO A;  2IBI A;  3KX1 A;  2FRQ A;  2YJ2 A;  3F75 A;  2AS8 A;  2FRA A;  3V6C A;  3H8C A;  4CDF B;  9PAP A;  4YYS A;  2BDL A;  4W4U A;  2R9M A;  1NQC A;  3I3T A;  1VSN A;  5CHV A;  1QDQ A;  2CB5 A;  4I07 A;  1AU3 A;  4BS5 A; 
#chains in the Genus database with same CATH topology
 3PRP A;  8PCH A;  2AVW A;  4CDE B;  2DCC A;  2R9C A;  4PP1 A;  4X6H A;  1PCI A;  1Y08 A;  4YVA A;  1AEC A;  1CJL A;  4XZX A;  1XKG A;  3HHI A;  2AUX A;  2PBH A;  2B1N A;  3WXG A;  3OF8 A;  3ZUA A;  2AU1 A;  2JQG R;  4PT5 A;  2YJ9 A;  3S3Q A;  4RKX A;  2BTW B;  3TMP A;  2Y5B A;  2YJB A;  3PHU A;  3S3R A;  4D8B A;  1SP4 B;  4PP2 E;  2G7Y A;  3OF9 A;  1ZIV A;  1K3B B;  4BOP A;  2HXZ A;  3NHE A;  3KW9 A;  4N79 A;  1CSB B;  1UKF A;  3KWZ A;  1F29 A;  1ITO A;  3N4C A;  1KHQ A;  4XR7 A;  3PHW A;  2FT2 A;  3ERV A;  4YYQ A;  1U9Q X;  4DMX A;  4WUR A;  1PE6 A;  2DC9 A;  3MP2 A;  4BS6 A;  1KFX L;  2DJG B;  1MDW A;  2HD5 A;  1X9Y A;  3BY4 A;  1GEC E;  3N3K A;  1CB5 A;  3PNR A;  4FK5 A;  2ATO A;  1AU2 A;  1ATK A;  4BOS A;  4PAD A;  4CDD B;  3HHA A;  3F5V A;  1Q6K A;  1ME3 A;  3RNV A;  1KHP A;  1BQI A;  1VJV A;  3H8B A;  3K9M A;  4I05 A;  3LFY A;  5FPW A;  5JZE A;  4BOQ A;  1SNK A;  1YK8 A;  2FTD A;  7PCK A;  5F02 A;  1CS8 A;  2FUD A;  1FH0 A;  4CZW A;  3MJ5 A;  4KLB A;  4QH6 A;  1AU0 A;  3P5V A;  1CPJ A;  3HWN A;  5EF4 A;  1TU6 A;  6PAD A;  2R9F A;  1YVB A;  1AYV A;  4IUM A;  3I06 A;  3B79 A;  1PPN A;  1YK7 A;  3CH2 X;  1NPZ A;  3MOR A;  3E9S A;  5A24 A;  4QRG A;  1QMY A;  3MHH A;  3W30 A;  1CVZ A;  4MZO A;  2NQA A;  1MIR A;  3PBH A;  2GHU A;  2WBF X;  3O65 A;  4I04 A;  3MHS A;  2OUL A;  1IWD A;  4AXL A;  1THE A;  1TLO A;  2PRE A;  3IEJ A;  4Q8H A;  2R9O A;  2C0Y A;  3KFQ A;  5CVO B;  2DC8 A;  4GUA A;  1PIP A;  3P5X A;  4HXD B;  1ZCM A;  1BGO A;  2DC6 A;  2DJF B;  1Y4H A;  3H6S A;  4A5U A;  1MHW A;  2HHN A;  2Y6E A;  3QSD A;  4MZS A;  1KXR A;  1MS6 A;  1TL9 A;  4OEL A;  3IUT A;  2FQ9 A;  1NB3 A;  5JH3 A;  3P5U A;  3BOW A;  3O0U A;  4YYV A;  4X6J A;  2DCA A;  1S4V A;  4CDC B;  2E03 A;  3C9E A;  3O1G A;  5PAD A;  1MEG A;  4P6E A;  4BPV A;  4YV8 A;  2XU3 A;  4RY2 A;  3U8E A;  1STF E;  4YYU A;  2G8E A;  5EGW A;  4AXM A;  3IOQ A;  4FJC A;  2Z84 A;  2DZZ A;  4WA6 A;  1ME4 A;  2XU1 A;  2ARY A;  1F2B A;  1PPD A;  2JTC A;  3WXF A;  2NQI A;  2J7Q A;  1F2A A;  1BP4 A;  3PT2 A;  3PDF A;  3QJ3 A;  2P7U A;  3BBA A;  2P86 A;  3AI8 A;  1MEM A;  2AYN A;  2BU3 A;  3N3G A;  1EWO A;  2JRI A;  4W5C A;  1PXV A;  3DF0 A;  1AYU A;  2F1G A;  2UZJ A;  1GCB A;  2FYE A;  2OP3 A;  2HH5 A;  3BWK A;  2R9N A;  2BDZ A;  3QT4 A;  4IP3 A;  1QXP A;  4R3D A;  2G8J A;  2O6X A;  4FIP A;  1NB5 A;  1GMY A;  4RNA A;  3M99 A;  2XU5 A;  4YYW A;  3KSE A;  2J7Q C;  3MTV A;  3RVX A;  2F7D A;  4QBB A;  4PI3 A;  1O0E A;  2DCD A;  3IFU A;  4BOU A;  3KWB X;  1CQD A;  3E1Z B;  1EWL A;  3CBJ A;  4P16 A;  3KKU A;  1ICF A;  2DOS A;  4QRV A;  3LXS A;  2PNS A;  3P5W A;  2JQF R;  2IPP B;  5K16 A;  2ACT A;  3IV2 A;  1A6R A;  1CTE A;  2E02 A;  3H7D A;  2G6D A;  5CVM A;  2E01 A;  4Q8G A;  4BSQ A;  5KO3 A;  2XU4 A;  4REZ A;  5E6J A;  5J94 A;  1CV8 A;  3OIS A;  2AUZ A;  1EWP A;  4RF1 A;  4X6I A;  1YAL A;  4ZTB A;  1KFU L;  3OVZ A;  4N4Z A;  3K8U A;  3BPM A;  4RF0 A;  4BQV A;  2AYO A;  2OZ2 A;  2YJC A;  1DEU A;  2VHS A;  4D8E A;  3OVX A;  1AU4 A;  3MTN A;  1BY8 A;  2DC7 A;  3C0R A;  3BPF A;  4OW0 A;  3GCB A;  3RVV A;  4XUI A;  1U9X A;  3ZNH A;  3K24 A;  3CBK A;  2VHF A;  3TNX A;  2DCB A;  1M6D A;  3BCN A;  1GLO A;  2BTW A;  2NQG A;  3W31 A;  1U5I A;  4YYR A;  4MM3 B;  3PRM A;  5JA7 A;  3H89 A;  1PPP A;  4G54 A;  2PAD A;  3V6E A;  1YT7 A;  1PPO A;  4K7C A;  3IMA A;  1PAD A;  2FO5 A;  4D8I A;  4P6G A;  3IHP A;  1NL6 A;  1U9V A;  1POP A;  1PVJ A;  1QOL A;  1NLJ A;  2YJ8 A;  2FE8 A;  1F2C A;  1EF7 A;  2H7J A;  3CH3 X;  3D6S A;  3PW3 A;  1EWM A;  4QRX A;  3USV A;  1AIM A;  2B1M A;  3PSE A;  3TRK A;  1U9W A;  4OEM A;  4MSX A;  5CVN B;  3PHX A;  2GFO A;  2E00 A;  2R6N A;  3B21 A;  2NQD B;  2HWK A;  3HD3 A;  4W5B A;  3RVW A;  4DMY A;  1AYW A;  4N8W A;  1JQP A;  1HUC B;  3WXE A;  3BC3 A;  3OQC A;  1PBH A;  2AIM A;  1DKI A;  4ZUX U;  1DF0 A;  2DZY A;  4HWY A;  2P0R A;  5CHT A;  2CIO A;  2AGA A;  2IBI A;  3KX1 A;  2FRQ A;  2YJ2 A;  3F75 A;  2AS8 A;  2FRA A;  3V6C A;  3H8C A;  4CDF B;  9PAP A;  4YYS A;  2BDL A;  4W4U A;  2R9M A;  1NQC A;  4MI7 A;  3BB7 A;  3I3T A;  4M0W A;  1VSN A;  5CHV A;  1YZB A;  5EZQ A;  4BOZ A;  1QDQ A;  2CB5 A;  5EZS A;  4I07 A;  4OVZ B;  1AU3 A;  4OVZ A;  4BS5 A; 
#chains in the Genus database with same CATH homology
 8PCH A;  2AVW A;  4CDE B;  2DCC A;  3D9W A;  2R9C A;  4PP1 A;  4X6H A;  1PCI A;  1Y08 A;  4YVA A;  1AEC A;  1CJL A;  1XKG A;  3HHI A;  2AUX A;  2PBH A;  2B1N A;  3WXG A;  4NV8 A;  3OF8 A;  3ZUA A;  2AU1 A;  2JQG R;  2YJ9 A;  3S3Q A;  1E2T A;  2Y5B A;  2YJB A;  3S3R A;  1SP4 B;  4PP2 E;  2G7Y A;  3OF9 A;  1ZIV A;  1K3B B;  2VFB A;  2HXZ A;  3NHE A;  3KW9 A;  4N79 A;  1CSB B;  3KWZ A;  1F29 A;  1ITO A;  3N4C A;  1KHQ A;  4XR7 A;  2FT2 A;  3ERV A;  4YYQ A;  1U9Q X;  4DMX A;  1PE6 A;  2DC9 A;  4BS6 A;  1KFX L;  2DJG B;  1MDW A;  2HD5 A;  1X9Y A;  3N3K A;  1GEC E;  1CB5 A;  3PNR A;  4FK5 A;  2ATO A;  1AU2 A;  1ATK A;  4CDD B;  4PAD A;  3HHA A;  3F5V A;  1Q6K A;  1ME3 A;  1KHP A;  1BQI A;  1VJV A;  3H8B A;  3K9M A;  4I05 A;  3LFY A;  5FPW A;  1SNK A;  1YK8 A;  2FTD A;  7PCK A;  5F02 A;  1CS8 A;  2FUD A;  1FH0 A;  4CZW A;  4KLB A;  4QH6 A;  1AU0 A;  3P5V A;  1CPJ A;  3HWN A;  4BGF A;  2BSZ A;  5EF4 A;  1TU6 A;  6PAD A;  2R9F A;  1YVB A;  1AYV A;  3I06 A;  3B79 A;  1PPN A;  1YK7 A;  3CH2 X;  1NPZ A;  3MOR A;  5A24 A;  4QRG A;  1QMY A;  3MHH A;  1CVZ A;  4MZO A;  2NQA A;  1MIR A;  3PBH A;  2GHU A;  2WBF X;  4GUZ A;  4I04 A;  3MHS A;  2OUL A;  1IWD A;  4AXL A;  1THE A;  1TLO A;  2PRE A;  3IEJ A;  4Q8H A;  2R9O A;  1GX3 A;  2C0Y A;  3KFQ A;  5CVO B;  2DC8 A;  1PIP A;  3P5X A;  1ZCM A;  1BGO A;  4B55 A;  2DC6 A;  2DJF B;  1Y4H A;  3H6S A;  1MHW A;  2HHN A;  2Y6E A;  3QSD A;  4MZS A;  1KXR A;  1MS6 A;  1TL9 A;  4OEL A;  3IUT A;  2FQ9 A;  1NB3 A;  5JH3 A;  3P5U A;  3BOW A;  3O0U A;  4YYV A;  4X6J A;  2VFC A;  2DCA A;  1S4V A;  4CDC B;  2E03 A;  3C9E A;  3O1G A;  5PAD A;  1MEG A;  4P6E A;  4BPV A;  4YV8 A;  2XU3 A;  4RY2 A;  3U8E A;  1STF E;  4YYU A;  2G8E A;  5EGW A;  4AXM A;  3IOQ A;  4FJC A;  2DZZ A;  4WA6 A;  1ME4 A;  2XU1 A;  2ARY A;  1F2B A;  1PPD A;  3WXF A;  2NQI A;  1F2A A;  1BP4 A;  1W6F A;  3PDF A;  3QJ3 A;  2P7U A;  2P86 A;  3AI8 A;  1MEM A;  2AYN A;  3N3G A;  1EWO A;  4W5C A;  1PXV A;  3DF0 A;  1AYU A;  2F1G A;  1GCB A;  2FYE A;  2OP3 A;  2HH5 A;  3BWK A;  2R9N A;  2BDZ A;  3QT4 A;  1QXP A;  2G8J A;  2O6X A;  4FIP A;  1NB5 A;  1GMY A;  3M99 A;  2XU5 A;  4YYW A;  3KSE A;  3RVX A;  3LTW A;  2F7D A;  4QBB A;  4PI3 A;  1O0E A;  2DCD A;  3KWB X;  1CQD A;  3E1Z B;  1EWL A;  3CBJ A;  1W5R A;  3KKU A;  1ICF A;  4QRV A;  3LXS A;  2PNS A;  3P5W A;  2JQF R;  2IPP B;  5K16 A;  2ACT A;  3IV2 A;  1A6R A;  1CTE A;  2E02 A;  3H7D A;  2G6D A;  5CVM A;  2E01 A;  4Q8G A;  4BSQ A;  2XU4 A;  5J94 A;  1CV8 A;  3OIS A;  2AUZ A;  1EWP A;  4X6I A;  1YAL A;  1KFU L;  3OVZ A;  4C5P A;  4N4Z A;  3K8U A;  3BPM A;  4BQV A;  2AYO A;  2OZ2 A;  2YJC A;  1DEU A;  2VHS A;  3OVX A;  1AU4 A;  3MTN A;  1BY8 A;  2DC7 A;  1W4T A;  3BPF A;  3GCB A;  3RVV A;  4XUI A;  1U9X A;  3K24 A;  3CBK A;  2VHF A;  3TNX A;  2DCB A;  1M6D A;  3BCN A;  1GLO A;  2NQG A;  1U5I A;  4YYR A;  5JA7 A;  3H89 A;  1PPP A;  4G54 A;  2PAD A;  3V6E A;  1YT7 A;  1PPO A;  4K7C A;  3IMA A;  1PAD A;  2FO5 A;  4P6G A;  3IHP A;  1NL6 A;  1U9V A;  1POP A;  1QOL A;  1NLJ A;  2YJ8 A;  1F2C A;  1EF7 A;  2H7J A;  3CH3 X;  3D6S A;  3PW3 A;  1EWM A;  4QRX A;  3USV A;  1AIM A;  2B1M A;  1U9W A;  4OEM A;  4MSX A;  5CVN B;  2GFO A;  2E00 A;  2R6N A;  2NQD B;  3HD3 A;  4W5B A;  3RVW A;  4DMY A;  1AYW A;  4N8W A;  1JQP A;  1HUC B;  3WXE A;  3BC3 A;  1PBH A;  2AIM A;  4ZUX U;  1DF0 A;  2DZY A;  4HWY A;  2P0R A;  5CHT A;  2CIO A;  2IBI A;  3KX1 A;  2FRQ A;  2YJ2 A;  3F75 A;  2AS8 A;  2FRA A;  3V6C A;  3H8C A;  4NV7 A;  4CDF B;  9PAP A;  4YYS A;  2BDL A;  4W4U A;  2R9M A;  1NQC A;  3I3T A;  1VSN A;  5CHV A;  1QDQ A;  2CB5 A;  4I07 A;  1AU3 A;  4BS5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...