3IOQA

Crystal structure of the carica candamarcensis cysteine protease cms1ms2 in complex with e-64.
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
213
structure length
213
Chain Sequence
IPTSIDWRQKGAVTPVRNQGGCGSCWTFSSVAAVEGINKIVTGQLLSLSEQELLDCERRSYGCRGGFPLYALQYVANSGIHLRQYYPYEGVQRQCRASQAKGPKVKTDGVGRVPRNNEQALIQRIAIQPVSIVVEAKGRAFQNYRGGIFAGPCGTSIDHAVAAVGYGNDYILIKNSWGTGWGEGGYIRIKRGSGNPQGACGVLSDSVFPTKNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the Carica candamarcensis cysteine protease CMS1MS2 in complex with E-64
rcsb
molecule tags Hydrolase
molecule keywords CMS1MS2
total genus 65
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 2009-08-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3ioqA00
1POPA 3CBKA 3HHIA 3BOWA 3V6CA 7PCKA 8PCHA 2FTDA 5JH3A 4I07A 2VHFA 1ME4A 2IPPB 2AUZA 1CJLA 2G8EA 1CPJA 2Y5BA 1CV8A 1STFE 4AXLA 2PNSA 2R9FA 3OVZA 2P0RA 4FK5A 1ATKA 1U5IA 2YJBA 2YJ9A 3MHSA 1KHQA 3IV2A 3GCBA 1AU3A 3KFQA 1F2AA 1ME3A 4PP1A 1MEMA 1GLOA 2OP3A 3H7DA 3OF9A 1CTEA 1EWLA 1THEA 1QDQA 3F75A 3O1GA 2AU1A 3KKUA 1QOLA 4N8WA 4CDCB 1PBHA 3KWZA 3S3RA 3O0UA 4I04A 3BWKA 4P6EA 5EGWA 3N3GA 3KSEA 3IEJA 4OELA 5JA7A 1BP4A 2AIMA 2HXZA 3AI8A 1NB5A 3KW9A 3B79A 1Q6KA 1PPOA 4OEMA 1YK7A 1PADA 3TNXA 2DC8A 4N79A 1U9XA 3K24A 4YYQA 3HD3A 4W5BA 3BC3A 5CHVA 4RY2A 3KWBX 4CDDB 3CH3X 3LXSA 3BPFA 1BGOA 4G54A 4XR7A 4ZUXU 1AECA 5CVOB 1QXPA 4Q8HA 1ZIVA 4YYRA 3BPMA 1YVBA 1GECE 4CDEB 4X6HA 1MDWA 3IHPA 3I3TA 1KFXL 2AS8A 1Y08A 4YYVA 4K7CA 4QRGA 1O0EA 2AUXA 3P5UA 3H8CA 1CS8A 1KHPA 3QT4A 1X9YA 1PPDA 1PPPA 2E00A 1NPZA 3QSDA 4X6JA 1F29A 6PADA 1MIRA 2H7JA 2DCAA 2DJFB 4PP2E 3KX1A 2P7UA 3N3KA 3S3QA 3QJ3A 1ITOA 2VHSA 1PE6A 1CSBB 1EF7A 1K3BB 1NL6A 3D6SA 2E03A 1AIMA 2BDLA 2CB5A 4QBBA 3H8BA 1Y4HA 2WBFX 4BSQA 3MHHA 3LFYA 1PXVA 2AVWA 3WXEA 3ZUAA 4QRXA 1AU0A 4YYSA 1JQPA 1VSNA 3IUTA 3P5WA 2DZYA 2GHUA 4N4ZA 4DMXA 1NLJA 2AYNA 2R9NA 3OF8A 1CVZA 3V6EA 4DMYA 1U9QX 2O6XA 4YVAA 4BS6A 3PW3A 3K9MA 3MTNA 4YYUA 2DZZA 1YALA 1MEGA 3H89A 3P5XA 1KXRA 1SNKA 2GFOA 1CQDA 1U9VA 3DF0A 4KLBA 9PAPA 4PI3A 4W5CA 5EF4A 2Y6EA 4FIPA 4YV8A 3N4CA 3USVA 5FPWA 2DCCA 2HHNA 3K8UA 2DCBA 3PNRA 3WXFA 1MS6A 3RVVA 4YYWA 2DC9A 2XU1A 1IWDA 2JQGR 1AYWA 2F7DA 4HWYA 1AU2A 5F02A 1S4VA 2NQDB 3P5VA 2DJGB 2NQGA 4WA6A 2G6DA 3F5VA 2B1NA 2R6NA 5CHTA 2JQFR 1PIPA 2HH5A 2FQ9A 2OULA 1CB5A 2PADA 3NHEA 3ERVA 1KFUL 4BPVA 5K16A 4CZWA 3RVWA 1F2CA 2FO5A 4PADA 3HWNA 1EWPA 2NQAA 3WXGA 4MZOA 2G7YA 2YJ2A 3IMAA 3BCNA 3H6SA 3HHAA 1AU4A 1NQCA 3MORA 5A24A 1FH0A 4X6IA 1HUCB 1U9WA 2R9OA 3RVXA 2IBIA 4FJCA 3U8EA 1M6DA 3PDFA 1F2BA 2FUDA 3C9EA 1BQIA 1MHWA 1NB3A 3OVXA 1VJVA 3E1ZB 2FT2A 2YJ8A 2FRQA 4W4UA 2E01A 4AXMA 2DC6A 2YJCA 1QMYA 2P86A 1EWOA 1TLOA 1ICFA 1SP4B 1YT7A 2XU5A 5PADA 2C0YA 2BDZA 2FRAA 2NQIA 4QH6A 2DCDA 2G8JA 4BQVA 1TL9A 4MSXA 5J94A 1BY8A 3I06A 3IOQA 4Q8GA 1TU6A 3CH2X 2B1MA 1ZCMA 4MZSA 1PCIA 2PBHA 2R9MA 2FYEA 2ATOA 4QRVA 4CDFB 1EWMA 1XKGA 5CVMA 2XU4A 2F1GA 1DEUA 1A6RA 3M99A 1AYUA 2CIOA 2ACTA 2DC7A 1GMYA 1AYVA 4I05A 4P6GA 2HD5A 1YK8A 4XUIA 2XU3A 3PBHA 2PREA 3OISA 5CVNB 1GCBA 4BS5A 2E02A 2R9CA 2AYOA 2ARYA 1DF0A 2OZ2A 1PPNA 3CBJA
chains in the Genus database with same CATH superfamily
4RF0A 3PHXA 1POPA 3CBKA 3HHIA 3BOWA 3V6CA 7PCKA 8PCHA 2FTDA 3MP2A 5JH3A 4I07A 2VHFA 1ME4A 2IPPB 2AUZA 1CJLA 2G8EA 1CPJA 2Y5BA 1CV8A 1STFE 4AXLA 2PNSA 2R9FA 3OVZA 2P0RA 4FK5A 4OVZA 4BOSA 1ATKA 1U5IA 4XZXA 2YJBA 2YJ9A 3MHSA 3BBAA 1KHQA 3IV2A 3GCBA 1AU3A 3KFQA 1F2AA 1ME3A 3C0RA 4BOQA 4PP1A 1MEMA 3PHUA 1GLOA 2OP3A 3H7DA 3OF9A 1CTEA 1EWLA 1THEA 1QDQA 3F75A 3O1GA 2AU1A 3KKUA 1QOLA 4N8WA 4CDCB 1PBHA 3KWZA 3S3RA 2UZJA 3O0UA 4I04A 3BWKA 4P6EA 5EGWA 3N3GA 4ZTBA 3KSEA 3IEJA 1UKFA 4OELA 5JA7A 1BP4A 2AIMA 2HXZA 3AI8A 1NB5A 3KW9A 3TMPA 3B79A 1Q6KA 5JZEA 1PPOA 4OEMA 1YK7A 1PADA 3TNXA 2JRIA 2DC8A 4N79A 1U9XA 3E9SA 3K24A 4BOPA 4YYQA 3HD3A 4PT5A 4W5BA 3BC3A 5CHVA 4RY2A 3KWBX 4CDDB 3CH3X 3LXSA 3BPFA 1BGOA 3PSEA 4BOZA 4G54A 4XR7A 4ZUXU 1AECA 5CVOB 1QXPA 4Q8HA 1ZIVA 4YYRA 5E6JA 3BPMA 1YVBA 4D8BA 1GECE 2FE8A 4CDEB 4X6HA 1MDWA 3IHPA 3I3TA 1KFXL 3O65A 2AS8A 1Y08A 4YYVA 4K7CA 4QRGA 3PT2A 1O0EA 2AUXA 3P5UA 3H8CA 1CS8A 1KHPA 3QT4A 1X9YA 2JTCA 3W30A 1PPDA 1PPPA 2E00A 1NPZA 3QSDA 4X6JA 1F29A 6PADA 1MIRA 2H7JA 2DCAA 2DJFB 4PP2E 3KX1A 2P7UA 3N3KA 3S3QA 3QJ3A 1ITOA 2VHSA 3BB7A 1PE6A 1CSBB 1EF7A 1K3BB 1NL6A 3D6SA 2E03A 1AIMA 3ZNHA 2BDLA 2CB5A 4QBBA 3H8BA 1Y4HA 2WBFX 4OW0A 4BSQA 3MHHA 3PHWA 3LFYA 1PXVA 2AVWA 3WXEA 3ZUAA 3PRPA 4QRXA 1AU0A 4YYSA 3PRMA 1JQPA 5EZSA 1VSNA 3IUTA 3P5WA 2DZYA 2GHUA 4N4ZA 4DMXA 1NLJA 2AYNA 2R9NA 3OF8A 2Z84A 1CVZA 4MM3B 3V6EA 4DMYA 1U9QX 2O6XA 4YVAA 4BS6A 3PW3A 3K9MA 3MTNA 4YYUA 2DZZA 1YALA 1MEGA 3H89A 3P5XA 1KXRA 1SNKA 2GFOA 1CQDA 1U9VA 3DF0A 4KLBA 9PAPA 3OQCA 4PI3A 4W5CA 5EF4A 2Y6EA 4FIPA 4YV8A 3N4CA 3USVA 3B21A 2DCCA 5FPWA 2HHNA 4IP3A 3K8UA 4HXDB 2HWKA 5KO3A 3W31A 2DCBA 3PNRA 4R3DA 4RF1A 3WXFA 1MS6A 3RVVA 4YYWA 2DC9A 2XU1A 1IWDA 2JQGR 1AYWA 2F7DA 4HWYA 1AU2A 5F02A 1S4VA 2NQDB 4OVZB 3P5VA 2DJGB 2NQGA 4WA6A 4WURA 2G6DA 3F5VA 2B1NA 2R6NA 4MI7A 2JQFR 5CHTA 1PIPA 2HH5A 2FQ9A 2OULA 1CB5A 2PADA 3NHEA 4A5UA 3ERVA 1KFUL 4BPVA 5K16A 4CZWA 3BY4A 3RVWA 1F2CA 2FO5A 4REZA 4D8EA 4PADA 4GUAA 1DKIA 3HWNA 1EWPA 2NQAA 3TRKA 3WXGA 4MZOA 2G7YA 2YJ2A 4M0WA 3IMAA 3BCNA 3H6SA 3HHAA 1AU4A 1NQCA 3MORA 5A24A 1FH0A 4IUMA 4X6IA 1HUCB 1U9WA 2R9OA 3RVXA 2IBIA 4FJCA 3U8EA 1M6DA 4RKXA 3PDFA 1F2BA 2FUDA 3C9EA 1BQIA 1MHWA 1NB3A 3OVXA 1VJVA 3E1ZB 2FT2A 4RNAA 2YJ8A 2FRQA 4W4UA 2E01A 4AXMA 4BOUA 2DC6A 2YJCA 1QMYA 2P86A 1EWOA 1TLOA 1PVJA 1ICFA 1SP4B 1YT7A 2XU5A 5PADA 1YZBA 5EZQA 2C0YA 2BDZA 2FRAA 2NQIA 3IFUA 4QH6A 2DCDA 2G8JA 4BQVA 1TL9A 4MSXA 5J94A 1BY8A 3I06A 2AGAA 3IOQA 4Q8GA 3MJ5A 1TU6A 3CH2X 2B1MA 1ZCMA 4MZSA 2J7QC 1PCIA 2PBHA 2R9MA 2FYEA 2ATOA 4QRVA 4CDFB 1EWMA 2J7QA 1XKGA 5CVMA 2XU4A 2F1GA 1DEUA 1A6RA 3M99A 2BTWB 3RNVA 4P16A 1AYUA 2CIOA 2ACTA 2DC7A 3MTVA 2BU3A 1GMYA 1AYVA 4I05A 4P6GA 2HD5A 1YK8A 4XUIA 4D8IA 2BTWA 2XU3A 3PBHA 2PREA 3OISA 5CVNB 1GCBA 4BS5A 2E02A 2R9CA 2AYOA 2ARYA 2DOSA 1DF0A 2OZ2A 1PPNA 3CBJA
chains in the Genus database with same CATH topology
1POPA 3CBKA 3HHIA 3BOWA 3V6CA 7PCKA 8PCHA 2FTDA 5JH3A 4I07A 2VHFA 1ME4A 2IPPB 2AUZA 1CJLA 2G8EA 1CPJA 2Y5BA 1CV8A 1STFE 4AXLA 2PNSA 2R9FA 3OVZA 2P0RA 4FK5A 1ATKA 1U5IA 2YJBA 2YJ9A 3MHSA 1KHQA 3IV2A 3GCBA 1AU3A 3KFQA 1F2AA 1W6FA 1ME3A 4PP1A 1MEMA 1GLOA 2OP3A 3H7DA 3OF9A 1CTEA 1EWLA 1THEA 1QDQA 3F75A 3O1GA 2AU1A 3KKUA 1QOLA 4N8WA 4CDCB 1PBHA 3KWZA 3S3RA 3O0UA 4B55A 4I04A 3BWKA 4P6EA 5EGWA 3N3GA 3KSEA 3IEJA 1W5RA 4OELA 5JA7A 1BP4A 2AIMA 2HXZA 3AI8A 1NB5A 3KW9A 3B79A 1Q6KA 1PPOA 4OEMA 1YK7A 1PADA 3TNXA 2DC8A 4N79A 1U9XA 2BSZA 2VFCA 3K24A 4YYQA 3HD3A 4W5BA 3BC3A 5CHVA 4RY2A 3KWBX 4CDDB 3CH3X 4C5PA 3LXSA 3BPFA 1BGOA 4G54A 4XR7A 4ZUXU 1AECA 5CVOB 1QXPA 4Q8HA 1ZIVA 4YYRA 3BPMA 1YVBA 1GECE 4CDEB 4X6HA 1MDWA 3IHPA 3I3TA 1KFXL 2AS8A 1Y08A 4YYVA 4K7CA 4QRGA 1O0EA 2AUXA 3P5UA 3H8CA 1CS8A 1KHPA 3QT4A 1X9YA 1PPDA 1PPPA 2E00A 1NPZA 3QSDA 4X6JA 1F29A 6PADA 1MIRA 2H7JA 2DCAA 2DJFB 4PP2E 3KX1A 2P7UA 3N3KA 3S3QA 3QJ3A 1ITOA 2VHSA 1PE6A 1CSBB 1EF7A 1K3BB 1NL6A 3D6SA 2E03A 1AIMA 2BDLA 2CB5A 4QBBA 3H8BA 3D9WA 1Y4HA 2WBFX 4BSQA 3MHHA 3LFYA 1PXVA 2AVWA 3WXEA 3ZUAA 4QRXA 1AU0A 4YYSA 1JQPA 1VSNA 3IUTA 3P5WA 2DZYA 2GHUA 4N4ZA 4DMXA 1NLJA 2AYNA 2R9NA 3OF8A 1CVZA 2VFBA 3V6EA 4DMYA 1U9QX 2O6XA 4YVAA 4BS6A 3PW3A 3K9MA 3MTNA 4YYUA 2DZZA 1YALA 1MEGA 3H89A 3P5XA 1KXRA 1SNKA 2GFOA 1CQDA 1U9VA 3DF0A 4KLBA 9PAPA 4PI3A 4W5CA 5EF4A 2Y6EA 4FIPA 4YV8A 3N4CA 3USVA 5FPWA 2DCCA 2HHNA 3K8UA 2DCBA 3PNRA 3WXFA 1MS6A 3RVVA 4YYWA 2DC9A 2XU1A 1IWDA 2JQGR 1AYWA 2F7DA 4HWYA 1AU2A 5F02A 1S4VA 2NQDB 1PPNA 3P5VA 2DJGB 2NQGA 4WA6A 2G6DA 3F5VA 2B1NA 2R6NA 5CHTA 2JQFR 1PIPA 2HH5A 2FQ9A 2OULA 1CB5A 2PADA 3NHEA 3ERVA 1KFUL 1E2TA 4GUZA 5K16A 4BPVA 4CZWA 3RVWA 1F2CA 2FO5A 4PADA 3HWNA 1EWPA 2NQAA 3WXGA 4NV7A 4MZOA 2G7YA 2YJ2A 3IMAA 3LTWA 3BCNA 3H6SA 3HHAA 1AU4A 1NQCA 3MORA 5A24A 1FH0A 4X6IA 1HUCB 1U9WA 2R9OA 3RVXA 2IBIA 4FJCA 3U8EA 1M6DA 3PDFA 1F2BA 2FUDA 3C9EA 1BQIA 1MHWA 1NB3A 3OVXA 1VJVA 3E1ZB 2FT2A 2YJ8A 2FRQA 4W4UA 2E01A 4AXMA 2DC6A 2YJCA 1QMYA 2P86A 1EWOA 1TLOA 1ICFA 1SP4B 1YT7A 2XU5A 5PADA 2C0YA 2BDZA 2FRAA 2NQIA 4QH6A 1W4TA 2DCDA 2G8JA 4BQVA 1TL9A 4MSXA 5J94A 1BY8A 3I06A 3IOQA 4Q8GA 1TU6A 4NV8A 3CH2X 2B1MA 1ZCMA 4MZSA 1PCIA 4BGFA 2PBHA 2R9MA 2FYEA 2ATOA 4QRVA 4CDFB 1EWMA 1XKGA 5CVMA 2XU4A 2F1GA 1DEUA 1A6RA 3M99A 1AYUA 2CIOA 2ACTA 2DC7A 1GMYA 1AYVA 4I05A 4P6GA 2HD5A 1YK8A 4XUIA 2XU3A 3PBHA 2PREA 3OISA 5CVNB 1GCBA 4BS5A 2E02A 2R9CA 2AYOA 2ARYA 1DF0A 2OZ2A 1GX3A 3CBJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1POP A;  3CBK A;  3HHI A;  3BOW A;  3V6C A;  7PCK A;  8PCH A;  2FTD A;  5JH3 A;  4I07 A;  2VHF A;  1ME4 A;  2IPP B;  2AUZ A;  1CJL A;  2G8E A;  1CPJ A;  2Y5B A;  1CV8 A;  1STF E;  4AXL A;  2PNS A;  2R9F A;  3OVZ A;  2P0R A;  4FK5 A;  1ATK A;  1U5I A;  2YJB A;  2YJ9 A;  3MHS A;  1KHQ A;  3IV2 A;  3GCB A;  1AU3 A;  3KFQ A;  1F2A A;  1ME3 A;  4PP1 A;  1MEM A;  1GLO A;  2OP3 A;  3H7D A;  3OF9 A;  1CTE A;  1EWL A;  1THE A;  1QDQ A;  3F75 A;  3O1G A;  2AU1 A;  3KKU A;  1QOL A;  4N8W A;  4CDC B;  1PBH A;  3KWZ A;  3S3R A;  3O0U A;  4I04 A;  3BWK A;  4P6E A;  5EGW A;  3N3G A;  3KSE A;  3IEJ A;  4OEL A;  5JA7 A;  1BP4 A;  2AIM A;  2HXZ A;  3AI8 A;  1NB5 A;  3KW9 A;  3B79 A;  1Q6K A;  1PPO A;  4OEM A;  1YK7 A;  1PAD A;  3TNX A;  2DC8 A;  4N79 A;  1U9X A;  3K24 A;  4YYQ A;  3HD3 A;  4W5B A;  3BC3 A;  5CHV A;  4RY2 A;  3KWB X;  4CDD B;  3CH3 X;  3LXS A;  3BPF A;  1BGO A;  4G54 A;  4XR7 A;  4ZUX U;  1AEC A;  5CVO B;  1QXP A;  4Q8H A;  1ZIV A;  4YYR A;  3BPM A;  1YVB A;  1GEC E;  4CDE B;  4X6H A;  1MDW A;  3IHP A;  3I3T A;  1KFX L;  2AS8 A;  1Y08 A;  4YYV A;  4K7C A;  4QRG A;  1O0E A;  2AUX A;  3P5U A;  3H8C A;  1CS8 A;  1KHP A;  3QT4 A;  1X9Y A;  1PPD A;  1PPP A;  2E00 A;  1NPZ A;  3QSD A;  4X6J A;  1F29 A;  6PAD A;  1MIR A;  2H7J A;  2DCA A;  2DJF B;  4PP2 E;  3KX1 A;  2P7U A;  3N3K A;  3S3Q A;  3QJ3 A;  1ITO A;  2VHS A;  1PE6 A;  1CSB B;  1EF7 A;  1K3B B;  1NL6 A;  3D6S A;  2E03 A;  1AIM A;  2BDL A;  2CB5 A;  4QBB A;  3H8B A;  1Y4H A;  2WBF X;  4BSQ A;  3MHH A;  3LFY A;  1PXV A;  2AVW A;  3WXE A;  3ZUA A;  4QRX A;  1AU0 A;  4YYS A;  1JQP A;  1VSN A;  3IUT A;  3P5W A;  2DZY A;  2GHU A;  4N4Z A;  4DMX A;  1NLJ A;  2AYN A;  2R9N A;  3OF8 A;  1CVZ A;  3V6E A;  4DMY A;  1U9Q X;  2O6X A;  4YVA A;  4BS6 A;  3PW3 A;  3K9M A;  3MTN A;  4YYU A;  2DZZ A;  1YAL A;  1MEG A;  3H89 A;  3P5X A;  1KXR A;  1SNK A;  2GFO A;  1CQD A;  1U9V A;  3DF0 A;  4KLB A;  9PAP A;  4PI3 A;  4W5C A;  5EF4 A;  2Y6E A;  4FIP A;  4YV8 A;  3N4C A;  3USV A;  5FPW A;  2DCC A;  2HHN A;  3K8U A;  2DCB A;  3PNR A;  3WXF A;  1MS6 A;  3RVV A;  4YYW A;  2DC9 A;  2XU1 A;  1IWD A;  2JQG R;  1AYW A;  2F7D A;  4HWY A;  1AU2 A;  5F02 A;  1S4V A;  2NQD B;  3P5V A;  2DJG B;  2NQG A;  4WA6 A;  2G6D A;  3F5V A;  2B1N A;  2R6N A;  5CHT A;  2JQF R;  1PIP A;  2HH5 A;  2FQ9 A;  2OUL A;  1CB5 A;  2PAD A;  3NHE A;  3ERV A;  1KFU L;  4BPV A;  5K16 A;  4CZW A;  3RVW A;  1F2C A;  2FO5 A;  4PAD A;  3HWN A;  1EWP A;  2NQA A;  3WXG A;  4MZO A;  2G7Y A;  2YJ2 A;  3IMA A;  3BCN A;  3H6S A;  3HHA A;  1AU4 A;  1NQC A;  3MOR A;  5A24 A;  1FH0 A;  4X6I A;  1HUC B;  1U9W A;  2R9O A;  3RVX A;  2IBI A;  4FJC A;  3U8E A;  1M6D A;  3PDF A;  1F2B A;  2FUD A;  3C9E A;  1BQI A;  1MHW A;  1NB3 A;  3OVX A;  1VJV A;  3E1Z B;  2FT2 A;  2YJ8 A;  2FRQ A;  4W4U A;  2E01 A;  4AXM A;  2DC6 A;  2YJC A;  1QMY A;  2P86 A;  1EWO A;  1TLO A;  1ICF A;  1SP4 B;  1YT7 A;  2XU5 A;  5PAD A;  2C0Y A;  2BDZ A;  2FRA A;  2NQI A;  4QH6 A;  2DCD A;  2G8J A;  4BQV A;  1TL9 A;  4MSX A;  5J94 A;  1BY8 A;  3I06 A;  3IOQ A;  4Q8G A;  1TU6 A;  3CH2 X;  2B1M A;  1ZCM A;  4MZS A;  1PCI A;  2PBH A;  2R9M A;  2FYE A;  2ATO A;  4QRV A;  4CDF B;  1EWM A;  1XKG A;  5CVM A;  2XU4 A;  2F1G A;  1DEU A;  1A6R A;  3M99 A;  1AYU A;  2CIO A;  2ACT A;  2DC7 A;  1GMY A;  1AYV A;  4I05 A;  4P6G A;  2HD5 A;  1YK8 A;  4XUI A;  2XU3 A;  3PBH A;  2PRE A;  3OIS A;  5CVN B;  1GCB A;  4BS5 A;  2E02 A;  2R9C A;  2AYO A;  2ARY A;  1DF0 A;  2OZ2 A;  1PPN A;  3CBJ A; 
#chains in the Genus database with same CATH topology
 4RF0 A;  3PHX A;  1POP A;  3CBK A;  3HHI A;  3BOW A;  3V6C A;  7PCK A;  8PCH A;  2FTD A;  3MP2 A;  5JH3 A;  4I07 A;  2VHF A;  1ME4 A;  2IPP B;  2AUZ A;  1CJL A;  2G8E A;  1CPJ A;  2Y5B A;  1CV8 A;  1STF E;  4AXL A;  2PNS A;  2R9F A;  3OVZ A;  2P0R A;  4FK5 A;  4OVZ A;  4BOS A;  1ATK A;  1U5I A;  4XZX A;  2YJB A;  2YJ9 A;  3MHS A;  3BBA A;  1KHQ A;  3IV2 A;  3GCB A;  1AU3 A;  3KFQ A;  1F2A A;  1ME3 A;  3C0R A;  4BOQ A;  4PP1 A;  1MEM A;  3PHU A;  1GLO A;  2OP3 A;  3H7D A;  3OF9 A;  1CTE A;  1EWL A;  1THE A;  1QDQ A;  3F75 A;  3O1G A;  2AU1 A;  3KKU A;  1QOL A;  4N8W A;  4CDC B;  1PBH A;  3KWZ A;  3S3R A;  2UZJ A;  3O0U A;  4I04 A;  3BWK A;  4P6E A;  5EGW A;  3N3G A;  4ZTB A;  3KSE A;  3IEJ A;  1UKF A;  4OEL A;  5JA7 A;  1BP4 A;  2AIM A;  2HXZ A;  3AI8 A;  1NB5 A;  3KW9 A;  3TMP A;  3B79 A;  1Q6K A;  5JZE A;  1PPO A;  4OEM A;  1YK7 A;  1PAD A;  3TNX A;  2JRI A;  2DC8 A;  4N79 A;  1U9X A;  3E9S A;  3K24 A;  4BOP A;  4YYQ A;  3HD3 A;  4PT5 A;  4W5B A;  3BC3 A;  5CHV A;  4RY2 A;  3KWB X;  4CDD B;  3CH3 X;  3LXS A;  3BPF A;  1BGO A;  3PSE A;  4BOZ A;  4G54 A;  4XR7 A;  4ZUX U;  1AEC A;  5CVO B;  1QXP A;  4Q8H A;  1ZIV A;  4YYR A;  5E6J A;  3BPM A;  1YVB A;  4D8B A;  1GEC E;  2FE8 A;  4CDE B;  4X6H A;  1MDW A;  3IHP A;  3I3T A;  1KFX L;  3O65 A;  2AS8 A;  1Y08 A;  4YYV A;  4K7C A;  4QRG A;  3PT2 A;  1O0E A;  2AUX A;  3P5U A;  3H8C A;  1CS8 A;  1KHP A;  3QT4 A;  1X9Y A;  2JTC A;  3W30 A;  1PPD A;  1PPP A;  2E00 A;  1NPZ A;  3QSD A;  4X6J A;  1F29 A;  6PAD A;  1MIR A;  2H7J A;  2DCA A;  2DJF B;  4PP2 E;  3KX1 A;  2P7U A;  3N3K A;  3S3Q A;  3QJ3 A;  1ITO A;  2VHS A;  3BB7 A;  1PE6 A;  1CSB B;  1EF7 A;  1K3B B;  1NL6 A;  3D6S A;  2E03 A;  1AIM A;  3ZNH A;  2BDL A;  2CB5 A;  4QBB A;  3H8B A;  1Y4H A;  2WBF X;  4OW0 A;  4BSQ A;  3MHH A;  3PHW A;  3LFY A;  1PXV A;  2AVW A;  3WXE A;  3ZUA A;  3PRP A;  4QRX A;  1AU0 A;  4YYS A;  3PRM A;  1JQP A;  5EZS A;  1VSN A;  3IUT A;  3P5W A;  2DZY A;  2GHU A;  4N4Z A;  4DMX A;  1NLJ A;  2AYN A;  2R9N A;  3OF8 A;  2Z84 A;  1CVZ A;  4MM3 B;  3V6E A;  4DMY A;  1U9Q X;  2O6X A;  4YVA A;  4BS6 A;  3PW3 A;  3K9M A;  3MTN A;  4YYU A;  2DZZ A;  1YAL A;  1MEG A;  3H89 A;  3P5X A;  1KXR A;  1SNK A;  2GFO A;  1CQD A;  1U9V A;  3DF0 A;  4KLB A;  9PAP A;  3OQC A;  4PI3 A;  4W5C A;  5EF4 A;  2Y6E A;  4FIP A;  4YV8 A;  3N4C A;  3USV A;  3B21 A;  2DCC A;  5FPW A;  2HHN A;  4IP3 A;  3K8U A;  4HXD B;  2HWK A;  5KO3 A;  3W31 A;  2DCB A;  3PNR A;  4R3D A;  4RF1 A;  3WXF A;  1MS6 A;  3RVV A;  4YYW A;  2DC9 A;  2XU1 A;  1IWD A;  2JQG R;  1AYW A;  2F7D A;  4HWY A;  1AU2 A;  5F02 A;  1S4V A;  2NQD B;  4OVZ B;  3P5V A;  2DJG B;  2NQG A;  4WA6 A;  4WUR A;  2G6D A;  3F5V A;  2B1N A;  2R6N A;  4MI7 A;  2JQF R;  5CHT A;  1PIP A;  2HH5 A;  2FQ9 A;  2OUL A;  1CB5 A;  2PAD A;  3NHE A;  4A5U A;  3ERV A;  1KFU L;  4BPV A;  5K16 A;  4CZW A;  3BY4 A;  3RVW A;  1F2C A;  2FO5 A;  4REZ A;  4D8E A;  4PAD A;  4GUA A;  1DKI A;  3HWN A;  1EWP A;  2NQA A;  3TRK A;  3WXG A;  4MZO A;  2G7Y A;  2YJ2 A;  4M0W A;  3IMA A;  3BCN A;  3H6S A;  3HHA A;  1AU4 A;  1NQC A;  3MOR A;  5A24 A;  1FH0 A;  4IUM A;  4X6I A;  1HUC B;  1U9W A;  2R9O A;  3RVX A;  2IBI A;  4FJC A;  3U8E A;  1M6D A;  4RKX A;  3PDF A;  1F2B A;  2FUD A;  3C9E A;  1BQI A;  1MHW A;  1NB3 A;  3OVX A;  1VJV A;  3E1Z B;  2FT2 A;  4RNA A;  2YJ8 A;  2FRQ A;  4W4U A;  2E01 A;  4AXM A;  4BOU A;  2DC6 A;  2YJC A;  1QMY A;  2P86 A;  1EWO A;  1TLO A;  1PVJ A;  1ICF A;  1SP4 B;  1YT7 A;  2XU5 A;  5PAD A;  1YZB A;  5EZQ A;  2C0Y A;  2BDZ A;  2FRA A;  2NQI A;  3IFU A;  4QH6 A;  2DCD A;  2G8J A;  4BQV A;  1TL9 A;  4MSX A;  5J94 A;  1BY8 A;  3I06 A;  2AGA A;  3IOQ A;  4Q8G A;  3MJ5 A;  1TU6 A;  3CH2 X;  2B1M A;  1ZCM A;  4MZS A;  2J7Q C;  1PCI A;  2PBH A;  2R9M A;  2FYE A;  2ATO A;  4QRV A;  4CDF B;  1EWM A;  2J7Q A;  1XKG A;  5CVM A;  2XU4 A;  2F1G A;  1DEU A;  1A6R A;  3M99 A;  2BTW B;  3RNV A;  4P16 A;  1AYU A;  2CIO A;  2ACT A;  2DC7 A;  3MTV A;  2BU3 A;  1GMY A;  1AYV A;  4I05 A;  4P6G A;  2HD5 A;  1YK8 A;  4XUI A;  4D8I A;  2BTW A;  2XU3 A;  3PBH A;  2PRE A;  3OIS A;  5CVN B;  1GCB A;  4BS5 A;  2E02 A;  2R9C A;  2AYO A;  2ARY A;  2DOS A;  1DF0 A;  2OZ2 A;  1PPN A;  3CBJ A; 
#chains in the Genus database with same CATH homology
 1POP A;  3CBK A;  3HHI A;  3BOW A;  3V6C A;  7PCK A;  8PCH A;  2FTD A;  5JH3 A;  4I07 A;  2VHF A;  1ME4 A;  2IPP B;  2AUZ A;  1CJL A;  2G8E A;  1CPJ A;  2Y5B A;  1CV8 A;  1STF E;  4AXL A;  2PNS A;  2R9F A;  3OVZ A;  2P0R A;  4FK5 A;  1ATK A;  1U5I A;  2YJB A;  2YJ9 A;  3MHS A;  1KHQ A;  3IV2 A;  3GCB A;  1AU3 A;  3KFQ A;  1F2A A;  1W6F A;  1ME3 A;  4PP1 A;  1MEM A;  1GLO A;  2OP3 A;  3H7D A;  3OF9 A;  1CTE A;  1EWL A;  1THE A;  1QDQ A;  3F75 A;  3O1G A;  2AU1 A;  3KKU A;  1QOL A;  4N8W A;  4CDC B;  1PBH A;  3KWZ A;  3S3R A;  3O0U A;  4B55 A;  4I04 A;  3BWK A;  4P6E A;  5EGW A;  3N3G A;  3KSE A;  3IEJ A;  1W5R A;  4OEL A;  5JA7 A;  1BP4 A;  2AIM A;  2HXZ A;  3AI8 A;  1NB5 A;  3KW9 A;  3B79 A;  1Q6K A;  1PPO A;  4OEM A;  1YK7 A;  1PAD A;  3TNX A;  2DC8 A;  4N79 A;  1U9X A;  2BSZ A;  2VFC A;  3K24 A;  4YYQ A;  3HD3 A;  4W5B A;  3BC3 A;  5CHV A;  4RY2 A;  3KWB X;  4CDD B;  3CH3 X;  4C5P A;  3LXS A;  3BPF A;  1BGO A;  4G54 A;  4XR7 A;  4ZUX U;  1AEC A;  5CVO B;  1QXP A;  4Q8H A;  1ZIV A;  4YYR A;  3BPM A;  1YVB A;  1GEC E;  4CDE B;  4X6H A;  1MDW A;  3IHP A;  3I3T A;  1KFX L;  2AS8 A;  1Y08 A;  4YYV A;  4K7C A;  4QRG A;  1O0E A;  2AUX A;  3P5U A;  3H8C A;  1CS8 A;  1KHP A;  3QT4 A;  1X9Y A;  1PPD A;  1PPP A;  2E00 A;  1NPZ A;  3QSD A;  4X6J A;  1F29 A;  6PAD A;  1MIR A;  2H7J A;  2DCA A;  2DJF B;  4PP2 E;  3KX1 A;  2P7U A;  3N3K A;  3S3Q A;  3QJ3 A;  1ITO A;  2VHS A;  1PE6 A;  1CSB B;  1EF7 A;  1K3B B;  1NL6 A;  3D6S A;  2E03 A;  1AIM A;  2BDL A;  2CB5 A;  4QBB A;  3H8B A;  3D9W A;  1Y4H A;  2WBF X;  4BSQ A;  3MHH A;  3LFY A;  1PXV A;  2AVW A;  3WXE A;  3ZUA A;  4QRX A;  1AU0 A;  4YYS A;  1JQP A;  1VSN A;  3IUT A;  3P5W A;  2DZY A;  2GHU A;  4N4Z A;  4DMX A;  1NLJ A;  2AYN A;  2R9N A;  3OF8 A;  1CVZ A;  2VFB A;  3V6E A;  4DMY A;  1U9Q X;  2O6X A;  4YVA A;  4BS6 A;  3PW3 A;  3K9M A;  3MTN A;  4YYU A;  2DZZ A;  1YAL A;  1MEG A;  3H89 A;  3P5X A;  1KXR A;  1SNK A;  2GFO A;  1CQD A;  1U9V A;  3DF0 A;  4KLB A;  9PAP A;  4PI3 A;  4W5C A;  5EF4 A;  2Y6E A;  4FIP A;  4YV8 A;  3N4C A;  3USV A;  5FPW A;  2DCC A;  2HHN A;  3K8U A;  2DCB A;  3PNR A;  3WXF A;  1MS6 A;  3RVV A;  4YYW A;  2DC9 A;  2XU1 A;  1IWD A;  2JQG R;  1AYW A;  2F7D A;  4HWY A;  1AU2 A;  5F02 A;  1S4V A;  2NQD B;  1PPN A;  3P5V A;  2DJG B;  2NQG A;  4WA6 A;  2G6D A;  3F5V A;  2B1N A;  2R6N A;  5CHT A;  2JQF R;  1PIP A;  2HH5 A;  2FQ9 A;  2OUL A;  1CB5 A;  2PAD A;  3NHE A;  3ERV A;  1KFU L;  1E2T A;  4GUZ A;  5K16 A;  4BPV A;  4CZW A;  3RVW A;  1F2C A;  2FO5 A;  4PAD A;  3HWN A;  1EWP A;  2NQA A;  3WXG A;  4NV7 A;  4MZO A;  2G7Y A;  2YJ2 A;  3IMA A;  3LTW A;  3BCN A;  3H6S A;  3HHA A;  1AU4 A;  1NQC A;  3MOR A;  5A24 A;  1FH0 A;  4X6I A;  1HUC B;  1U9W A;  2R9O A;  3RVX A;  2IBI A;  4FJC A;  3U8E A;  1M6D A;  3PDF A;  1F2B A;  2FUD A;  3C9E A;  1BQI A;  1MHW A;  1NB3 A;  3OVX A;  1VJV A;  3E1Z B;  2FT2 A;  2YJ8 A;  2FRQ A;  4W4U A;  2E01 A;  4AXM A;  2DC6 A;  2YJC A;  1QMY A;  2P86 A;  1EWO A;  1TLO A;  1ICF A;  1SP4 B;  1YT7 A;  2XU5 A;  5PAD A;  2C0Y A;  2BDZ A;  2FRA A;  2NQI A;  4QH6 A;  1W4T A;  2DCD A;  2G8J A;  4BQV A;  1TL9 A;  4MSX A;  5J94 A;  1BY8 A;  3I06 A;  3IOQ A;  4Q8G A;  1TU6 A;  4NV8 A;  3CH2 X;  2B1M A;  1ZCM A;  4MZS A;  1PCI A;  4BGF A;  2PBH A;  2R9M A;  2FYE A;  2ATO A;  4QRV A;  4CDF B;  1EWM A;  1XKG A;  5CVM A;  2XU4 A;  2F1G A;  1DEU A;  1A6R A;  3M99 A;  1AYU A;  2CIO A;  2ACT A;  2DC7 A;  1GMY A;  1AYV A;  4I05 A;  4P6G A;  2HD5 A;  1YK8 A;  4XUI A;  2XU3 A;  3PBH A;  2PRE A;  3OIS A;  5CVN B;  1GCB A;  4BS5 A;  2E02 A;  2R9C A;  2AYO A;  2ARY A;  1DF0 A;  2OZ2 A;  1GX3 A;  3CBJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...