3IOQA

Crystal structure of the carica candamarcensis cysteine protease cms1ms2 in complex with e-64.
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
213
structure length
213
Chain Sequence
b'IPTSIDWRQKGAVTPVRNQGGCGSCWTFSSVAAVEGINKIVTGQLLSLSEQELLDCERRSYGCRGGFPLYALQYVANSGIHLRQYYPYEGVQRQCRASQAKGPKVKTDGVGRVPRNNEQALIQRIAIQPVSIVVEAKGRAFQNYRGGIFAGPCGTSIDHAVAAVGYGNDYILIKNSWGTGWGEGGYIRIKRGSGNPQGACGVLSDSVFPTKNR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CMS1MS2
publication title Crystal structure of the Carica candamarcensis cysteine protease CMS1MS2 in complex with E-64
rcsb
molecule tags Hydrolase
total genus 65
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 2009-08-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3ioqA00
1PE6A 3K8UA 3H89A 2Y5BA 2AYOA 1JQPA 3BPMA 5PADA 3IMAA 2FT2A 4BQVA 3V6CA 2FUDA 2OULA 5CHVA 1VJVA 1MDWA 4P6GA 4XUIA 4BS6A 4PP1A 1KHQA 2E01A 2E02A 2C0YA 4FK5A 4MZSA 4CDCB 3KWBX 3CH2X 5EF4A 4YVAA 3TNXA 2WBFX 2NQDB 2FQ9A 1S4VA 2G8EA 3C9EA 3IEJA 2OP3A 2XU4A 1QMYA 4YYQA 3USVA 4PI3A 4HWYA 3MHHA 1PIPA 2OZ2A 1GMYA 1KHPA 5CVOB 4I07A 3U8EA 4N4ZA 1K3BB 3N3GA 2F7DA 3K9MA 2VHSA 5JH3A 5EGWA 1ZIVA 4WA6A 1AU4A 1QDQA 2ATOA 3CH3X 1SP4B 1GCBA 1AECA 3NHEA 3P5WA 2R9FA 2DZYA 2PBHA 2H7JA 2HXZA 4YYVA 2R9OA 3RVWA 1YK7A 1PPPA 2JQGR 4QBBA 4QRXA 4ZUXU 1PBHA 3QSDA 1QXPA 1AYVA 4OELA 3S3QA 1U9VA 4OEMA 3K24A 3OF9A 3RVVA 1POPA 4FIPA 2PADA 1MIRA 4I04A 1YVBA 3RVXA 3O0UA 4QRVA 3BC3A 2GFOA 3OF8A 2FTDA 4G54A 2P0RA 1ME4A 3DF0A 3BOWA 1CJLA 1TU6A 1IWDA 1PXVA 2BDLA 4N79A 3OISA 2FYEA 4W4UA 3E1ZB 1F2BA 3F75A 2DZZA 1CSBB 3P5XA 3MORA 1AU2A 2R6NA 1MS6A 1Y08A 1EWLA 1ZCMA 5CVNB 3S3RA 3AI8A 3KFQA 3ZUAA 2FRAA 2IPPB 2G8JA 4DMXA 1M6DA 3OVZA 4AXMA 2B1NA 4DMYA 1FH0A 2FRQA 1F2AA 1THEA 1AU0A 2IBIA 2DC7A 3N3KA 1CTEA 1BP4A 2YJCA 1U9WA 3IUTA 2AIMA 2Y6EA 5A24A 2AYNA 1NL6A 2YJ9A 1HUCB 1PPDA 1A6RA 3IOQA 1ME3A 1GLOA 1CQDA 2YJ2A 1U9XA 4I05A 3P5UA 2VHFA 3LXSA 1NPZA 2DCAA 3CBKA 1PPOA 3BWKA 4PP2E 4N8WA 3KSEA 3V6EA 3WXEA 1VSNA 2FO5A 1CV8A 1YT7A 4YYRA 2ACTA 7PCKA 1MEGA 1CPJA 2AS8A 5J94A 1PPNA 2JQFR 1AYUA 4CZWA 1XKGA 2DCCA 3WXFA 2DCBA 2GHUA 4FJCA 1X9YA 9PAPA 2DJFB 2BDZA 4MZOA 1TLOA 3B79A 3LFYA 1MEMA 4W5BA 2NQGA 4CDDB 4Q8GA 1EWOA 5FPWA 3IHPA 1U5IA 1KXRA 2YJBA 2P7UA 2DCDA 4BSQA 2XU3A 2G7YA 2E00A 1YK8A 1BY8A 2ARYA 3BCNA 1STFE 3I3TA 2B1MA 1PADA 3PW3A 1ICFA 4MSXA 2AVWA 2YJ8A 1Y4HA 1BGOA 3MTNA 2G6DA 1F2CA 1EWPA 4Q8HA 5F02A 2HHNA 1CB5A 2XU1A 2CB5A 1NQCA 3WXGA 2F1GA 2AUXA 4X6IA 1U9QX 4XR7A 3PDFA 1PCIA 2HH5A 1CS8A 1AYWA 3QT4A 2AU1A 2PREA 4YYSA 3KWZA 3F5VA 2P86A 1BQIA 1EF7A 2HD5A 4K7CA 3HD3A 1NB5A 2E03A 3H8CA 4BS5A 3H6SA 4QRGA 3OVXA 3P5VA 1Q6KA 4PADA 4QH6A 1DEUA 4X6JA 1NLJA 2CIOA 5CHTA 3PNRA 1F29A 1GECE 4W5CA 3O1GA 4KLBA 3N4CA 3H7DA 3BPFA 2DJGB 1DF0A 3PBHA 3CBJA 2R9CA 2NQAA 3QJ3A 4YYUA 2O6XA 1KFXL 2NQIA 1AU3A 1AIMA 5JA7A 4AXLA 1KFUL 1EWMA 5K16A 1YALA 3D6SA 2DC6A 2XU5A 3MHSA 4X6HA 4CDEB 1TL9A 3HHIA 8PCHA 3KX1A 1QOLA 2DC8A 1MHWA 1O0EA 2DC9A 4BPVA 3KKUA 2R9NA 3HHAA 4YV8A 2AUZA 3M99A 1ITOA 2PNSA 3ERVA 4CDFB 2R9MA 3H8BA 1CVZA 1ATKA 3GCBA 5CVMA 1SNKA 6PADA 3IV2A 4P6EA 3HWNA 4RY2A 1NB3A 3KW9A 3I06A 4YYWA
chains in the Genus database with same CATH superfamily
1PE6A 3K8UA 3H89A 2Y5BA 5KO3A 5EZQA 2AYOA 1JQPA 3BPMA 5PADA 3IMAA 2FT2A 4BQVA 3V6CA 2FUDA 2OULA 5CHVA 1VJVA 1MDWA 4P6GA 2DOSA 4XUIA 4BS6A 4PP1A 1KHQA 2E01A 3IFUA 2E02A 4HXDB 2C0YA 4FK5A 1PVJA 4MZSA 4CDCB 3KWBX 3CH2X 5EF4A 4YVAA 3TNXA 2WBFX 2NQDB 2FQ9A 1S4VA 2G8EA 3C9EA 3PRPA 3IEJA 2OP3A 2XU4A 1QMYA 4YYQA 3USVA 4PI3A 4HWYA 3MHHA 1PIPA 2OZ2A 3BB7A 1GMYA 1KHPA 5CVOB 4I07A 5JZEA 3U8EA 4N4ZA 1K3BB 3N3GA 2F7DA 3K9MA 2VHSA 4PT5A 5JH3A 5EGWA 1ZIVA 4MI7A 4WA6A 1AU4A 1QDQA 2ATOA 3CH3X 1SP4B 1GCBA 1AECA 3NHEA 3P5WA 2R9FA 2DZYA 2PBHA 4RNAA 2H7JA 2HXZA 2JRIA 4YYVA 2R9OA 3RVWA 1YK7A 1PPPA 2JQGR 4QBBA 4QRXA 4ZUXU 3W30A 1PBHA 3QSDA 1QXPA 1AYVA 4OELA 3S3QA 1U9VA 4OEMA 3PHUA 3K24A 3OF9A 3RVVA 4BOSA 1POPA 3E9SA 4A5UA 4FIPA 2PADA 1MIRA 4I04A 1YVBA 3RVXA 2UZJA 3O0UA 4QRVA 3BC3A 2GFOA 3OF8A 2FTDA 4G54A 2J7QC 2P0RA 1ME4A 3DF0A 3BOWA 1CJLA 1TU6A 4BOUA 1IWDA 1PXVA 2BDLA 4N79A 3OISA 2FYEA 3PSEA 4RF0A 4W4UA 3E1ZB 4REZA 1F2BA 3F75A 2DZZA 1CSBB 3P5XA 4XZXA 3MORA 1AU2A 2R6NA 1MS6A 1Y08A 1EWLA 1ZCMA 2Z84A 5CVNB 3S3RA 4M0WA 3AI8A 3KFQA 3ZUAA 4D8BA 2FRAA 5E6JA 2IPPB 2BTWB 2G8JA 3PHXA 4DMXA 1M6DA 3PRMA 3OVZA 4AXMA 2B1NA 4DMYA 1FH0A 2FRQA 3OQCA 1F2AA 1THEA 1AU0A 4OW0A 2IBIA 2DC7A 3N3KA 3B21A 1CTEA 1BP4A 4BOZA 2YJCA 1U9WA 3IUTA 2AIMA 2Y6EA 5A24A 2AYNA 3C0RA 1NL6A 2YJ9A 1HUCB 1PPDA 1A6RA 3IOQA 1ME3A 1GLOA 1CQDA 2YJ2A 4BOPA 3TMPA 1U9XA 4I05A 3P5UA 5EZSA 2VHFA 3LXSA 4ZTBA 1NPZA 2DCAA 3CBKA 1PPOA 3BWKA 4PP2E 4N8WA 3KSEA 3V6EA 3WXEA 1VSNA 2FO5A 1CV8A 1YT7A 4WURA 4YYRA 4IUMA 2ACTA 7PCKA 1MEGA 1CPJA 2AS8A 5J94A 1PPNA 2JQFR 1AYUA 4CZWA 1XKGA 2DCCA 3BBAA 3WXFA 3MP2A 2DCBA 2GHUA 4FJCA 1X9YA 2JTCA 9PAPA 2DJFB 2BDZA 4MZOA 1TLOA 3B79A 3LFYA 1MEMA 4W5BA 2NQGA 4CDDB 3PHWA 3O65A 4Q8GA 1EWOA 5FPWA 3IHPA 1U5IA 1KXRA 2YJBA 2P7UA 2DCDA 4BSQA 2XU3A 2G7YA 2E00A 1YK8A 1BY8A 2ARYA 3BCNA 3PT2A 1STFE 3I3TA 2B1MA 1PADA 3PW3A 1ICFA 4MSXA 2AVWA 2YJ8A 1DKIA 1Y4HA 1BGOA 3MTNA 2G6DA 2BU3A 1F2CA 1EWPA 4Q8HA 5F02A 2HHNA 1CB5A 2XU1A 2FE8A 2CB5A 1NQCA 3WXGA 2F1GA 2AUXA 4X6IA 1U9QX 4OVZB 3PDFA 4XR7A 1PCIA 2HH5A 1CS8A 1AYWA 3QT4A 2AU1A 2PREA 4YYSA 3KWZA 4IP3A 3F5VA 2P86A 1BQIA 4RF1A 1EF7A 2HD5A 4K7CA 3HD3A 1NB5A 2E03A 3H8CA 3BY4A 4BS5A 3H6SA 4QRGA 3OVXA 3P5VA 1Q6KA 4PADA 3ZNHA 4QH6A 1DEUA 4X6JA 3TRKA 1NLJA 2CIOA 3RNVA 4BOQA 5CHTA 3PNRA 1F29A 1GECE 4W5CA 3O1GA 4KLBA 4OVZA 3N4CA 3H7DA 2BTWA 3BPFA 3MJ5A 2DJGB 1DF0A 2HWKA 4GUAA 2J7QA 3PBHA 3CBJA 2R9CA 2NQAA 3QJ3A 4YYUA 2O6XA 1KFXL 2NQIA 1AU3A 1AIMA 5JA7A 4AXLA 1KFUL 1EWMA 5K16A 1YALA 3D6SA 2DC6A 4MM3B 2XU5A 3MHSA 4X6HA 4CDEB 1TL9A 3HHIA 8PCHA 4P16A 3KX1A 1QOLA 4D8IA 2DC8A 1MHWA 1O0EA 2DC9A 4BPVA 3KKUA 2R9NA 3HHAA 3W31A 4YV8A 2AGAA 2AUZA 3MTVA 3M99A 1ITOA 2PNSA 3ERVA 1YZBA 4CDFB 2R9MA 3H8BA 1CVZA 1ATKA 3GCBA 5CVMA 1SNKA 1UKFA 6PADA 3IV2A 4P6EA 3HWNA 4RY2A 1NB3A 3KW9A 4D8EA 4RKXA 3I06A 4YYWA 4R3DA
chains in the Genus database with same CATH topology
1PE6A 3K8UA 3H89A 2Y5BA 4NV7A 2AYOA 1JQPA 3BPMA 5PADA 3IMAA 2FT2A 4BQVA 3V6CA 2FUDA 2OULA 5CHVA 1VJVA 1MDWA 4P6GA 4XUIA 4BS6A 1W4TA 4PP1A 4GUZA 1KHQA 2E01A 2E02A 2C0YA 4FK5A 4MZSA 4CDCB 3KWBX 3CH2X 5EF4A 4YVAA 3TNXA 2WBFX 2NQDB 2FQ9A 1S4VA 2G8EA 3C9EA 3IEJA 2OP3A 2XU4A 1QMYA 4YYQA 1W5RA 3USVA 4PI3A 4HWYA 3MHHA 1PIPA 2OZ2A 1GMYA 1KHPA 5CVOB 4I07A 3U8EA 4N4ZA 1K3BB 3N3GA 2F7DA 3K9MA 2VHSA 4NV8A 5EGWA 5JH3A 1ZIVA 4WA6A 1AU4A 1QDQA 2ATOA 3CH3X 1SP4B 1GCBA 1AECA 1E2TA 3NHEA 3P5WA 2R9FA 2DZYA 2PBHA 2H7JA 2HXZA 4YYVA 2R9OA 3RVWA 1YK7A 1PPPA 2JQGR 4QBBA 4QRXA 4ZUXU 1PBHA 3QSDA 1QXPA 1AYVA 4OELA 3S3QA 1U9VA 4OEMA 3K24A 3OF9A 2BSZA 3RVVA 1POPA 4FIPA 2PADA 1MIRA 4I04A 3LTWA 1YVBA 3RVXA 3O0UA 4QRVA 3BC3A 2GFOA 3OF8A 2FTDA 4G54A 2P0RA 1ME4A 3DF0A 3BOWA 1CJLA 1TU6A 1IWDA 1PXVA 2BDLA 4N79A 3OISA 2FYEA 4W4UA 3E1ZB 1F2BA 3F75A 2DZZA 1CSBB 3P5XA 3MORA 1AU2A 2R6NA 1MS6A 1Y08A 1EWLA 1ZCMA 5CVNB 3S3RA 3AI8A 3KFQA 3ZUAA 2FRAA 2IPPB 2G8JA 4DMXA 1M6DA 3OVZA 4AXMA 2B1NA 4DMYA 1FH0A 2FRQA 1F2AA 1THEA 1AU0A 2IBIA 2DC7A 3N3KA 1CTEA 1BP4A 2YJCA 1U9WA 3IUTA 2AIMA 2Y6EA 5A24A 2AYNA 1NL6A 2YJ9A 1HUCB 1PPDA 1A6RA 3IOQA 1ME3A 1GLOA 1CQDA 2YJ2A 1U9XA 4I05A 3P5UA 2VHFA 3LXSA 1NPZA 2DCAA 3CBKA 1PPOA 3BWKA 4PP2E 4N8WA 3KSEA 3V6EA 3WXEA 1VSNA 2FO5A 1CV8A 1YT7A 4YYRA 2ACTA 2VFBA 7PCKA 1MEGA 1CPJA 2AS8A 5J94A 1PPNA 2JQFR 1AYUA 4CZWA 1XKGA 2DCCA 3WXFA 2DCBA 2GHUA 4FJCA 1X9YA 9PAPA 2DJFB 2BDZA 4MZOA 1TLOA 3B79A 3LFYA 1MEMA 4W5BA 2NQGA 4CDDB 4Q8GA 1EWOA 5FPWA 3IHPA 1U5IA 1KXRA 2YJBA 2P7UA 2DCDA 4BSQA 2XU3A 2G7YA 2E00A 4C5PA 1YK8A 1BY8A 2ARYA 3BCNA 1STFE 3I3TA 2B1MA 1PADA 3PW3A 1ICFA 4BGFA 4MSXA 2AVWA 2YJ8A 1Y4HA 2VFCA 1BGOA 3MTNA 2G6DA 1F2CA 1EWPA 4Q8HA 5F02A 2HHNA 1CB5A 1W6FA 2XU1A 2CB5A 1NQCA 3WXGA 2F1GA 2AUXA 4X6IA 1U9QX 4XR7A 3PDFA 1PCIA 2HH5A 1CS8A 1AYWA 3QT4A 2AU1A 2PREA 4YYSA 3KWZA 3F5VA 2P86A 1BQIA 1EF7A 2HD5A 4K7CA 3HD3A 1NB5A 2E03A 3H8CA 4BS5A 3H6SA 4QRGA 3OVXA 3P5VA 1Q6KA 4PADA 4QH6A 1DEUA 4X6JA 1NLJA 2CIOA 5CHTA 3D9WA 3PNRA 1F29A 1GECE 4W5CA 3O1GA 4KLBA 3N4CA 3H7DA 3BPFA 2DJGB 1DF0A 4B55A 3PBHA 3CBJA 2R9CA 2NQAA 3QJ3A 4YYUA 2O6XA 1KFXL 2NQIA 1AU3A 1AIMA 5JA7A 4AXLA 1GX3A 1EWMA 1KFUL 1YALA 3D6SA 5K16A 2DC6A 2XU5A 3MHSA 4X6HA 4CDEB 1TL9A 3HHIA 8PCHA 3KX1A 1QOLA 2DC8A 1MHWA 1O0EA 2DC9A 4BPVA 3KKUA 2R9NA 3HHAA 4YV8A 2AUZA 3M99A 1ITOA 2PNSA 3ERVA 4CDFB 2R9MA 3H8BA 1CVZA 1ATKA 3GCBA 5CVMA 1SNKA 6PADA 3IV2A 4P6EA 3HWNA 4RY2A 1NB3A 3KW9A 3I06A 4YYWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PE6 A;  3K8U A;  3H89 A;  2Y5B A;  2AYO A;  1JQP A;  3BPM A;  5PAD A;  3IMA A;  2FT2 A;  4BQV A;  3V6C A;  2FUD A;  2OUL A;  5CHV A;  1VJV A;  1MDW A;  4P6G A;  4XUI A;  4BS6 A;  4PP1 A;  1KHQ A;  2E01 A;  2E02 A;  2C0Y A;  4FK5 A;  4MZS A;  4CDC B;  3KWB X;  3CH2 X;  5EF4 A;  4YVA A;  3TNX A;  2WBF X;  2NQD B;  2FQ9 A;  1S4V A;  2G8E A;  3C9E A;  3IEJ A;  2OP3 A;  2XU4 A;  1QMY A;  4YYQ A;  3USV A;  4PI3 A;  4HWY A;  3MHH A;  1PIP A;  2OZ2 A;  1GMY A;  1KHP A;  5CVO B;  4I07 A;  3U8E A;  4N4Z A;  1K3B B;  3N3G A;  2F7D A;  3K9M A;  2VHS A;  5JH3 A;  5EGW A;  1ZIV A;  4WA6 A;  1AU4 A;  1QDQ A;  2ATO A;  3CH3 X;  1SP4 B;  1GCB A;  1AEC A;  3NHE A;  3P5W A;  2R9F A;  2DZY A;  2PBH A;  2H7J A;  2HXZ A;  4YYV A;  2R9O A;  3RVW A;  1YK7 A;  1PPP A;  2JQG R;  4QBB A;  4QRX A;  4ZUX U;  1PBH A;  3QSD A;  1QXP A;  1AYV A;  4OEL A;  3S3Q A;  1U9V A;  4OEM A;  3K24 A;  3OF9 A;  3RVV A;  1POP A;  4FIP A;  2PAD A;  1MIR A;  4I04 A;  1YVB A;  3RVX A;  3O0U A;  4QRV A;  3BC3 A;  2GFO A;  3OF8 A;  2FTD A;  4G54 A;  2P0R A;  1ME4 A;  3DF0 A;  3BOW A;  1CJL A;  1TU6 A;  1IWD A;  1PXV A;  2BDL A;  4N79 A;  3OIS A;  2FYE A;  4W4U A;  3E1Z B;  1F2B A;  3F75 A;  2DZZ A;  1CSB B;  3P5X A;  3MOR A;  1AU2 A;  2R6N A;  1MS6 A;  1Y08 A;  1EWL A;  1ZCM A;  5CVN B;  3S3R A;  3AI8 A;  3KFQ A;  3ZUA A;  2FRA A;  2IPP B;  2G8J A;  4DMX A;  1M6D A;  3OVZ A;  4AXM A;  2B1N A;  4DMY A;  1FH0 A;  2FRQ A;  1F2A A;  1THE A;  1AU0 A;  2IBI A;  2DC7 A;  3N3K A;  1CTE A;  1BP4 A;  2YJC A;  1U9W A;  3IUT A;  2AIM A;  2Y6E A;  5A24 A;  2AYN A;  1NL6 A;  2YJ9 A;  1HUC B;  1PPD A;  1A6R A;  3IOQ A;  1ME3 A;  1GLO A;  1CQD A;  2YJ2 A;  1U9X A;  4I05 A;  3P5U A;  2VHF A;  3LXS A;  1NPZ A;  2DCA A;  3CBK A;  1PPO A;  3BWK A;  4PP2 E;  4N8W A;  3KSE A;  3V6E A;  3WXE A;  1VSN A;  2FO5 A;  1CV8 A;  1YT7 A;  4YYR A;  2ACT A;  7PCK A;  1MEG A;  1CPJ A;  2AS8 A;  5J94 A;  1PPN A;  2JQF R;  1AYU A;  4CZW A;  1XKG A;  2DCC A;  3WXF A;  2DCB A;  2GHU A;  4FJC A;  1X9Y A;  9PAP A;  2DJF B;  2BDZ A;  4MZO A;  1TLO A;  3B79 A;  3LFY A;  1MEM A;  4W5B A;  2NQG A;  4CDD B;  4Q8G A;  1EWO A;  5FPW A;  3IHP A;  1U5I A;  1KXR A;  2YJB A;  2P7U A;  2DCD A;  4BSQ A;  2XU3 A;  2G7Y A;  2E00 A;  1YK8 A;  1BY8 A;  2ARY A;  3BCN A;  1STF E;  3I3T A;  2B1M A;  1PAD A;  3PW3 A;  1ICF A;  4MSX A;  2AVW A;  2YJ8 A;  1Y4H A;  1BGO A;  3MTN A;  2G6D A;  1F2C A;  1EWP A;  4Q8H A;  5F02 A;  2HHN A;  1CB5 A;  2XU1 A;  2CB5 A;  1NQC A;  3WXG A;  2F1G A;  2AUX A;  4X6I A;  1U9Q X;  4XR7 A;  3PDF A;  1PCI A;  2HH5 A;  1CS8 A;  1AYW A;  3QT4 A;  2AU1 A;  2PRE A;  4YYS A;  3KWZ A;  3F5V A;  2P86 A;  1BQI A;  1EF7 A;  2HD5 A;  4K7C A;  3HD3 A;  1NB5 A;  2E03 A;  3H8C A;  4BS5 A;  3H6S A;  4QRG A;  3OVX A;  3P5V A;  1Q6K A;  4PAD A;  4QH6 A;  1DEU A;  4X6J A;  1NLJ A;  2CIO A;  5CHT A;  3PNR A;  1F29 A;  1GEC E;  4W5C A;  3O1G A;  4KLB A;  3N4C A;  3H7D A;  3BPF A;  2DJG B;  1DF0 A;  3PBH A;  3CBJ A;  2R9C A;  2NQA A;  3QJ3 A;  4YYU A;  2O6X A;  1KFX L;  2NQI A;  1AU3 A;  1AIM A;  5JA7 A;  4AXL A;  1KFU L;  1EWM A;  5K16 A;  1YAL A;  3D6S A;  2DC6 A;  2XU5 A;  3MHS A;  4X6H A;  4CDE B;  1TL9 A;  3HHI A;  8PCH A;  3KX1 A;  1QOL A;  2DC8 A;  1MHW A;  1O0E A;  2DC9 A;  4BPV A;  3KKU A;  2R9N A;  3HHA A;  4YV8 A;  2AUZ A;  3M99 A;  1ITO A;  2PNS A;  3ERV A;  4CDF B;  2R9M A;  3H8B A;  1CVZ A;  1ATK A;  3GCB A;  5CVM A;  1SNK A;  6PAD A;  3IV2 A;  4P6E A;  3HWN A;  4RY2 A;  1NB3 A;  3KW9 A;  3I06 A;  4YYW A; 
#chains in the Genus database with same CATH topology
 1PE6 A;  3K8U A;  3H89 A;  2Y5B A;  5KO3 A;  5EZQ A;  2AYO A;  1JQP A;  3BPM A;  5PAD A;  3IMA A;  2FT2 A;  4BQV A;  3V6C A;  2FUD A;  2OUL A;  5CHV A;  1VJV A;  1MDW A;  4P6G A;  2DOS A;  4XUI A;  4BS6 A;  4PP1 A;  1KHQ A;  2E01 A;  3IFU A;  2E02 A;  4HXD B;  2C0Y A;  4FK5 A;  1PVJ A;  4MZS A;  4CDC B;  3KWB X;  3CH2 X;  5EF4 A;  4YVA A;  3TNX A;  2WBF X;  2NQD B;  2FQ9 A;  1S4V A;  2G8E A;  3C9E A;  3PRP A;  3IEJ A;  2OP3 A;  2XU4 A;  1QMY A;  4YYQ A;  3USV A;  4PI3 A;  4HWY A;  3MHH A;  1PIP A;  2OZ2 A;  3BB7 A;  1GMY A;  1KHP A;  5CVO B;  4I07 A;  5JZE A;  3U8E A;  4N4Z A;  1K3B B;  3N3G A;  2F7D A;  3K9M A;  2VHS A;  4PT5 A;  5JH3 A;  5EGW A;  1ZIV A;  4MI7 A;  4WA6 A;  1AU4 A;  1QDQ A;  2ATO A;  3CH3 X;  1SP4 B;  1GCB A;  1AEC A;  3NHE A;  3P5W A;  2R9F A;  2DZY A;  2PBH A;  4RNA A;  2H7J A;  2HXZ A;  2JRI A;  4YYV A;  2R9O A;  3RVW A;  1YK7 A;  1PPP A;  2JQG R;  4QBB A;  4QRX A;  4ZUX U;  3W30 A;  1PBH A;  3QSD A;  1QXP A;  1AYV A;  4OEL A;  3S3Q A;  1U9V A;  4OEM A;  3PHU A;  3K24 A;  3OF9 A;  3RVV A;  4BOS A;  1POP A;  3E9S A;  4A5U A;  4FIP A;  2PAD A;  1MIR A;  4I04 A;  1YVB A;  3RVX A;  2UZJ A;  3O0U A;  4QRV A;  3BC3 A;  2GFO A;  3OF8 A;  2FTD A;  4G54 A;  2J7Q C;  2P0R A;  1ME4 A;  3DF0 A;  3BOW A;  1CJL A;  1TU6 A;  4BOU A;  1IWD A;  1PXV A;  2BDL A;  4N79 A;  3OIS A;  2FYE A;  3PSE A;  4RF0 A;  4W4U A;  3E1Z B;  4REZ A;  1F2B A;  3F75 A;  2DZZ A;  1CSB B;  3P5X A;  4XZX A;  3MOR A;  1AU2 A;  2R6N A;  1MS6 A;  1Y08 A;  1EWL A;  1ZCM A;  2Z84 A;  5CVN B;  3S3R A;  4M0W A;  3AI8 A;  3KFQ A;  3ZUA A;  4D8B A;  2FRA A;  5E6J A;  2IPP B;  2BTW B;  2G8J A;  3PHX A;  4DMX A;  1M6D A;  3PRM A;  3OVZ A;  4AXM A;  2B1N A;  4DMY A;  1FH0 A;  2FRQ A;  3OQC A;  1F2A A;  1THE A;  1AU0 A;  4OW0 A;  2IBI A;  2DC7 A;  3N3K A;  3B21 A;  1CTE A;  1BP4 A;  4BOZ A;  2YJC A;  1U9W A;  3IUT A;  2AIM A;  2Y6E A;  5A24 A;  2AYN A;  3C0R A;  1NL6 A;  2YJ9 A;  1HUC B;  1PPD A;  1A6R A;  3IOQ A;  1ME3 A;  1GLO A;  1CQD A;  2YJ2 A;  4BOP A;  3TMP A;  1U9X A;  4I05 A;  3P5U A;  5EZS A;  2VHF A;  3LXS A;  4ZTB A;  1NPZ A;  2DCA A;  3CBK A;  1PPO A;  3BWK A;  4PP2 E;  4N8W A;  3KSE A;  3V6E A;  3WXE A;  1VSN A;  2FO5 A;  1CV8 A;  1YT7 A;  4WUR A;  4YYR A;  4IUM A;  2ACT A;  7PCK A;  1MEG A;  1CPJ A;  2AS8 A;  5J94 A;  1PPN A;  2JQF R;  1AYU A;  4CZW A;  1XKG A;  2DCC A;  3BBA A;  3WXF A;  3MP2 A;  2DCB A;  2GHU A;  4FJC A;  1X9Y A;  2JTC A;  9PAP A;  2DJF B;  2BDZ A;  4MZO A;  1TLO A;  3B79 A;  3LFY A;  1MEM A;  4W5B A;  2NQG A;  4CDD B;  3PHW A;  3O65 A;  4Q8G A;  1EWO A;  5FPW A;  3IHP A;  1U5I A;  1KXR A;  2YJB A;  2P7U A;  2DCD A;  4BSQ A;  2XU3 A;  2G7Y A;  2E00 A;  1YK8 A;  1BY8 A;  2ARY A;  3BCN A;  3PT2 A;  1STF E;  3I3T A;  2B1M A;  1PAD A;  3PW3 A;  1ICF A;  4MSX A;  2AVW A;  2YJ8 A;  1DKI A;  1Y4H A;  1BGO A;  3MTN A;  2G6D A;  2BU3 A;  1F2C A;  1EWP A;  4Q8H A;  5F02 A;  2HHN A;  1CB5 A;  2XU1 A;  2FE8 A;  2CB5 A;  1NQC A;  3WXG A;  2F1G A;  2AUX A;  4X6I A;  1U9Q X;  4OVZ B;  3PDF A;  4XR7 A;  1PCI A;  2HH5 A;  1CS8 A;  1AYW A;  3QT4 A;  2AU1 A;  2PRE A;  4YYS A;  3KWZ A;  4IP3 A;  3F5V A;  2P86 A;  1BQI A;  4RF1 A;  1EF7 A;  2HD5 A;  4K7C A;  3HD3 A;  1NB5 A;  2E03 A;  3H8C A;  3BY4 A;  4BS5 A;  3H6S A;  4QRG A;  3OVX A;  3P5V A;  1Q6K A;  4PAD A;  3ZNH A;  4QH6 A;  1DEU A;  4X6J A;  3TRK A;  1NLJ A;  2CIO A;  3RNV A;  4BOQ A;  5CHT A;  3PNR A;  1F29 A;  1GEC E;  4W5C A;  3O1G A;  4KLB A;  4OVZ A;  3N4C A;  3H7D A;  2BTW A;  3BPF A;  3MJ5 A;  2DJG B;  1DF0 A;  2HWK A;  4GUA A;  2J7Q A;  3PBH A;  3CBJ A;  2R9C A;  2NQA A;  3QJ3 A;  4YYU A;  2O6X A;  1KFX L;  2NQI A;  1AU3 A;  1AIM A;  5JA7 A;  4AXL A;  1KFU L;  1EWM A;  5K16 A;  1YAL A;  3D6S A;  2DC6 A;  4MM3 B;  2XU5 A;  3MHS A;  4X6H A;  4CDE B;  1TL9 A;  3HHI A;  8PCH A;  4P16 A;  3KX1 A;  1QOL A;  4D8I A;  2DC8 A;  1MHW A;  1O0E A;  2DC9 A;  4BPV A;  3KKU A;  2R9N A;  3HHA A;  3W31 A;  4YV8 A;  2AGA A;  2AUZ A;  3MTV A;  3M99 A;  1ITO A;  2PNS A;  3ERV A;  1YZB A;  4CDF B;  2R9M A;  3H8B A;  1CVZ A;  1ATK A;  3GCB A;  5CVM A;  1SNK A;  1UKF A;  6PAD A;  3IV2 A;  4P6E A;  3HWN A;  4RY2 A;  1NB3 A;  3KW9 A;  4D8E A;  4RKX A;  3I06 A;  4YYW A;  4R3D A; 
#chains in the Genus database with same CATH homology
 1PE6 A;  3K8U A;  3H89 A;  2Y5B A;  4NV7 A;  2AYO A;  1JQP A;  3BPM A;  5PAD A;  3IMA A;  2FT2 A;  4BQV A;  3V6C A;  2FUD A;  2OUL A;  5CHV A;  1VJV A;  1MDW A;  4P6G A;  4XUI A;  4BS6 A;  1W4T A;  4PP1 A;  4GUZ A;  1KHQ A;  2E01 A;  2E02 A;  2C0Y A;  4FK5 A;  4MZS A;  4CDC B;  3KWB X;  3CH2 X;  5EF4 A;  4YVA A;  3TNX A;  2WBF X;  2NQD B;  2FQ9 A;  1S4V A;  2G8E A;  3C9E A;  3IEJ A;  2OP3 A;  2XU4 A;  1QMY A;  4YYQ A;  1W5R A;  3USV A;  4PI3 A;  4HWY A;  3MHH A;  1PIP A;  2OZ2 A;  1GMY A;  1KHP A;  5CVO B;  4I07 A;  3U8E A;  4N4Z A;  1K3B B;  3N3G A;  2F7D A;  3K9M A;  2VHS A;  4NV8 A;  5EGW A;  5JH3 A;  1ZIV A;  4WA6 A;  1AU4 A;  1QDQ A;  2ATO A;  3CH3 X;  1SP4 B;  1GCB A;  1AEC A;  1E2T A;  3NHE A;  3P5W A;  2R9F A;  2DZY A;  2PBH A;  2H7J A;  2HXZ A;  4YYV A;  2R9O A;  3RVW A;  1YK7 A;  1PPP A;  2JQG R;  4QBB A;  4QRX A;  4ZUX U;  1PBH A;  3QSD A;  1QXP A;  1AYV A;  4OEL A;  3S3Q A;  1U9V A;  4OEM A;  3K24 A;  3OF9 A;  2BSZ A;  3RVV A;  1POP A;  4FIP A;  2PAD A;  1MIR A;  4I04 A;  3LTW A;  1YVB A;  3RVX A;  3O0U A;  4QRV A;  3BC3 A;  2GFO A;  3OF8 A;  2FTD A;  4G54 A;  2P0R A;  1ME4 A;  3DF0 A;  3BOW A;  1CJL A;  1TU6 A;  1IWD A;  1PXV A;  2BDL A;  4N79 A;  3OIS A;  2FYE A;  4W4U A;  3E1Z B;  1F2B A;  3F75 A;  2DZZ A;  1CSB B;  3P5X A;  3MOR A;  1AU2 A;  2R6N A;  1MS6 A;  1Y08 A;  1EWL A;  1ZCM A;  5CVN B;  3S3R A;  3AI8 A;  3KFQ A;  3ZUA A;  2FRA A;  2IPP B;  2G8J A;  4DMX A;  1M6D A;  3OVZ A;  4AXM A;  2B1N A;  4DMY A;  1FH0 A;  2FRQ A;  1F2A A;  1THE A;  1AU0 A;  2IBI A;  2DC7 A;  3N3K A;  1CTE A;  1BP4 A;  2YJC A;  1U9W A;  3IUT A;  2AIM A;  2Y6E A;  5A24 A;  2AYN A;  1NL6 A;  2YJ9 A;  1HUC B;  1PPD A;  1A6R A;  3IOQ A;  1ME3 A;  1GLO A;  1CQD A;  2YJ2 A;  1U9X A;  4I05 A;  3P5U A;  2VHF A;  3LXS A;  1NPZ A;  2DCA A;  3CBK A;  1PPO A;  3BWK A;  4PP2 E;  4N8W A;  3KSE A;  3V6E A;  3WXE A;  1VSN A;  2FO5 A;  1CV8 A;  1YT7 A;  4YYR A;  2ACT A;  2VFB A;  7PCK A;  1MEG A;  1CPJ A;  2AS8 A;  5J94 A;  1PPN A;  2JQF R;  1AYU A;  4CZW A;  1XKG A;  2DCC A;  3WXF A;  2DCB A;  2GHU A;  4FJC A;  1X9Y A;  9PAP A;  2DJF B;  2BDZ A;  4MZO A;  1TLO A;  3B79 A;  3LFY A;  1MEM A;  4W5B A;  2NQG A;  4CDD B;  4Q8G A;  1EWO A;  5FPW A;  3IHP A;  1U5I A;  1KXR A;  2YJB A;  2P7U A;  2DCD A;  4BSQ A;  2XU3 A;  2G7Y A;  2E00 A;  4C5P A;  1YK8 A;  1BY8 A;  2ARY A;  3BCN A;  1STF E;  3I3T A;  2B1M A;  1PAD A;  3PW3 A;  1ICF A;  4BGF A;  4MSX A;  2AVW A;  2YJ8 A;  1Y4H A;  2VFC A;  1BGO A;  3MTN A;  2G6D A;  1F2C A;  1EWP A;  4Q8H A;  5F02 A;  2HHN A;  1CB5 A;  1W6F A;  2XU1 A;  2CB5 A;  1NQC A;  3WXG A;  2F1G A;  2AUX A;  4X6I A;  1U9Q X;  4XR7 A;  3PDF A;  1PCI A;  2HH5 A;  1CS8 A;  1AYW A;  3QT4 A;  2AU1 A;  2PRE A;  4YYS A;  3KWZ A;  3F5V A;  2P86 A;  1BQI A;  1EF7 A;  2HD5 A;  4K7C A;  3HD3 A;  1NB5 A;  2E03 A;  3H8C A;  4BS5 A;  3H6S A;  4QRG A;  3OVX A;  3P5V A;  1Q6K A;  4PAD A;  4QH6 A;  1DEU A;  4X6J A;  1NLJ A;  2CIO A;  5CHT A;  3D9W A;  3PNR A;  1F29 A;  1GEC E;  4W5C A;  3O1G A;  4KLB A;  3N4C A;  3H7D A;  3BPF A;  2DJG B;  1DF0 A;  4B55 A;  3PBH A;  3CBJ A;  2R9C A;  2NQA A;  3QJ3 A;  4YYU A;  2O6X A;  1KFX L;  2NQI A;  1AU3 A;  1AIM A;  5JA7 A;  4AXL A;  1GX3 A;  1EWM A;  1KFU L;  1YAL A;  3D6S A;  5K16 A;  2DC6 A;  2XU5 A;  3MHS A;  4X6H A;  4CDE B;  1TL9 A;  3HHI A;  8PCH A;  3KX1 A;  1QOL A;  2DC8 A;  1MHW A;  1O0E A;  2DC9 A;  4BPV A;  3KKU A;  2R9N A;  3HHA A;  4YV8 A;  2AUZ A;  3M99 A;  1ITO A;  2PNS A;  3ERV A;  4CDF B;  2R9M A;  3H8B A;  1CVZ A;  1ATK A;  3GCB A;  5CVM A;  1SNK A;  6PAD A;  3IV2 A;  4P6E A;  3HWN A;  4RY2 A;  1NB3 A;  3KW9 A;  3I06 A;  4YYW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...