3IOQA

Crystal structure of the carica candamarcensis cysteine protease cms1ms2 in complex with e-64.
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
213
structure length
213
Chain Sequence
IPTSIDWRQKGAVTPVRNQGGCGSCWTFSSVAAVEGINKIVTGQLLSLSEQELLDCERRSYGCRGGFPLYALQYVANSGIHLRQYYPYEGVQRQCRASQAKGPKVKTDGVGRVPRNNEQALIQRIAIQPVSIVVEAKGRAFQNYRGGIFAGPCGTSIDHAVAAVGYGNDYILIKNSWGTGWGEGGYIRIKRGSGNPQGACGVLSDSVFPTKNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CMS1MS2
publication title Crystal structure of the Carica candamarcensis cysteine protease CMS1MS2 in complex with E-64
rcsb
molecule tags Hydrolase
total genus 65
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 2009-08-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3ioqA00
2CB5A 5F02A 1EWLA 3KFQA 3BOWA 1PPOA 1PXVA 4P6EA 3AI8A 1EWMA 1U9QX 4AXLA 2BDLA 2WBFX 4QRXA 3I06A 4XUIA 1FH0A 2FYEA 2NQGA 2DZZA 2HHNA 2JQGR 2AS8A 1Y08A 2PREA 5CHVA 3M99A 3QSDA 2F1GA 2G7YA 3CH3X 2YJ8A 2E02A 4QH6A 2FT2A 2R9FA 1PADA 1AU2A 3KWBX 3IMAA 4N79A 5CHTA 2E01A 3CBKA 3H8BA 3HHAA 2HD5A 1EF7A 3PDFA 3PNRA 4CZWA 1BP4A 3ERVA 4YYQA 2CIOA 4CDEB 2YJ9A 3BWKA 3P5UA 1VSNA 2NQDB 8PCHA 3OISA 1AECA 4XR7A 2ATOA 1BGOA 1PPNA 4PP2E 3RVXA 5CVNB 4I04A 1PPDA 4W5BA 1CSBB 1S4VA 1SNKA 4YYUA 3WXGA 4YYRA 1AIMA 2R9CA 2DCDA 2YJCA 5JA7A 1NB3A 2AU1A 1IWDA 3F75A 2E00A 2FQ9A 5EF4A 3O1GA 1GLOA 2DZYA 1QDQA 3RVWA 5FPWA 3HHIA 3B79A 3H6SA 2DC6A 1CV8A 4FK5A 4G54A 4ZUXU 5CVMA 9PAPA 4OEMA 4YYWA 3PBHA 3P5XA 1AU3A 4HWYA 1F29A 1M6DA 2AUZA 2G8JA 4Q8GA 1U9XA 1THEA 2O6XA 2P0RA 1CVZA 1PPPA 2HXZA 2FUDA 3H89A 1MDWA 2R9OA 3S3QA 3OVXA 4YV8A 3IV2A 4I07A 4KLBA 1CQDA 1F2AA 1YALA 2JQFR 4WA6A 2F7DA 3MTNA 3QT4A 1YK7A 4BS5A 3HD3A 3V6EA 2FTDA 1Q6KA 1ZCMA 2ARYA 3N3GA 1HUCB 5CVOB 1MHWA 3MHHA 1F2CA 2G6DA 3U8EA 2FRAA 2AYOA 1AYUA 4N4ZA 3CH2X 2NQAA 2HH5A 1TL9A 3BCNA 1DEUA 1VJVA 2FRQA 4QBBA 4QRVA 3F5VA 3IHPA 3C9EA 1KFXL 1QMYA 3KSEA 3IOQA 1MEGA 3IEJA 4MSXA 2BDZA 2PNSA 4MZOA 2DCBA 3WXEA 3K24A 1MS6A 1TLOA 4Q8HA 2YJBA 1BQIA 2IPPB 3USVA 1ICFA 3N3KA 1CS8A 2DCAA 2DJFB 1BY8A 1X9YA 1GECE 2AVWA 3K9MA 3S3RA 3KW9A 4I05A 2VHSA 1XKGA 3H7DA 1Y4HA 1AU0A 4W5CA 1ATKA 1AU4A 2IBIA 3NHEA 2YJ2A 3OF8A 5EGWA 4QRGA 4YYSA 2OZ2A 2Y5BA 3BC3A 4PI3A 1NQCA 1O0EA 4X6JA 2H7JA 1KHQA 1ME3A 4MZSA 4BQVA 3HWNA 1GCBA 1CB5A 3MHSA 2AUXA 2XU5A 3P5WA 2DC8A 4BPVA 3BPFA 1ITOA 1TU6A 3PW3A 3CBJA 3LFYA 2PBHA 1KXRA 1ZIVA 3D6SA 1U9VA 3MORA 1NL6A 2GFOA 1AYWA 1KFUL 4X6IA 4YYVA 4RY2A 4BSQA 2B1NA 1EWPA 5A24A 4W4UA 3KKUA 2ACTA 4YVAA 1QOLA 4PADA 2G8EA 2R6NA 1KHPA 4DMXA 2PADA 1ME4A 3LXSA 3TNXA 3N4CA 4K7CA 1A6RA 1POPA 1NLJA 4P6GA 3KWZA 1PE6A 3IUTA 2XU3A 1QXPA 1NPZA 4DMYA 1CTEA 4FJCA 4X6HA 2E03A 1AYVA 3DF0A 1SP4B 2OULA 1PCIA 2DCCA 1U5IA 2P86A 4BS6A 2P7UA 1STFE 1PIPA 3BPMA 3KX1A 4CDCB 3OVZA 5PADA 4CDFB 3P5VA 2OP3A 3H8CA 2DC9A 3K8UA 5K16A 1JQPA 3GCBA 2VHFA 3I3TA 3RVVA 1NB5A 3E1ZB 1GMYA 2GHUA 1MIRA 5J94A 2B1MA 3ZUAA 3OF9A 1PBHA 1U9WA 2NQIA 2XU4A 1MEMA 4AXMA 5JH3A 2C0YA 3O0UA 4PP1A 4CDDB 3QJ3A 7PCKA 2XU1A 1CPJA 1YK8A 1F2BA 2R9NA 3V6CA 3WXFA 1K3BB 2AIMA 1CJLA 2FO5A 1YT7A 4OELA 4FIPA 2DC7A 1DF0A 4N8WA 2AYNA 2Y6EA 1EWOA 2DJGB 2R9MA 1YVBA 6PADA
chains in the Genus database with same CATH superfamily
2CB5A 5F02A 2JRIA 1EWLA 3KFQA 3BOWA 1PPOA 1PXVA 3BBAA 4PT5A 4P6EA 3AI8A 1EWMA 1U9QX 3MP2A 4AXLA 2BDLA 2WBFX 4QRXA 3I06A 4XUIA 1FH0A 4BOZA 2FYEA 4BOPA 2NQGA 4MM3B 4GUAA 2DZZA 2HHNA 2JQGR 3IFUA 2AS8A 1Y08A 2PREA 5CHVA 3M99A 3TMPA 3QSDA 2F1GA 2G7YA 3CH3X 2YJ8A 2E02A 4QH6A 5JZEA 2FT2A 2R9FA 1PADA 1AU2A 3KWBX 3IMAA 4N79A 5CHTA 2E01A 3CBKA 3H8BA 3HHAA 4IUMA 2HD5A 3PSEA 1EF7A 3PDFA 3PNRA 4CZWA 1BP4A 3ERVA 4YYQA 2BTWA 2CIOA 4CDEB 2YJ9A 3BWKA 3P5UA 1VSNA 2NQDB 4RF0A 4OW0A 8PCHA 3OISA 1AECA 4XR7A 2ATOA 1BGOA 5KO3A 3MTVA 1PPNA 4PP2E 3RVXA 5CVNB 4I04A 1PPDA 4W5BA 1CSBB 1S4VA 1SNKA 4YYUA 3WXGA 4YYRA 1AIMA 2R9CA 2DCDA 2YJCA 5JA7A 1NB3A 2AU1A 2HWKA 1IWDA 3F75A 2E00A 2FQ9A 5EF4A 3O1GA 1GLOA 4M0WA 2DZYA 1UKFA 1QDQA 2BU3A 3RVWA 5FPWA 3HHIA 3B79A 3H6SA 2DC6A 1CV8A 4FK5A 4G54A 2UZJA 3W30A 4ZUXU 5CVMA 9PAPA 4OEMA 4YYWA 3PBHA 5EZQA 3OQCA 4IP3A 3P5XA 1AU3A 4HWYA 1F29A 1M6DA 2AUZA 2G8JA 4Q8GA 1U9XA 1THEA 2O6XA 2P0RA 1CVZA 1PPPA 2HXZA 1PVJA 2FUDA 3H89A 1MDWA 2R9OA 3S3QA 3OVXA 4YV8A 3IV2A 4I07A 4KLBA 1CQDA 1F2AA 1YALA 2JQFR 2JTCA 4RKXA 4WA6A 2F7DA 3MTNA 3QT4A 1YK7A 3ZNHA 4BS5A 3HD3A 3V6EA 2FTDA 1Q6KA 1ZCMA 2ARYA 3N3GA 1HUCB 3PHXA 4D8BA 5CVOB 1MHWA 3PRMA 3MHHA 1F2CA 2G6DA 3U8EA 2FRAA 2AYOA 1AYUA 4N4ZA 3CH2X 2NQAA 2HH5A 1TL9A 3BCNA 1DEUA 1VJVA 2FRQA 3O65A 4QBBA 4QRVA 4BOSA 3F5VA 3IHPA 3C9EA 1KFXL 1QMYA 3KSEA 3IOQA 1MEGA 3IEJA 4MSXA 2BDZA 2PNSA 4MZOA 2DCBA 4ZTBA 3WXEA 3K24A 1MS6A 3BY4A 1TLOA 4Q8HA 4XZXA 2YJBA 1BQIA 2IPPB 3B21A 4A5UA 3USVA 1ICFA 3N3KA 1CS8A 3RNVA 2DCAA 2DJFB 1BY8A 1X9YA 1GECE 2AVWA 3K9MA 3S3RA 3KW9A 4D8EA 2J7QC 4I05A 2VHSA 1XKGA 3H7DA 1Y4HA 5EZSA 1AU0A 4W5CA 1ATKA 1AU4A 2IBIA 3NHEA 4HXDB 2YJ2A 3OF8A 4BOQA 2AGAA 3BB7A 5EGWA 4QRGA 4YYSA 2OZ2A 2Y5BA 3BC3A 5E6JA 4PI3A 1NQCA 1O0EA 4X6JA 2H7JA 3C0RA 1KHQA 1ME3A 4MZSA 4BQVA 3HWNA 1GCBA 1CB5A 3MHSA 2AUXA 3PT2A 1DKIA 2XU5A 3P5WA 2DC8A 4BPVA 3BPFA 1ITOA 4R3DA 1TU6A 3PW3A 4P16A 3CBJA 3LFYA 2PBHA 1KXRA 3PRPA 1ZIVA 2DOSA 3D6SA 1U9VA 3MORA 1NL6A 2GFOA 1AYWA 1KFUL 4X6IA 4OVZB 4YYVA 4RY2A 4BSQA 2B1NA 1EWPA 5A24A 4W4UA 3KKUA 2ACTA 4BOUA 4YVAA 1QOLA 4PADA 2G8EA 2R6NA 1KHPA 3PHWA 4DMXA 2PADA 1ME4A 3LXSA 3TNXA 3N4CA 4K7CA 1A6RA 1POPA 1NLJA 4P6GA 3KWZA 1PE6A 3IUTA 3MJ5A 2XU3A 1QXPA 1NPZA 4DMYA 1CTEA 4MI7A 4FJCA 1YZBA 4X6HA 2E03A 1AYVA 3DF0A 4RNAA 1SP4B 3W31A 2OULA 1PCIA 2DCCA 1U5IA 2P86A 4BS6A 2P7UA 1STFE 2J7QA 1PIPA 3BPMA 3E9SA 3KX1A 4CDCB 3OVZA 5PADA 4CDFB 3P5VA 2OP3A 3H8CA 2BTWB 2DC9A 3K8UA 5K16A 1JQPA 3GCBA 2VHFA 3I3TA 3RVVA 1NB5A 3E1ZB 4RF1A 1GMYA 4REZA 2GHUA 1MIRA 5J94A 2B1MA 3ZUAA 3OF9A 1PBHA 1U9WA 2NQIA 2XU4A 2FE8A 1MEMA 4AXMA 3PHUA 5JH3A 2C0YA 3O0UA 4PP1A 4CDDB 3QJ3A 2Z84A 7PCKA 2XU1A 4WURA 1CPJA 3TRKA 1YK8A 1F2BA 2R9NA 3V6CA 3WXFA 1K3BB 2AIMA 1CJLA 2FO5A 4OVZA 1YT7A 4OELA 4FIPA 2DC7A 1DF0A 4N8WA 2AYNA 2Y6EA 1EWOA 2DJGB 2R9MA 4D8IA 1YVBA 6PADA
chains in the Genus database with same CATH topology
2CB5A 5F02A 1EWLA 3KFQA 3BOWA 1PPOA 1PXVA 4P6EA 3AI8A 1EWMA 1U9QX 1E2TA 4AXLA 2BDLA 2WBFX 4QRXA 3I06A 4XUIA 1FH0A 2FYEA 2NQGA 2DZZA 2HHNA 2JQGR 2AS8A 1Y08A 2PREA 5CHVA 3M99A 3QSDA 2F1GA 2G7YA 3CH3X 2YJ8A 4BGFA 2E02A 4QH6A 2FT2A 2R9FA 1PADA 1AU2A 3KWBX 3IMAA 4N79A 5CHTA 2E01A 3CBKA 3H8BA 3HHAA 2HD5A 1EF7A 3PDFA 3PNRA 4CZWA 1BP4A 3ERVA 4YYQA 2CIOA 4CDEB 2YJ9A 3BWKA 3P5UA 1VSNA 2NQDB 8PCHA 3OISA 1AECA 4XR7A 2ATOA 1BGOA 1PPNA 4PP2E 3RVXA 5CVNB 4I04A 1PPDA 4W5BA 1CSBB 1S4VA 1SNKA 4YYUA 3WXGA 4B55A 4YYRA 1AIMA 2R9CA 2DCDA 2VFBA 2YJCA 5JA7A 1NB3A 2AU1A 1IWDA 3F75A 1W4TA 2E00A 2FQ9A 5EF4A 3O1GA 1GLOA 2DZYA 1QDQA 3RVWA 5FPWA 3HHIA 3B79A 3H6SA 2DC6A 1CV8A 4FK5A 4G54A 4GUZA 4ZUXU 5CVMA 9PAPA 4OEMA 4YYWA 3PBHA 3P5XA 1AU3A 4HWYA 1F29A 1M6DA 2AUZA 2G8JA 4Q8GA 1U9XA 1THEA 2O6XA 2P0RA 1CVZA 1PPPA 2HXZA 2FUDA 3H89A 1MDWA 2R9OA 3S3QA 3OVXA 4YV8A 3IV2A 4I07A 4KLBA 1CQDA 1F2AA 1YALA 2JQFR 4WA6A 2F7DA 3D9WA 3MTNA 3QT4A 1YK7A 4BS5A 3HD3A 3V6EA 2FTDA 1Q6KA 1ZCMA 2ARYA 3N3GA 1HUCB 5CVOB 1MHWA 3MHHA 1F2CA 2G6DA 3U8EA 2FRAA 2AYOA 1AYUA 4N4ZA 3CH2X 2NQAA 2HH5A 1TL9A 3BCNA 1DEUA 1VJVA 2FRQA 4QBBA 4QRVA 3F5VA 3IHPA 3C9EA 1KFXL 1QMYA 3KSEA 3IOQA 1MEGA 4NV8A 3IEJA 4MSXA 2BDZA 2PNSA 4MZOA 2DCBA 3WXEA 2VFCA 3K24A 1MS6A 1TLOA 4Q8HA 2YJBA 1BQIA 2IPPB 3USVA 1ICFA 3N3KA 1CS8A 2DCAA 2DJFB 1BY8A 1X9YA 1GECE 2AVWA 3K9MA 3S3RA 3KW9A 4I05A 2VHSA 1XKGA 3H7DA 1Y4HA 1AU0A 4W5CA 1ATKA 1AU4A 2IBIA 3NHEA 2YJ2A 3OF8A 5EGWA 4NV7A 4QRGA 4YYSA 2OZ2A 2Y5BA 3BC3A 4PI3A 1NQCA 1O0EA 4X6JA 2H7JA 1KHQA 1ME3A 4MZSA 4BQVA 3HWNA 1GCBA 1CB5A 3MHSA 2AUXA 2XU5A 3P5WA 2DC8A 4BPVA 3BPFA 1ITOA 1TU6A 3PW3A 1W5RA 3CBJA 3LFYA 2PBHA 1KXRA 1ZIVA 3D6SA 1U9VA 3MORA 1NL6A 2GFOA 1AYWA 1KFUL 4X6IA 4YYVA 4RY2A 4BSQA 2B1NA 1EWPA 5A24A 4W4UA 3KKUA 2ACTA 4YVAA 1QOLA 4PADA 1GX3A 2G8EA 2R6NA 1KHPA 4C5PA 4DMXA 2PADA 1ME4A 3LXSA 3TNXA 3N4CA 4K7CA 1A6RA 1POPA 1NLJA 4P6GA 3KWZA 1PE6A 3IUTA 2XU3A 1QXPA 1NPZA 4DMYA 1CTEA 4FJCA 4X6HA 2E03A 1W6FA 1AYVA 3DF0A 1SP4B 2OULA 1PCIA 2DCCA 1U5IA 2P86A 4BS6A 2P7UA 1STFE 3LTWA 1PIPA 3BPMA 3KX1A 4CDCB 3OVZA 5PADA 4CDFB 3P5VA 2OP3A 3H8CA 2DC9A 3K8UA 5K16A 1JQPA 3GCBA 2VHFA 3I3TA 3RVVA 2BSZA 1NB5A 3E1ZB 1GMYA 2GHUA 1MIRA 5J94A 2B1MA 3ZUAA 3OF9A 1PBHA 1U9WA 2NQIA 2XU4A 1MEMA 4AXMA 5JH3A 2C0YA 3O0UA 4PP1A 4CDDB 3QJ3A 7PCKA 2XU1A 1CPJA 1YK8A 1F2BA 2R9NA 3V6CA 3WXFA 1K3BB 2AIMA 1CJLA 2FO5A 1YT7A 4OELA 4FIPA 2DC7A 1DF0A 4N8WA 2AYNA 2Y6EA 1EWOA 2DJGB 2R9MA 1YVBA 6PADA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CB5 A;  5F02 A;  1EWL A;  3KFQ A;  3BOW A;  1PPO A;  1PXV A;  4P6E A;  3AI8 A;  1EWM A;  1U9Q X;  4AXL A;  2BDL A;  2WBF X;  4QRX A;  3I06 A;  4XUI A;  1FH0 A;  2FYE A;  2NQG A;  2DZZ A;  2HHN A;  2JQG R;  2AS8 A;  1Y08 A;  2PRE A;  5CHV A;  3M99 A;  3QSD A;  2F1G A;  2G7Y A;  3CH3 X;  2YJ8 A;  2E02 A;  4QH6 A;  2FT2 A;  2R9F A;  1PAD A;  1AU2 A;  3KWB X;  3IMA A;  4N79 A;  5CHT A;  2E01 A;  3CBK A;  3H8B A;  3HHA A;  2HD5 A;  1EF7 A;  3PDF A;  3PNR A;  4CZW A;  1BP4 A;  3ERV A;  4YYQ A;  2CIO A;  4CDE B;  2YJ9 A;  3BWK A;  3P5U A;  1VSN A;  2NQD B;  8PCH A;  3OIS A;  1AEC A;  4XR7 A;  2ATO A;  1BGO A;  1PPN A;  4PP2 E;  3RVX A;  5CVN B;  4I04 A;  1PPD A;  4W5B A;  1CSB B;  1S4V A;  1SNK A;  4YYU A;  3WXG A;  4YYR A;  1AIM A;  2R9C A;  2DCD A;  2YJC A;  5JA7 A;  1NB3 A;  2AU1 A;  1IWD A;  3F75 A;  2E00 A;  2FQ9 A;  5EF4 A;  3O1G A;  1GLO A;  2DZY A;  1QDQ A;  3RVW A;  5FPW A;  3HHI A;  3B79 A;  3H6S A;  2DC6 A;  1CV8 A;  4FK5 A;  4G54 A;  4ZUX U;  5CVM A;  9PAP A;  4OEM A;  4YYW A;  3PBH A;  3P5X A;  1AU3 A;  4HWY A;  1F29 A;  1M6D A;  2AUZ A;  2G8J A;  4Q8G A;  1U9X A;  1THE A;  2O6X A;  2P0R A;  1CVZ A;  1PPP A;  2HXZ A;  2FUD A;  3H89 A;  1MDW A;  2R9O A;  3S3Q A;  3OVX A;  4YV8 A;  3IV2 A;  4I07 A;  4KLB A;  1CQD A;  1F2A A;  1YAL A;  2JQF R;  4WA6 A;  2F7D A;  3MTN A;  3QT4 A;  1YK7 A;  4BS5 A;  3HD3 A;  3V6E A;  2FTD A;  1Q6K A;  1ZCM A;  2ARY A;  3N3G A;  1HUC B;  5CVO B;  1MHW A;  3MHH A;  1F2C A;  2G6D A;  3U8E A;  2FRA A;  2AYO A;  1AYU A;  4N4Z A;  3CH2 X;  2NQA A;  2HH5 A;  1TL9 A;  3BCN A;  1DEU A;  1VJV A;  2FRQ A;  4QBB A;  4QRV A;  3F5V A;  3IHP A;  3C9E A;  1KFX L;  1QMY A;  3KSE A;  3IOQ A;  1MEG A;  3IEJ A;  4MSX A;  2BDZ A;  2PNS A;  4MZO A;  2DCB A;  3WXE A;  3K24 A;  1MS6 A;  1TLO A;  4Q8H A;  2YJB A;  1BQI A;  2IPP B;  3USV A;  1ICF A;  3N3K A;  1CS8 A;  2DCA A;  2DJF B;  1BY8 A;  1X9Y A;  1GEC E;  2AVW A;  3K9M A;  3S3R A;  3KW9 A;  4I05 A;  2VHS A;  1XKG A;  3H7D A;  1Y4H A;  1AU0 A;  4W5C A;  1ATK A;  1AU4 A;  2IBI A;  3NHE A;  2YJ2 A;  3OF8 A;  5EGW A;  4QRG A;  4YYS A;  2OZ2 A;  2Y5B A;  3BC3 A;  4PI3 A;  1NQC A;  1O0E A;  4X6J A;  2H7J A;  1KHQ A;  1ME3 A;  4MZS A;  4BQV A;  3HWN A;  1GCB A;  1CB5 A;  3MHS A;  2AUX A;  2XU5 A;  3P5W A;  2DC8 A;  4BPV A;  3BPF A;  1ITO A;  1TU6 A;  3PW3 A;  3CBJ A;  3LFY A;  2PBH A;  1KXR A;  1ZIV A;  3D6S A;  1U9V A;  3MOR A;  1NL6 A;  2GFO A;  1AYW A;  1KFU L;  4X6I A;  4YYV A;  4RY2 A;  4BSQ A;  2B1N A;  1EWP A;  5A24 A;  4W4U A;  3KKU A;  2ACT A;  4YVA A;  1QOL A;  4PAD A;  2G8E A;  2R6N A;  1KHP A;  4DMX A;  2PAD A;  1ME4 A;  3LXS A;  3TNX A;  3N4C A;  4K7C A;  1A6R A;  1POP A;  1NLJ A;  4P6G A;  3KWZ A;  1PE6 A;  3IUT A;  2XU3 A;  1QXP A;  1NPZ A;  4DMY A;  1CTE A;  4FJC A;  4X6H A;  2E03 A;  1AYV A;  3DF0 A;  1SP4 B;  2OUL A;  1PCI A;  2DCC A;  1U5I A;  2P86 A;  4BS6 A;  2P7U A;  1STF E;  1PIP A;  3BPM A;  3KX1 A;  4CDC B;  3OVZ A;  5PAD A;  4CDF B;  3P5V A;  2OP3 A;  3H8C A;  2DC9 A;  3K8U A;  5K16 A;  1JQP A;  3GCB A;  2VHF A;  3I3T A;  3RVV A;  1NB5 A;  3E1Z B;  1GMY A;  2GHU A;  1MIR A;  5J94 A;  2B1M A;  3ZUA A;  3OF9 A;  1PBH A;  1U9W A;  2NQI A;  2XU4 A;  1MEM A;  4AXM A;  5JH3 A;  2C0Y A;  3O0U A;  4PP1 A;  4CDD B;  3QJ3 A;  7PCK A;  2XU1 A;  1CPJ A;  1YK8 A;  1F2B A;  2R9N A;  3V6C A;  3WXF A;  1K3B B;  2AIM A;  1CJL A;  2FO5 A;  1YT7 A;  4OEL A;  4FIP A;  2DC7 A;  1DF0 A;  4N8W A;  2AYN A;  2Y6E A;  1EWO A;  2DJG B;  2R9M A;  1YVB A;  6PAD A; 
#chains in the Genus database with same CATH topology
 2CB5 A;  5F02 A;  2JRI A;  1EWL A;  3KFQ A;  3BOW A;  1PPO A;  1PXV A;  3BBA A;  4PT5 A;  4P6E A;  3AI8 A;  1EWM A;  1U9Q X;  3MP2 A;  4AXL A;  2BDL A;  2WBF X;  4QRX A;  3I06 A;  4XUI A;  1FH0 A;  4BOZ A;  2FYE A;  4BOP A;  2NQG A;  4MM3 B;  4GUA A;  2DZZ A;  2HHN A;  2JQG R;  3IFU A;  2AS8 A;  1Y08 A;  2PRE A;  5CHV A;  3M99 A;  3TMP A;  3QSD A;  2F1G A;  2G7Y A;  3CH3 X;  2YJ8 A;  2E02 A;  4QH6 A;  5JZE A;  2FT2 A;  2R9F A;  1PAD A;  1AU2 A;  3KWB X;  3IMA A;  4N79 A;  5CHT A;  2E01 A;  3CBK A;  3H8B A;  3HHA A;  4IUM A;  2HD5 A;  3PSE A;  1EF7 A;  3PDF A;  3PNR A;  4CZW A;  1BP4 A;  3ERV A;  4YYQ A;  2BTW A;  2CIO A;  4CDE B;  2YJ9 A;  3BWK A;  3P5U A;  1VSN A;  2NQD B;  4RF0 A;  4OW0 A;  8PCH A;  3OIS A;  1AEC A;  4XR7 A;  2ATO A;  1BGO A;  5KO3 A;  3MTV A;  1PPN A;  4PP2 E;  3RVX A;  5CVN B;  4I04 A;  1PPD A;  4W5B A;  1CSB B;  1S4V A;  1SNK A;  4YYU A;  3WXG A;  4YYR A;  1AIM A;  2R9C A;  2DCD A;  2YJC A;  5JA7 A;  1NB3 A;  2AU1 A;  2HWK A;  1IWD A;  3F75 A;  2E00 A;  2FQ9 A;  5EF4 A;  3O1G A;  1GLO A;  4M0W A;  2DZY A;  1UKF A;  1QDQ A;  2BU3 A;  3RVW A;  5FPW A;  3HHI A;  3B79 A;  3H6S A;  2DC6 A;  1CV8 A;  4FK5 A;  4G54 A;  2UZJ A;  3W30 A;  4ZUX U;  5CVM A;  9PAP A;  4OEM A;  4YYW A;  3PBH A;  5EZQ A;  3OQC A;  4IP3 A;  3P5X A;  1AU3 A;  4HWY A;  1F29 A;  1M6D A;  2AUZ A;  2G8J A;  4Q8G A;  1U9X A;  1THE A;  2O6X A;  2P0R A;  1CVZ A;  1PPP A;  2HXZ A;  1PVJ A;  2FUD A;  3H89 A;  1MDW A;  2R9O A;  3S3Q A;  3OVX A;  4YV8 A;  3IV2 A;  4I07 A;  4KLB A;  1CQD A;  1F2A A;  1YAL A;  2JQF R;  2JTC A;  4RKX A;  4WA6 A;  2F7D A;  3MTN A;  3QT4 A;  1YK7 A;  3ZNH A;  4BS5 A;  3HD3 A;  3V6E A;  2FTD A;  1Q6K A;  1ZCM A;  2ARY A;  3N3G A;  1HUC B;  3PHX A;  4D8B A;  5CVO B;  1MHW A;  3PRM A;  3MHH A;  1F2C A;  2G6D A;  3U8E A;  2FRA A;  2AYO A;  1AYU A;  4N4Z A;  3CH2 X;  2NQA A;  2HH5 A;  1TL9 A;  3BCN A;  1DEU A;  1VJV A;  2FRQ A;  3O65 A;  4QBB A;  4QRV A;  4BOS A;  3F5V A;  3IHP A;  3C9E A;  1KFX L;  1QMY A;  3KSE A;  3IOQ A;  1MEG A;  3IEJ A;  4MSX A;  2BDZ A;  2PNS A;  4MZO A;  2DCB A;  4ZTB A;  3WXE A;  3K24 A;  1MS6 A;  3BY4 A;  1TLO A;  4Q8H A;  4XZX A;  2YJB A;  1BQI A;  2IPP B;  3B21 A;  4A5U A;  3USV A;  1ICF A;  3N3K A;  1CS8 A;  3RNV A;  2DCA A;  2DJF B;  1BY8 A;  1X9Y A;  1GEC E;  2AVW A;  3K9M A;  3S3R A;  3KW9 A;  4D8E A;  2J7Q C;  4I05 A;  2VHS A;  1XKG A;  3H7D A;  1Y4H A;  5EZS A;  1AU0 A;  4W5C A;  1ATK A;  1AU4 A;  2IBI A;  3NHE A;  4HXD B;  2YJ2 A;  3OF8 A;  4BOQ A;  2AGA A;  3BB7 A;  5EGW A;  4QRG A;  4YYS A;  2OZ2 A;  2Y5B A;  3BC3 A;  5E6J A;  4PI3 A;  1NQC A;  1O0E A;  4X6J A;  2H7J A;  3C0R A;  1KHQ A;  1ME3 A;  4MZS A;  4BQV A;  3HWN A;  1GCB A;  1CB5 A;  3MHS A;  2AUX A;  3PT2 A;  1DKI A;  2XU5 A;  3P5W A;  2DC8 A;  4BPV A;  3BPF A;  1ITO A;  4R3D A;  1TU6 A;  3PW3 A;  4P16 A;  3CBJ A;  3LFY A;  2PBH A;  1KXR A;  3PRP A;  1ZIV A;  2DOS A;  3D6S A;  1U9V A;  3MOR A;  1NL6 A;  2GFO A;  1AYW A;  1KFU L;  4X6I A;  4OVZ B;  4YYV A;  4RY2 A;  4BSQ A;  2B1N A;  1EWP A;  5A24 A;  4W4U A;  3KKU A;  2ACT A;  4BOU A;  4YVA A;  1QOL A;  4PAD A;  2G8E A;  2R6N A;  1KHP A;  3PHW A;  4DMX A;  2PAD A;  1ME4 A;  3LXS A;  3TNX A;  3N4C A;  4K7C A;  1A6R A;  1POP A;  1NLJ A;  4P6G A;  3KWZ A;  1PE6 A;  3IUT A;  3MJ5 A;  2XU3 A;  1QXP A;  1NPZ A;  4DMY A;  1CTE A;  4MI7 A;  4FJC A;  1YZB A;  4X6H A;  2E03 A;  1AYV A;  3DF0 A;  4RNA A;  1SP4 B;  3W31 A;  2OUL A;  1PCI A;  2DCC A;  1U5I A;  2P86 A;  4BS6 A;  2P7U A;  1STF E;  2J7Q A;  1PIP A;  3BPM A;  3E9S A;  3KX1 A;  4CDC B;  3OVZ A;  5PAD A;  4CDF B;  3P5V A;  2OP3 A;  3H8C A;  2BTW B;  2DC9 A;  3K8U A;  5K16 A;  1JQP A;  3GCB A;  2VHF A;  3I3T A;  3RVV A;  1NB5 A;  3E1Z B;  4RF1 A;  1GMY A;  4REZ A;  2GHU A;  1MIR A;  5J94 A;  2B1M A;  3ZUA A;  3OF9 A;  1PBH A;  1U9W A;  2NQI A;  2XU4 A;  2FE8 A;  1MEM A;  4AXM A;  3PHU A;  5JH3 A;  2C0Y A;  3O0U A;  4PP1 A;  4CDD B;  3QJ3 A;  2Z84 A;  7PCK A;  2XU1 A;  4WUR A;  1CPJ A;  3TRK A;  1YK8 A;  1F2B A;  2R9N A;  3V6C A;  3WXF A;  1K3B B;  2AIM A;  1CJL A;  2FO5 A;  4OVZ A;  1YT7 A;  4OEL A;  4FIP A;  2DC7 A;  1DF0 A;  4N8W A;  2AYN A;  2Y6E A;  1EWO A;  2DJG B;  2R9M A;  4D8I A;  1YVB A;  6PAD A; 
#chains in the Genus database with same CATH homology
 2CB5 A;  5F02 A;  1EWL A;  3KFQ A;  3BOW A;  1PPO A;  1PXV A;  4P6E A;  3AI8 A;  1EWM A;  1U9Q X;  1E2T A;  4AXL A;  2BDL A;  2WBF X;  4QRX A;  3I06 A;  4XUI A;  1FH0 A;  2FYE A;  2NQG A;  2DZZ A;  2HHN A;  2JQG R;  2AS8 A;  1Y08 A;  2PRE A;  5CHV A;  3M99 A;  3QSD A;  2F1G A;  2G7Y A;  3CH3 X;  2YJ8 A;  4BGF A;  2E02 A;  4QH6 A;  2FT2 A;  2R9F A;  1PAD A;  1AU2 A;  3KWB X;  3IMA A;  4N79 A;  5CHT A;  2E01 A;  3CBK A;  3H8B A;  3HHA A;  2HD5 A;  1EF7 A;  3PDF A;  3PNR A;  4CZW A;  1BP4 A;  3ERV A;  4YYQ A;  2CIO A;  4CDE B;  2YJ9 A;  3BWK A;  3P5U A;  1VSN A;  2NQD B;  8PCH A;  3OIS A;  1AEC A;  4XR7 A;  2ATO A;  1BGO A;  1PPN A;  4PP2 E;  3RVX A;  5CVN B;  4I04 A;  1PPD A;  4W5B A;  1CSB B;  1S4V A;  1SNK A;  4YYU A;  3WXG A;  4B55 A;  4YYR A;  1AIM A;  2R9C A;  2DCD A;  2VFB A;  2YJC A;  5JA7 A;  1NB3 A;  2AU1 A;  1IWD A;  3F75 A;  1W4T A;  2E00 A;  2FQ9 A;  5EF4 A;  3O1G A;  1GLO A;  2DZY A;  1QDQ A;  3RVW A;  5FPW A;  3HHI A;  3B79 A;  3H6S A;  2DC6 A;  1CV8 A;  4FK5 A;  4G54 A;  4GUZ A;  4ZUX U;  5CVM A;  9PAP A;  4OEM A;  4YYW A;  3PBH A;  3P5X A;  1AU3 A;  4HWY A;  1F29 A;  1M6D A;  2AUZ A;  2G8J A;  4Q8G A;  1U9X A;  1THE A;  2O6X A;  2P0R A;  1CVZ A;  1PPP A;  2HXZ A;  2FUD A;  3H89 A;  1MDW A;  2R9O A;  3S3Q A;  3OVX A;  4YV8 A;  3IV2 A;  4I07 A;  4KLB A;  1CQD A;  1F2A A;  1YAL A;  2JQF R;  4WA6 A;  2F7D A;  3D9W A;  3MTN A;  3QT4 A;  1YK7 A;  4BS5 A;  3HD3 A;  3V6E A;  2FTD A;  1Q6K A;  1ZCM A;  2ARY A;  3N3G A;  1HUC B;  5CVO B;  1MHW A;  3MHH A;  1F2C A;  2G6D A;  3U8E A;  2FRA A;  2AYO A;  1AYU A;  4N4Z A;  3CH2 X;  2NQA A;  2HH5 A;  1TL9 A;  3BCN A;  1DEU A;  1VJV A;  2FRQ A;  4QBB A;  4QRV A;  3F5V A;  3IHP A;  3C9E A;  1KFX L;  1QMY A;  3KSE A;  3IOQ A;  1MEG A;  4NV8 A;  3IEJ A;  4MSX A;  2BDZ A;  2PNS A;  4MZO A;  2DCB A;  3WXE A;  2VFC A;  3K24 A;  1MS6 A;  1TLO A;  4Q8H A;  2YJB A;  1BQI A;  2IPP B;  3USV A;  1ICF A;  3N3K A;  1CS8 A;  2DCA A;  2DJF B;  1BY8 A;  1X9Y A;  1GEC E;  2AVW A;  3K9M A;  3S3R A;  3KW9 A;  4I05 A;  2VHS A;  1XKG A;  3H7D A;  1Y4H A;  1AU0 A;  4W5C A;  1ATK A;  1AU4 A;  2IBI A;  3NHE A;  2YJ2 A;  3OF8 A;  5EGW A;  4NV7 A;  4QRG A;  4YYS A;  2OZ2 A;  2Y5B A;  3BC3 A;  4PI3 A;  1NQC A;  1O0E A;  4X6J A;  2H7J A;  1KHQ A;  1ME3 A;  4MZS A;  4BQV A;  3HWN A;  1GCB A;  1CB5 A;  3MHS A;  2AUX A;  2XU5 A;  3P5W A;  2DC8 A;  4BPV A;  3BPF A;  1ITO A;  1TU6 A;  3PW3 A;  1W5R A;  3CBJ A;  3LFY A;  2PBH A;  1KXR A;  1ZIV A;  3D6S A;  1U9V A;  3MOR A;  1NL6 A;  2GFO A;  1AYW A;  1KFU L;  4X6I A;  4YYV A;  4RY2 A;  4BSQ A;  2B1N A;  1EWP A;  5A24 A;  4W4U A;  3KKU A;  2ACT A;  4YVA A;  1QOL A;  4PAD A;  1GX3 A;  2G8E A;  2R6N A;  1KHP A;  4C5P A;  4DMX A;  2PAD A;  1ME4 A;  3LXS A;  3TNX A;  3N4C A;  4K7C A;  1A6R A;  1POP A;  1NLJ A;  4P6G A;  3KWZ A;  1PE6 A;  3IUT A;  2XU3 A;  1QXP A;  1NPZ A;  4DMY A;  1CTE A;  4FJC A;  4X6H A;  2E03 A;  1W6F A;  1AYV A;  3DF0 A;  1SP4 B;  2OUL A;  1PCI A;  2DCC A;  1U5I A;  2P86 A;  4BS6 A;  2P7U A;  1STF E;  3LTW A;  1PIP A;  3BPM A;  3KX1 A;  4CDC B;  3OVZ A;  5PAD A;  4CDF B;  3P5V A;  2OP3 A;  3H8C A;  2DC9 A;  3K8U A;  5K16 A;  1JQP A;  3GCB A;  2VHF A;  3I3T A;  3RVV A;  2BSZ A;  1NB5 A;  3E1Z B;  1GMY A;  2GHU A;  1MIR A;  5J94 A;  2B1M A;  3ZUA A;  3OF9 A;  1PBH A;  1U9W A;  2NQI A;  2XU4 A;  1MEM A;  4AXM A;  5JH3 A;  2C0Y A;  3O0U A;  4PP1 A;  4CDD B;  3QJ3 A;  7PCK A;  2XU1 A;  1CPJ A;  1YK8 A;  1F2B A;  2R9N A;  3V6C A;  3WXF A;  1K3B B;  2AIM A;  1CJL A;  2FO5 A;  1YT7 A;  4OEL A;  4FIP A;  2DC7 A;  1DF0 A;  4N8W A;  2AYN A;  2Y6E A;  1EWO A;  2DJG B;  2R9M A;  1YVB A;  6PAD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...