3IOQA

Crystal structure of the carica candamarcensis cysteine protease cms1ms2 in complex with e-64.
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
213
structure length
213
Chain Sequence
IPTSIDWRQKGAVTPVRNQGGCGSCWTFSSVAAVEGINKIVTGQLLSLSEQELLDCERRSYGCRGGFPLYALQYVANSGIHLRQYYPYEGVQRQCRASQAKGPKVKTDGVGRVPRNNEQALIQRIAIQPVSIVVEAKGRAFQNYRGGIFAGPCGTSIDHAVAAVGYGNDYILIKNSWGTGWGEGGYIRIKRGSGNPQGACGVLSDSVFPTKNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords CMS1MS2
publication title Crystal structure of the Carica candamarcensis cysteine protease CMS1MS2 in complex with E-64
rcsb
total genus 65
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 2009-08-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3ioqA00
1QDQA 4YYRA 2BDLA 2XU1A 1ICFA 3AI8A 1CSBB 3IOQA 1ATKA 1IWDA 1MHWA 2G8JA 1KFXL 1GLOA 2IPPB 1BY8A 3MTNA 2OZ2A 4BS6A 4YYQA 3IV2A 2E02A 1GECE 5JH3A 2E00A 3N4CA 5F02A 3RVVA 2PNSA 2DCDA 3RVWA 2NQDB 2JQFR 2VHFA 2OP3A 1ZIVA 2R9FA 1AU3A 1AECA 3CH2X 4YYVA 1CPJA 2C0YA 2ARYA 2PADA 6PADA 1U9XA 2R6NA 3ERVA 2Y5BA 4W5BA 1SP4B 4KLBA 5CHVA 4PP2E 1KXRA 2XU5A 3P5UA 3BPMA 1DEUA 3MORA 1PCIA 2AUXA 1GCBA 1QXPA 5CVMA 2FQ9A 5K16A 2B1NA 4XR7A 2YJ8A 4MSXA 1EWLA 2DC6A 3LFYA 2FUDA 3ZUAA 1POPA 3KFQA 3P5VA 3D6SA 1SNKA 4QH6A 1CJLA 2JQGR 1MIRA 1AYWA 2CB5A 1QOLA 1CVZA 2DJGB 3OF9A 9PAPA 3K24A 1Y08A 1U9QX 1M6DA 2P0RA 1CTEA 2AU1A 2HHNA 4QRGA 2DJFB 3H8BA 1F2CA 3H89A 1PXVA 5CVOB 3NHEA 3N3GA 2IBIA 4FIPA 4QRXA 3WXEA 3BPFA 4I07A 3LXSA 3S3QA 3V6CA 4W4UA 3IUTA 1NPZA 1DF0A 4WA6A 7PCKA 1STFE 2G8EA 4N79A 2DCCA 1NQCA 1CB5A 2WBFX 8PCHA 2NQIA 2AYNA 2YJ2A 3F5VA 1TL9A 4PADA 3WXGA 3QJ3A 2NQGA 2DCBA 4G54A 1A6RA 2BDZA 1KHPA 2HXZA 1F29A 3E1ZB 3KKUA 2YJCA 2YJ9A 3KW9A 1X9YA 4CDFB 3GCBA 4YV8A 5CVNB 2R9MA 2YJBA 1BGOA 4BSQA 2AS8A 2FRAA 1TLOA 4N4ZA 2DC9A 1YK7A 3K9MA 3MHHA 2E01A 1QMYA 1AU0A 2P7UA 1YALA 3IMAA 1MDWA 2H7JA 2AIMA 3B79A 4ZUXU 3OVXA 1FH0A 5EF4A 1MS6A 1ME4A 1Q6KA 3CBKA 3PW3A 2FT2A 2GHUA 1PPNA 4X6IA 3QSDA 3RVXA 2NQAA 4X6HA 1EF7A 2O6XA 4Q8GA 4BPVA 2FYEA 1CS8A 4DMXA 1AYUA 4CDCB 1MEMA 2G6DA 4FK5A 4YYUA 1NLJA 4BQVA 3PBHA 2DZZA 2XU4A 2F7DA 3P5WA 2PBHA 1PPPA 3OISA 1VSNA 3MHSA 3HD3A 4YVAA 3OVZA 1BP4A 2G7YA 2R9OA 2GFOA 2PREA 1KFUL 1CQDA 1F2BA 4X6JA 2P86A 3QT4A 3BC3A 3HHAA 1MEGA 1NB3A 1NB5A 3N3KA 4W5CA 4QRVA 3TNXA 3K8UA 4N8WA 4K7CA 2CIOA 4OEMA 3C9EA 4MZOA 5PADA 1BQIA 4AXLA 2R9CA 1PE6A 2VHSA 2F1GA 5JA7A 4RY2A 1U9VA 5A24A 4P6GA 1F2AA 2R9NA 1S4VA 3CH3X 3CBJA 3KWZA 3USVA 1ITOA 3IEJA 3DF0A 1GMYA 5EGWA 3KSEA 3HWNA 4HWYA 4YYWA 4AXMA 1PIPA 1AU4A 1XKGA 2DCAA 1O0EA 4I04A 1EWOA 1PPDA 1CV8A 1YVBA 1PADA 2B1MA 2ATOA 3OF8A 2XU3A 3F75A 2AYOA 1YK8A 1EWPA 1ME3A 1PBHA 1EWMA 2FO5A 4Q8HA 3WXFA 3KWBX 1YT7A 4CZWA 5FPWA 3KX1A 1Y4HA 5CHTA 2HH5A 4OELA 3PDFA 3H6SA 2AUZA 1AYVA 2DZYA 2FRQA 4QBBA 1TU6A 1KHQA 5J94A 4BS5A 4CDDB 3H8CA 4MZSA 2DC7A 1AIMA 1ZCMA 2ACTA 4FJCA 1NL6A 1THEA 3P5XA 4PI3A 4CDEB 3M99A 1HUCB 4P6EA 4XUIA 4YYSA 3HHIA 3V6EA 2FTDA 3I06A 3U8EA 1JQPA 1U9WA 3I3TA 4PP1A 4DMYA 3BOWA 3O0UA 2HD5A 2OULA 3PNRA 2Y6EA 1K3BB 3S3RA 4I05A 1PPOA 2E03A 1AU2A 3O1GA 1VJVA 2AVWA 3BWKA 3BCNA 3IHPA 3H7DA 2DC8A 1U5IA
chains in the Genus database with same CATH superfamily
1QDQA 2Z84A 4YYRA 2BDLA 2XU1A 1ICFA 3AI8A 1CSBB 3IOQA 1ATKA 1IWDA 1MHWA 2G8JA 1KFXL 1GLOA 4RKXA 2IPPB 1BY8A 3OQCA 3BB7A 3MTNA 3PT2A 2OZ2A 4BS6A 4YYQA 3IV2A 2E02A 3C0RA 1GECE 2BTWA 5JH3A 2E00A 3N4CA 5F02A 3RVVA 2PNSA 3B21A 2DCDA 3RVWA 2NQDB 2JQFR 2VHFA 2OP3A 3PSEA 1ZIVA 2R9FA 1YZBA 1AU3A 1AECA 3CH2X 5KO3A 4YYVA 1CPJA 2C0YA 2ARYA 2PADA 6PADA 1U9XA 2R6NA 3ERVA 2Y5BA 2HWKA 4W5BA 1SP4B 2JTCA 3PRPA 4KLBA 5CHVA 4PP2E 4HXDB 1KXRA 4MI7A 2XU5A 3TMPA 4RNAA 2J7QC 3P5UA 3BPMA 1DEUA 3MORA 1PCIA 2AUXA 1GCBA 1QXPA 5CVMA 2FQ9A 5K16A 2B1NA 4XR7A 4R3DA 2YJ8A 4MSXA 4OVZB 1EWLA 2DC6A 3LFYA 2FUDA 4M0WA 3ZUAA 1DKIA 3W30A 1POPA 3KFQA 3P5VA 3D6SA 1SNKA 4QH6A 1CJLA 2JQGR 1MIRA 1AYWA 2CB5A 1QOLA 1CVZA 3BY4A 2DJGB 3OF9A 9PAPA 3K24A 1Y08A 1U9QX 1M6DA 2P0RA 1CTEA 2AU1A 2HHNA 4QRGA 2DJFB 3H8BA 2AGAA 1F2CA 3H89A 3BBAA 1PXVA 5CVOB 4BOPA 3NHEA 3N3GA 2IBIA 4FIPA 4QRXA 4P16A 3WXEA 3BPFA 4I07A 3LXSA 4BOUA 3S3QA 3V6CA 4W4UA 3IUTA 1NPZA 1DF0A 4WA6A 7PCKA 3E9SA 1STFE 2G8EA 4N79A 2DCCA 1NQCA 1CB5A 2WBFX 8PCHA 2NQIA 2AYNA 2YJ2A 3F5VA 1TL9A 4PADA 3WXGA 3MP2A 3QJ3A 2NQGA 2DCBA 4G54A 1A6RA 3PHWA 2BDZA 2BU3A 1KHPA 4PT5A 2HXZA 2FE8A 1F29A 3E1ZB 3KKUA 2YJCA 2YJ9A 3KW9A 1X9YA 4IP3A 4CDFB 3MJ5A 3GCBA 4YV8A 5CVNB 2R9MA 2YJBA 1BGOA 4BSQA 2AS8A 2J7QA 2FRAA 4OW0A 4A5UA 1TLOA 3O65A 4N4ZA 2DC9A 5EZSA 1YK7A 3K9MA 3MHHA 2E01A 1QMYA 1AU0A 2P7UA 1YALA 3IMAA 1MDWA 2H7JA 1PVJA 2AIMA 3B79A 4ZUXU 3OVXA 1FH0A 3ZNHA 5EF4A 1MS6A 1ME4A 1Q6KA 3CBKA 3PW3A 2FT2A 2GHUA 1PPNA 4X6IA 3QSDA 3RVXA 2NQAA 4X6HA 1EF7A 2O6XA 4Q8GA 4BPVA 2FYEA 1CS8A 4DMXA 1AYUA 4IUMA 4CDCB 1MEMA 2G6DA 4FK5A 4YYUA 4D8IA 1NLJA 4D8EA 4BQVA 3PBHA 5JZEA 4D8BA 2DZZA 2XU4A 2F7DA 3IFUA 3P5WA 2PBHA 1PPPA 3OISA 1VSNA 3MHSA 4REZA 3HD3A 4YVAA 2BTWB 3OVZA 3W31A 1BP4A 2G7YA 2R9OA 2GFOA 2PREA 1KFUL 2JRIA 1CQDA 1F2BA 4X6JA 2P86A 3BC3A 3QT4A 3HHAA 1MEGA 1NB3A 1UKFA 1NB5A 3N3KA 4W5CA 4QRVA 3TNXA 3K8UA 4N8WA 4K7CA 2CIOA 4OEMA 4OVZA 3C9EA 4GUAA 4MZOA 5PADA 1BQIA 4AXLA 2R9CA 1PE6A 2VHSA 2F1GA 5JA7A 4RY2A 1U9VA 5A24A 4P6GA 1F2AA 2R9NA 1S4VA 3CH3X 3CBJA 3KWZA 3USVA 1ITOA 4BOQA 3IEJA 3DF0A 1GMYA 5EGWA 3KSEA 3HWNA 4HWYA 4YYWA 4AXMA 1PIPA 1AU4A 1XKGA 2DCAA 1O0EA 4I04A 4ZTBA 1EWOA 1PPDA 1CV8A 1YVBA 4XZXA 1PADA 2B1MA 2ATOA 3OF8A 2XU3A 5EZQA 3F75A 2AYOA 1YK8A 1EWPA 1ME3A 1PBHA 1EWMA 2FO5A 4Q8HA 3WXFA 3KWBX 1YT7A 4CZWA 2DOSA 5FPWA 3KX1A 5E6JA 1Y4HA 5CHTA 3TRKA 2HH5A 4OELA 3PDFA 3H6SA 2AUZA 1AYVA 2DZYA 2FRQA 4QBBA 4BOZA 1TU6A 1KHQA 5J94A 4BS5A 4CDDB 3H8CA 4MZSA 2DC7A 3PRMA 1AIMA 1ZCMA 3RNVA 2ACTA 4FJCA 1NL6A 1THEA 3P5XA 4PI3A 3PHUA 4CDEB 3M99A 4RF1A 3PHXA 1HUCB 4P6EA 4XUIA 4YYSA 3HHIA 3V6EA 2FTDA 3I06A 3U8EA 1JQPA 1U9WA 3I3TA 4PP1A 4DMYA 3BOWA 3O0UA 4BOSA 2UZJA 2HD5A 4WURA 3PNRA 2OULA 2Y6EA 1K3BB 3S3RA 3MTVA 4I05A 4MM3B 1PPOA 2E03A 1AU2A 3O1GA 1VJVA 2AVWA 3BWKA 3BCNA 3IHPA 4RF0A 3H7DA 2DC8A 1U5IA
chains in the Genus database with same CATH topology
1QDQA 1W5RA 4YYRA 2BDLA 2XU1A 1ICFA 3AI8A 4NV8A 1CSBB 3IOQA 1ATKA 1IWDA 1MHWA 2G8JA 1KFXL 1GLOA 2IPPB 1BY8A 3MTNA 2OZ2A 4BS6A 4YYQA 3IV2A 2E02A 1GECE 5JH3A 2E00A 3N4CA 5F02A 3RVVA 2PNSA 2DCDA 3RVWA 2NQDB 2JQFR 2VHFA 2OP3A 1ZIVA 2R9FA 1AU3A 1AECA 3CH2X 4YYVA 1CPJA 2C0YA 2ARYA 2PADA 6PADA 1U9XA 2R6NA 3ERVA 2Y5BA 4W5BA 1SP4B 4KLBA 5CHVA 4PP2E 1KXRA 2XU5A 3P5UA 3BPMA 1DEUA 3MORA 1PCIA 2AUXA 1GCBA 1QXPA 5CVMA 2FQ9A 5K16A 2B1NA 4XR7A 1W4TA 2YJ8A 4MSXA 1EWLA 2DC6A 3LFYA 2FUDA 3ZUAA 1POPA 3KFQA 3P5VA 3D6SA 1SNKA 1GX3A 4QH6A 1CJLA 2JQGR 1MIRA 1AYWA 2CB5A 1QOLA 1CVZA 2DJGB 3OF9A 1W6FA 9PAPA 3K24A 1Y08A 1U9QX 1M6DA 2P0RA 1CTEA 2AU1A 2HHNA 4QRGA 2DJFB 3H8BA 1F2CA 3H89A 1PXVA 5CVOB 3NHEA 3N3GA 2IBIA 4FIPA 4QRXA 3WXEA 3BPFA 4I07A 3LXSA 3S3QA 3V6CA 4W4UA 3IUTA 1NPZA 1DF0A 2BSZA 4WA6A 7PCKA 1STFE 2G8EA 4N79A 2DCCA 1NQCA 1CB5A 2WBFX 8PCHA 2NQIA 2AYNA 2YJ2A 3F5VA 1TL9A 4PADA 3WXGA 3QJ3A 2NQGA 2DCBA 4G54A 1A6RA 2BDZA 1KHPA 2HXZA 1F29A 3E1ZB 3KKUA 2YJCA 2YJ9A 3KW9A 1X9YA 4CDFB 3GCBA 4YV8A 5CVNB 2R9MA 3D9WA 2YJBA 1BGOA 4BSQA 2AS8A 2FRAA 1TLOA 4N4ZA 2DC9A 1YK7A 3K9MA 3MHHA 2E01A 1QMYA 1AU0A 2P7UA 1YALA 3IMAA 1MDWA 2H7JA 2VFCA 2AIMA 3B79A 4ZUXU 3OVXA 1FH0A 5EF4A 1MS6A 1ME4A 1Q6KA 3CBKA 3PW3A 2FT2A 2GHUA 1PPNA 4X6IA 3QSDA 3RVXA 2NQAA 4X6HA 1EF7A 2O6XA 4Q8GA 4BPVA 2FYEA 1CS8A 4DMXA 1AYUA 4CDCB 1MEMA 2G6DA 4FK5A 4YYUA 1NLJA 4BQVA 3PBHA 2DZZA 2XU4A 4NV7A 2F7DA 3P5WA 2PBHA 1PPPA 3OISA 1E2TA 1VSNA 3MHSA 3HD3A 4YVAA 3OVZA 1BP4A 4C5PA 2G7YA 2R9OA 2GFOA 2PREA 4GUZA 1KFUL 1CQDA 1F2BA 4X6JA 2P86A 3QT4A 3BC3A 3HHAA 1MEGA 1NB3A 1NB5A 3N3KA 4W5CA 4QRVA 3TNXA 3K8UA 4N8WA 4K7CA 2CIOA 4OEMA 3C9EA 4MZOA 5PADA 1BQIA 4AXLA 2R9CA 1PE6A 2VHSA 2F1GA 5JA7A 4RY2A 1U9VA 4BGFA 5A24A 4P6GA 1F2AA 2R9NA 1S4VA 3CH3X 3CBJA 3KWZA 3USVA 1ITOA 3IEJA 3DF0A 1GMYA 5EGWA 3KSEA 3HWNA 4HWYA 4YYWA 4AXMA 1PIPA 1AU4A 1XKGA 2DCAA 1O0EA 4I04A 1EWOA 1PPDA 1CV8A 1YVBA 1PADA 2B1MA 2ATOA 3OF8A 2XU3A 3F75A 2AYOA 1YK8A 1EWPA 1ME3A 1PBHA 1EWMA 2FO5A 4Q8HA 3WXFA 3KWBX 1YT7A 4CZWA 5FPWA 3KX1A 1Y4HA 5CHTA 2HH5A 4OELA 3PDFA 3H6SA 2AUZA 1AYVA 2DZYA 2FRQA 4QBBA 1TU6A 1KHQA 5J94A 4BS5A 4CDDB 3H8CA 4MZSA 2DC7A 2VFBA 3LTWA 1AIMA 1ZCMA 2ACTA 4FJCA 1NL6A 1THEA 3P5XA 4PI3A 4CDEB 3M99A 1HUCB 4P6EA 4XUIA 4YYSA 3HHIA 3V6EA 2FTDA 3I06A 3U8EA 1JQPA 1U9WA 3I3TA 4PP1A 4DMYA 3BOWA 3O0UA 2HD5A 2OULA 3PNRA 2Y6EA 1K3BB 3S3RA 4B55A 4I05A 1PPOA 2E03A 1AU2A 3O1GA 1VJVA 2AVWA 3BWKA 3BCNA 3IHPA 3H7DA 2DC8A 1U5IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QDQ A;  4YYR A;  2BDL A;  2XU1 A;  1ICF A;  3AI8 A;  1CSB B;  3IOQ A;  1ATK A;  1IWD A;  1MHW A;  2G8J A;  1KFX L;  1GLO A;  2IPP B;  1BY8 A;  3MTN A;  2OZ2 A;  4BS6 A;  4YYQ A;  3IV2 A;  2E02 A;  1GEC E;  5JH3 A;  2E00 A;  3N4C A;  5F02 A;  3RVV A;  2PNS A;  2DCD A;  3RVW A;  2NQD B;  2JQF R;  2VHF A;  2OP3 A;  1ZIV A;  2R9F A;  1AU3 A;  1AEC A;  3CH2 X;  4YYV A;  1CPJ A;  2C0Y A;  2ARY A;  2PAD A;  6PAD A;  1U9X A;  2R6N A;  3ERV A;  2Y5B A;  4W5B A;  1SP4 B;  4KLB A;  5CHV A;  4PP2 E;  1KXR A;  2XU5 A;  3P5U A;  3BPM A;  1DEU A;  3MOR A;  1PCI A;  2AUX A;  1GCB A;  1QXP A;  5CVM A;  2FQ9 A;  5K16 A;  2B1N A;  4XR7 A;  2YJ8 A;  4MSX A;  1EWL A;  2DC6 A;  3LFY A;  2FUD A;  3ZUA A;  1POP A;  3KFQ A;  3P5V A;  3D6S A;  1SNK A;  4QH6 A;  1CJL A;  2JQG R;  1MIR A;  1AYW A;  2CB5 A;  1QOL A;  1CVZ A;  2DJG B;  3OF9 A;  9PAP A;  3K24 A;  1Y08 A;  1U9Q X;  1M6D A;  2P0R A;  1CTE A;  2AU1 A;  2HHN A;  4QRG A;  2DJF B;  3H8B A;  1F2C A;  3H89 A;  1PXV A;  5CVO B;  3NHE A;  3N3G A;  2IBI A;  4FIP A;  4QRX A;  3WXE A;  3BPF A;  4I07 A;  3LXS A;  3S3Q A;  3V6C A;  4W4U A;  3IUT A;  1NPZ A;  1DF0 A;  4WA6 A;  7PCK A;  1STF E;  2G8E A;  4N79 A;  2DCC A;  1NQC A;  1CB5 A;  2WBF X;  8PCH A;  2NQI A;  2AYN A;  2YJ2 A;  3F5V A;  1TL9 A;  4PAD A;  3WXG A;  3QJ3 A;  2NQG A;  2DCB A;  4G54 A;  1A6R A;  2BDZ A;  1KHP A;  2HXZ A;  1F29 A;  3E1Z B;  3KKU A;  2YJC A;  2YJ9 A;  3KW9 A;  1X9Y A;  4CDF B;  3GCB A;  4YV8 A;  5CVN B;  2R9M A;  2YJB A;  1BGO A;  4BSQ A;  2AS8 A;  2FRA A;  1TLO A;  4N4Z A;  2DC9 A;  1YK7 A;  3K9M A;  3MHH A;  2E01 A;  1QMY A;  1AU0 A;  2P7U A;  1YAL A;  3IMA A;  1MDW A;  2H7J A;  2AIM A;  3B79 A;  4ZUX U;  3OVX A;  1FH0 A;  5EF4 A;  1MS6 A;  1ME4 A;  1Q6K A;  3CBK A;  3PW3 A;  2FT2 A;  2GHU A;  1PPN A;  4X6I A;  3QSD A;  3RVX A;  2NQA A;  4X6H A;  1EF7 A;  2O6X A;  4Q8G A;  4BPV A;  2FYE A;  1CS8 A;  4DMX A;  1AYU A;  4CDC B;  1MEM A;  2G6D A;  4FK5 A;  4YYU A;  1NLJ A;  4BQV A;  3PBH A;  2DZZ A;  2XU4 A;  2F7D A;  3P5W A;  2PBH A;  1PPP A;  3OIS A;  1VSN A;  3MHS A;  3HD3 A;  4YVA A;  3OVZ A;  1BP4 A;  2G7Y A;  2R9O A;  2GFO A;  2PRE A;  1KFU L;  1CQD A;  1F2B A;  4X6J A;  2P86 A;  3QT4 A;  3BC3 A;  3HHA A;  1MEG A;  1NB3 A;  1NB5 A;  3N3K A;  4W5C A;  4QRV A;  3TNX A;  3K8U A;  4N8W A;  4K7C A;  2CIO A;  4OEM A;  3C9E A;  4MZO A;  5PAD A;  1BQI A;  4AXL A;  2R9C A;  1PE6 A;  2VHS A;  2F1G A;  5JA7 A;  4RY2 A;  1U9V A;  5A24 A;  4P6G A;  1F2A A;  2R9N A;  1S4V A;  3CH3 X;  3CBJ A;  3KWZ A;  3USV A;  1ITO A;  3IEJ A;  3DF0 A;  1GMY A;  5EGW A;  3KSE A;  3HWN A;  4HWY A;  4YYW A;  4AXM A;  1PIP A;  1AU4 A;  1XKG A;  2DCA A;  1O0E A;  4I04 A;  1EWO A;  1PPD A;  1CV8 A;  1YVB A;  1PAD A;  2B1M A;  2ATO A;  3OF8 A;  2XU3 A;  3F75 A;  2AYO A;  1YK8 A;  1EWP A;  1ME3 A;  1PBH A;  1EWM A;  2FO5 A;  4Q8H A;  3WXF A;  3KWB X;  1YT7 A;  4CZW A;  5FPW A;  3KX1 A;  1Y4H A;  5CHT A;  2HH5 A;  4OEL A;  3PDF A;  3H6S A;  2AUZ A;  1AYV A;  2DZY A;  2FRQ A;  4QBB A;  1TU6 A;  1KHQ A;  5J94 A;  4BS5 A;  4CDD B;  3H8C A;  4MZS A;  2DC7 A;  1AIM A;  1ZCM A;  2ACT A;  4FJC A;  1NL6 A;  1THE A;  3P5X A;  4PI3 A;  4CDE B;  3M99 A;  1HUC B;  4P6E A;  4XUI A;  4YYS A;  3HHI A;  3V6E A;  2FTD A;  3I06 A;  3U8E A;  1JQP A;  1U9W A;  3I3T A;  4PP1 A;  4DMY A;  3BOW A;  3O0U A;  2HD5 A;  2OUL A;  3PNR A;  2Y6E A;  1K3B B;  3S3R A;  4I05 A;  1PPO A;  2E03 A;  1AU2 A;  3O1G A;  1VJV A;  2AVW A;  3BWK A;  3BCN A;  3IHP A;  3H7D A;  2DC8 A;  1U5I A; 
#chains in the Genus database with same CATH topology
 1QDQ A;  2Z84 A;  4YYR A;  2BDL A;  2XU1 A;  1ICF A;  3AI8 A;  1CSB B;  3IOQ A;  1ATK A;  1IWD A;  1MHW A;  2G8J A;  1KFX L;  1GLO A;  4RKX A;  2IPP B;  1BY8 A;  3OQC A;  3BB7 A;  3MTN A;  3PT2 A;  2OZ2 A;  4BS6 A;  4YYQ A;  3IV2 A;  2E02 A;  3C0R A;  1GEC E;  2BTW A;  5JH3 A;  2E00 A;  3N4C A;  5F02 A;  3RVV A;  2PNS A;  3B21 A;  2DCD A;  3RVW A;  2NQD B;  2JQF R;  2VHF A;  2OP3 A;  3PSE A;  1ZIV A;  2R9F A;  1YZB A;  1AU3 A;  1AEC A;  3CH2 X;  5KO3 A;  4YYV A;  1CPJ A;  2C0Y A;  2ARY A;  2PAD A;  6PAD A;  1U9X A;  2R6N A;  3ERV A;  2Y5B A;  2HWK A;  4W5B A;  1SP4 B;  2JTC A;  3PRP A;  4KLB A;  5CHV A;  4PP2 E;  4HXD B;  1KXR A;  4MI7 A;  2XU5 A;  3TMP A;  4RNA A;  2J7Q C;  3P5U A;  3BPM A;  1DEU A;  3MOR A;  1PCI A;  2AUX A;  1GCB A;  1QXP A;  5CVM A;  2FQ9 A;  5K16 A;  2B1N A;  4XR7 A;  4R3D A;  2YJ8 A;  4MSX A;  4OVZ B;  1EWL A;  2DC6 A;  3LFY A;  2FUD A;  4M0W A;  3ZUA A;  1DKI A;  3W30 A;  1POP A;  3KFQ A;  3P5V A;  3D6S A;  1SNK A;  4QH6 A;  1CJL A;  2JQG R;  1MIR A;  1AYW A;  2CB5 A;  1QOL A;  1CVZ A;  3BY4 A;  2DJG B;  3OF9 A;  9PAP A;  3K24 A;  1Y08 A;  1U9Q X;  1M6D A;  2P0R A;  1CTE A;  2AU1 A;  2HHN A;  4QRG A;  2DJF B;  3H8B A;  2AGA A;  1F2C A;  3H89 A;  3BBA A;  1PXV A;  5CVO B;  4BOP A;  3NHE A;  3N3G A;  2IBI A;  4FIP A;  4QRX A;  4P16 A;  3WXE A;  3BPF A;  4I07 A;  3LXS A;  4BOU A;  3S3Q A;  3V6C A;  4W4U A;  3IUT A;  1NPZ A;  1DF0 A;  4WA6 A;  7PCK A;  3E9S A;  1STF E;  2G8E A;  4N79 A;  2DCC A;  1NQC A;  1CB5 A;  2WBF X;  8PCH A;  2NQI A;  2AYN A;  2YJ2 A;  3F5V A;  1TL9 A;  4PAD A;  3WXG A;  3MP2 A;  3QJ3 A;  2NQG A;  2DCB A;  4G54 A;  1A6R A;  3PHW A;  2BDZ A;  2BU3 A;  1KHP A;  4PT5 A;  2HXZ A;  2FE8 A;  1F29 A;  3E1Z B;  3KKU A;  2YJC A;  2YJ9 A;  3KW9 A;  1X9Y A;  4IP3 A;  4CDF B;  3MJ5 A;  3GCB A;  4YV8 A;  5CVN B;  2R9M A;  2YJB A;  1BGO A;  4BSQ A;  2AS8 A;  2J7Q A;  2FRA A;  4OW0 A;  4A5U A;  1TLO A;  3O65 A;  4N4Z A;  2DC9 A;  5EZS A;  1YK7 A;  3K9M A;  3MHH A;  2E01 A;  1QMY A;  1AU0 A;  2P7U A;  1YAL A;  3IMA A;  1MDW A;  2H7J A;  1PVJ A;  2AIM A;  3B79 A;  4ZUX U;  3OVX A;  1FH0 A;  3ZNH A;  5EF4 A;  1MS6 A;  1ME4 A;  1Q6K A;  3CBK A;  3PW3 A;  2FT2 A;  2GHU A;  1PPN A;  4X6I A;  3QSD A;  3RVX A;  2NQA A;  4X6H A;  1EF7 A;  2O6X A;  4Q8G A;  4BPV A;  2FYE A;  1CS8 A;  4DMX A;  1AYU A;  4IUM A;  4CDC B;  1MEM A;  2G6D A;  4FK5 A;  4YYU A;  4D8I A;  1NLJ A;  4D8E A;  4BQV A;  3PBH A;  5JZE A;  4D8B A;  2DZZ A;  2XU4 A;  2F7D A;  3IFU A;  3P5W A;  2PBH A;  1PPP A;  3OIS A;  1VSN A;  3MHS A;  4REZ A;  3HD3 A;  4YVA A;  2BTW B;  3OVZ A;  3W31 A;  1BP4 A;  2G7Y A;  2R9O A;  2GFO A;  2PRE A;  1KFU L;  2JRI A;  1CQD A;  1F2B A;  4X6J A;  2P86 A;  3BC3 A;  3QT4 A;  3HHA A;  1MEG A;  1NB3 A;  1UKF A;  1NB5 A;  3N3K A;  4W5C A;  4QRV A;  3TNX A;  3K8U A;  4N8W A;  4K7C A;  2CIO A;  4OEM A;  4OVZ A;  3C9E A;  4GUA A;  4MZO A;  5PAD A;  1BQI A;  4AXL A;  2R9C A;  1PE6 A;  2VHS A;  2F1G A;  5JA7 A;  4RY2 A;  1U9V A;  5A24 A;  4P6G A;  1F2A A;  2R9N A;  1S4V A;  3CH3 X;  3CBJ A;  3KWZ A;  3USV A;  1ITO A;  4BOQ A;  3IEJ A;  3DF0 A;  1GMY A;  5EGW A;  3KSE A;  3HWN A;  4HWY A;  4YYW A;  4AXM A;  1PIP A;  1AU4 A;  1XKG A;  2DCA A;  1O0E A;  4I04 A;  4ZTB A;  1EWO A;  1PPD A;  1CV8 A;  1YVB A;  4XZX A;  1PAD A;  2B1M A;  2ATO A;  3OF8 A;  2XU3 A;  5EZQ A;  3F75 A;  2AYO A;  1YK8 A;  1EWP A;  1ME3 A;  1PBH A;  1EWM A;  2FO5 A;  4Q8H A;  3WXF A;  3KWB X;  1YT7 A;  4CZW A;  2DOS A;  5FPW A;  3KX1 A;  5E6J A;  1Y4H A;  5CHT A;  3TRK A;  2HH5 A;  4OEL A;  3PDF A;  3H6S A;  2AUZ A;  1AYV A;  2DZY A;  2FRQ A;  4QBB A;  4BOZ A;  1TU6 A;  1KHQ A;  5J94 A;  4BS5 A;  4CDD B;  3H8C A;  4MZS A;  2DC7 A;  3PRM A;  1AIM A;  1ZCM A;  3RNV A;  2ACT A;  4FJC A;  1NL6 A;  1THE A;  3P5X A;  4PI3 A;  3PHU A;  4CDE B;  3M99 A;  4RF1 A;  3PHX A;  1HUC B;  4P6E A;  4XUI A;  4YYS A;  3HHI A;  3V6E A;  2FTD A;  3I06 A;  3U8E A;  1JQP A;  1U9W A;  3I3T A;  4PP1 A;  4DMY A;  3BOW A;  3O0U A;  4BOS A;  2UZJ A;  2HD5 A;  4WUR A;  3PNR A;  2OUL A;  2Y6E A;  1K3B B;  3S3R A;  3MTV A;  4I05 A;  4MM3 B;  1PPO A;  2E03 A;  1AU2 A;  3O1G A;  1VJV A;  2AVW A;  3BWK A;  3BCN A;  3IHP A;  4RF0 A;  3H7D A;  2DC8 A;  1U5I A; 
#chains in the Genus database with same CATH homology
 1QDQ A;  1W5R A;  4YYR A;  2BDL A;  2XU1 A;  1ICF A;  3AI8 A;  4NV8 A;  1CSB B;  3IOQ A;  1ATK A;  1IWD A;  1MHW A;  2G8J A;  1KFX L;  1GLO A;  2IPP B;  1BY8 A;  3MTN A;  2OZ2 A;  4BS6 A;  4YYQ A;  3IV2 A;  2E02 A;  1GEC E;  5JH3 A;  2E00 A;  3N4C A;  5F02 A;  3RVV A;  2PNS A;  2DCD A;  3RVW A;  2NQD B;  2JQF R;  2VHF A;  2OP3 A;  1ZIV A;  2R9F A;  1AU3 A;  1AEC A;  3CH2 X;  4YYV A;  1CPJ A;  2C0Y A;  2ARY A;  2PAD A;  6PAD A;  1U9X A;  2R6N A;  3ERV A;  2Y5B A;  4W5B A;  1SP4 B;  4KLB A;  5CHV A;  4PP2 E;  1KXR A;  2XU5 A;  3P5U A;  3BPM A;  1DEU A;  3MOR A;  1PCI A;  2AUX A;  1GCB A;  1QXP A;  5CVM A;  2FQ9 A;  5K16 A;  2B1N A;  4XR7 A;  1W4T A;  2YJ8 A;  4MSX A;  1EWL A;  2DC6 A;  3LFY A;  2FUD A;  3ZUA A;  1POP A;  3KFQ A;  3P5V A;  3D6S A;  1SNK A;  1GX3 A;  4QH6 A;  1CJL A;  2JQG R;  1MIR A;  1AYW A;  2CB5 A;  1QOL A;  1CVZ A;  2DJG B;  3OF9 A;  1W6F A;  9PAP A;  3K24 A;  1Y08 A;  1U9Q X;  1M6D A;  2P0R A;  1CTE A;  2AU1 A;  2HHN A;  4QRG A;  2DJF B;  3H8B A;  1F2C A;  3H89 A;  1PXV A;  5CVO B;  3NHE A;  3N3G A;  2IBI A;  4FIP A;  4QRX A;  3WXE A;  3BPF A;  4I07 A;  3LXS A;  3S3Q A;  3V6C A;  4W4U A;  3IUT A;  1NPZ A;  1DF0 A;  2BSZ A;  4WA6 A;  7PCK A;  1STF E;  2G8E A;  4N79 A;  2DCC A;  1NQC A;  1CB5 A;  2WBF X;  8PCH A;  2NQI A;  2AYN A;  2YJ2 A;  3F5V A;  1TL9 A;  4PAD A;  3WXG A;  3QJ3 A;  2NQG A;  2DCB A;  4G54 A;  1A6R A;  2BDZ A;  1KHP A;  2HXZ A;  1F29 A;  3E1Z B;  3KKU A;  2YJC A;  2YJ9 A;  3KW9 A;  1X9Y A;  4CDF B;  3GCB A;  4YV8 A;  5CVN B;  2R9M A;  3D9W A;  2YJB A;  1BGO A;  4BSQ A;  2AS8 A;  2FRA A;  1TLO A;  4N4Z A;  2DC9 A;  1YK7 A;  3K9M A;  3MHH A;  2E01 A;  1QMY A;  1AU0 A;  2P7U A;  1YAL A;  3IMA A;  1MDW A;  2H7J A;  2VFC A;  2AIM A;  3B79 A;  4ZUX U;  3OVX A;  1FH0 A;  5EF4 A;  1MS6 A;  1ME4 A;  1Q6K A;  3CBK A;  3PW3 A;  2FT2 A;  2GHU A;  1PPN A;  4X6I A;  3QSD A;  3RVX A;  2NQA A;  4X6H A;  1EF7 A;  2O6X A;  4Q8G A;  4BPV A;  2FYE A;  1CS8 A;  4DMX A;  1AYU A;  4CDC B;  1MEM A;  2G6D A;  4FK5 A;  4YYU A;  1NLJ A;  4BQV A;  3PBH A;  2DZZ A;  2XU4 A;  4NV7 A;  2F7D A;  3P5W A;  2PBH A;  1PPP A;  3OIS A;  1E2T A;  1VSN A;  3MHS A;  3HD3 A;  4YVA A;  3OVZ A;  1BP4 A;  4C5P A;  2G7Y A;  2R9O A;  2GFO A;  2PRE A;  4GUZ A;  1KFU L;  1CQD A;  1F2B A;  4X6J A;  2P86 A;  3QT4 A;  3BC3 A;  3HHA A;  1MEG A;  1NB3 A;  1NB5 A;  3N3K A;  4W5C A;  4QRV A;  3TNX A;  3K8U A;  4N8W A;  4K7C A;  2CIO A;  4OEM A;  3C9E A;  4MZO A;  5PAD A;  1BQI A;  4AXL A;  2R9C A;  1PE6 A;  2VHS A;  2F1G A;  5JA7 A;  4RY2 A;  1U9V A;  4BGF A;  5A24 A;  4P6G A;  1F2A A;  2R9N A;  1S4V A;  3CH3 X;  3CBJ A;  3KWZ A;  3USV A;  1ITO A;  3IEJ A;  3DF0 A;  1GMY A;  5EGW A;  3KSE A;  3HWN A;  4HWY A;  4YYW A;  4AXM A;  1PIP A;  1AU4 A;  1XKG A;  2DCA A;  1O0E A;  4I04 A;  1EWO A;  1PPD A;  1CV8 A;  1YVB A;  1PAD A;  2B1M A;  2ATO A;  3OF8 A;  2XU3 A;  3F75 A;  2AYO A;  1YK8 A;  1EWP A;  1ME3 A;  1PBH A;  1EWM A;  2FO5 A;  4Q8H A;  3WXF A;  3KWB X;  1YT7 A;  4CZW A;  5FPW A;  3KX1 A;  1Y4H A;  5CHT A;  2HH5 A;  4OEL A;  3PDF A;  3H6S A;  2AUZ A;  1AYV A;  2DZY A;  2FRQ A;  4QBB A;  1TU6 A;  1KHQ A;  5J94 A;  4BS5 A;  4CDD B;  3H8C A;  4MZS A;  2DC7 A;  2VFB A;  3LTW A;  1AIM A;  1ZCM A;  2ACT A;  4FJC A;  1NL6 A;  1THE A;  3P5X A;  4PI3 A;  4CDE B;  3M99 A;  1HUC B;  4P6E A;  4XUI A;  4YYS A;  3HHI A;  3V6E A;  2FTD A;  3I06 A;  3U8E A;  1JQP A;  1U9W A;  3I3T A;  4PP1 A;  4DMY A;  3BOW A;  3O0U A;  2HD5 A;  2OUL A;  3PNR A;  2Y6E A;  1K3B B;  3S3R A;  4B55 A;  4I05 A;  1PPO A;  2E03 A;  1AU2 A;  3O1G A;  1VJV A;  2AVW A;  3BWK A;  3BCN A;  3IHP A;  3H7D A;  2DC8 A;  1U5I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...