4CDFB

Human dpp1 in complex with (2s,4s)-n-((1s)-1-cyano-2-(4-(4- cyanophenyl)phenyl)ethyl)-4-hydroxy-piperidine-2-carboxamide
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
162
structure length
162
Chain Sequence
b'HLPTSWDWRNVHGINFVSPVRNQASCGSCYSFASMGMLEARIRILTNNSQTPILSPQEVVSCSQYAQGCEGGFPYLIAGKYAQDFGLVEEACFPYTGTDSPCKMKEDCFRYYSSEYHYVGGFYGGCNEALMKLELVHHGPMAVAFEVYDDFLHYKKGIYHHT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DIPEPTIDYL PEPTIDASE 1 EXCLUSION DOMAIN CHAIN
publication title Cathepsin C Inhibitors: Property Optimization and Identification of a Clinical Candidate.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 45
structure length 162
sequence length 162
chains with identical sequence E
ec nomenclature ec 3.4.14.1: Dipeptidyl-peptidase I.
pdb deposition date 2013-10-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 4cdfB01
1PIPA 2YJCA 4W4UA 3D6SA 4BS6A 4FIPA 4OEMA 2P7UA 2YJ8A 3BOWA 1Y08A 3QT4A 3I06A 2DCCA 3P5WA 2FRAA 4CDEB 3QSDA 4QRGA 1U9VA 4BSQA 1F2AA 1GCBA 3H7DA 1MHWA 2B1MA 1QOLA 1YVBA 3I3TA 4X6HA 4RY2A 1AU2A 1CV8A 2XU1A 3H6SA 5CVOB 1NPZA 3LFYA 2DJGB 2F7DA 2FYEA 3AI8A 1KXRA 4YYVA 1ZCMA 2PNSA 1A6RA 1U9WA 1MIRA 4YYSA 1AU3A 2IPPB 4YYWA 1YT7A 4YYRA 4YV8A 5A24A 2HD5A 1PCIA 2YJ9A 1VJVA 2AVWA 3PNRA 4Q8HA 2YJ2A 1YALA 2R9NA 1NLJA 2F1GA 2YJBA 4AXLA 2HHNA 2FQ9A 3H8BA 5F02A 1EWPA 2AYOA 5FPWA 4MZOA 3U8EA 1ITOA 2G8JA 1PPPA 3WXEA 4PP1A 1BGOA 4P6GA 3BWKA 1BQIA 4I07A 1ZIVA 3P5UA 1CS8A 1PBHA 3WXGA 2AYNA 1HUCB 3CBKA 1PADA 1ME4A 4QRXA 2AIMA 3K24A 4CDFB 1GMYA 2VHFA 1EWLA 2DCBA 3HHAA 4PI3A 3OF9A 3N3KA 3IUTA 2HXZA 3E1ZB 5JH3A 2DZZA 3KWZA 3RVWA 1NB3A 2OP3A 2C0YA 3V6CA 1M6DA 3V6EA 1KHQA 3M99A 2R9FA 2DC9A 2P0RA 3P5VA 4DMYA 3HHIA 4Q8GA 3RVVA 4HWYA 2H7JA 2BDZA 2IBIA 3DF0A 1XKGA 1CPJA 1ATKA 6PADA 2FTDA 3F75A 4PP2E 2R9CA 1SNKA 2JQFR 1U5IA 3K8UA 3HD3A 3K9MA 1ME3A 3PW3A 3RVXA 2Y5BA 3ZUAA 1X9YA 1YK8A 2DC6A 4QBBA 1CVZA 1DF0A 4BQVA 2ARYA 1PPOA 4ZUXU 2GFOA 3KX1A 1TLOA 2GHUA 4QRVA 2ACTA 5EGWA 1FH0A 4FK5A 2FT2A 3N3GA 2B1NA 5K16A 3O1GA 3F5VA 1NB5A 1QMYA 4WA6A 4BS5A 5EF4A 3IOQA 1MEGA 2R6NA 1MEMA 4XUIA 4YYQA 4G54A 3PDFA 3IHPA 2CB5A 1PXVA 1O0EA 2OZ2A 4W5BA 4AXMA 3IEJA 2E02A 5CHVA 1QDQA 2E03A 4DMXA 1U9QX 3KFQA 4PADA 1BP4A 5CVMA 3BC3A 4N79A 1F2CA 4OELA 3BPFA 2HH5A 3BPMA 1ICFA 2O6XA 3OVXA 2XU5A 3H8CA 3H89A 4FJCA 3ERVA 4QH6A 3KW9A 1AYUA 1AECA 2AS8A 3KKUA 4I04A 3IV2A 2NQIA 3MHSA 1PE6A 2ATOA 4CDDB 3O0UA 3QJ3A 3N4CA 2AUZA 8PCHA 3LXSA 4K7CA 2AUXA 2CIOA 1DEUA 2E00A 4W5CA 1K3BB 1PPDA 1GLOA 3B79A 3TNXA 2OULA 2AU1A 3MTNA 4YVAA 1GECE 4I05A 1SP4B 3OF8A 5CHTA 3PBHA 4X6JA 2E01A 4X6IA 4MZSA 5CVNB 3CH2X 3OVZA 1EF7A 1QXPA 1EWOA 1Y4HA 3KSEA 1VSNA 2P86A 3GCBA 1AU0A 3HWNA 3NHEA 1NQCA 3MORA 5J94A 1PPNA 1F2BA 2R9MA 4YYUA 1F29A 1KFXL 1EWMA 1IWDA 3OISA 1KHPA 3CBJA 1TU6A 1MS6A 2G7YA 4BPVA 1CQDA 1Q6KA 3IMAA 3BCNA 2DCDA 1AYWA 2NQAA 2G8EA 2DC7A 2XU4A 2VHSA 7PCKA 2DJFB 2FO5A 4CZWA 3CH3X 1CJLA 2DC8A 3S3RA 1AU4A 1CSBB 5PADA 2PADA 2BDLA 9PAPA 1THEA 4N8WA 5JA7A 2Y6EA 1NL6A 4XR7A 1JQPA 3C9EA 3WXFA 3KWBX 1BY8A 1POPA 1U9XA 1STFE 2NQGA 3S3QA 1KFUL 1MDWA 2R9OA 4N4ZA 4KLBA 1YK7A 2WBFX 2DCAA 4P6EA 1CTEA 2NQDB 1TL9A 2XU3A 1S4VA 2FRQA 1CB5A 2JQGR 3P5XA 4CDCB 1AYVA 4MSXA 2G6DA 2DZYA 1AIMA 2FUDA 3USVA 2PBHA 2PREA 3MHHA
chains in the Genus database with same CATH superfamily
5KO3A 1PIPA 2YJCA 4W4UA 3D6SA 4BS6A 4FIPA 4OEMA 2AGAA 2P7UA 4MM3B 2YJ8A 3BOWA 1Y08A 3C0RA 2UZJA 3QT4A 3I06A 4GUAA 4IP3A 2DCCA 3P5WA 2FRAA 4CDEB 3QSDA 4QRGA 1U9VA 4BSQA 1F2AA 1GCBA 3H7DA 1MHWA 2B1MA 1QOLA 1YVBA 3I3TA 4X6HA 4RY2A 1AU2A 1CV8A 2XU1A 3H6SA 5CVOB 4BOQA 1NPZA 3LFYA 2DJGB 2F7DA 2FYEA 3AI8A 1KXRA 4YYVA 1ZCMA 2PNSA 1A6RA 1U9WA 1MIRA 4YYSA 1AU3A 2IPPB 4YYWA 3IFUA 1YT7A 4YYRA 4YV8A 2JRIA 5A24A 2HD5A 1PCIA 2YJ9A 1VJVA 2AVWA 3PNRA 4Q8HA 2YJ2A 1YALA 2R9NA 1NLJA 2F1GA 2YJBA 4AXLA 2HHNA 2FQ9A 3H8BA 5F02A 1EWPA 2AYOA 5FPWA 4MZOA 3U8EA 3OQCA 1ITOA 2G8JA 1PPPA 3BB7A 3WXEA 4PP1A 1BGOA 1YZBA 4P6GA 3BWKA 2FE8A 1BQIA 4I07A 1ZIVA 3P5UA 1CS8A 4HXDB 1PBHA 3WXGA 2AYNA 1HUCB 3CBKA 1PADA 1ME4A 4QRXA 2AIMA 3K24A 4CDFB 1GMYA 2VHFA 1EWLA 2DCBA 3HHAA 4PI3A 3OF9A 3N3KA 3IUTA 2HXZA 3E1ZB 3B21A 5JH3A 2DZZA 2BTWA 3KWZA 3RVWA 1NB3A 2OP3A 2C0YA 3V6CA 1M6DA 3V6EA 1KHQA 3W30A 3M99A 2R9FA 2DC9A 2P0RA 3P5VA 4DMYA 3HHIA 4Q8GA 3RVVA 4HWYA 2H7JA 2BDZA 2IBIA 3DF0A 1XKGA 1CPJA 1ATKA 6PADA 2FTDA 3F75A 4PP2E 4A5UA 2R9CA 1SNKA 2JQFR 1U5IA 3K8UA 3HD3A 3K9MA 1ME3A 3PW3A 3RVXA 2Y5BA 3ZUAA 1X9YA 4WURA 1YK8A 2DC6A 3PT2A 5EZQA 4QBBA 1CVZA 4BOPA 1DF0A 4BQVA 2ARYA 1PPOA 3TMPA 4ZUXU 2GFOA 3KX1A 1TLOA 4RF1A 2GHUA 4QRVA 5JZEA 2ACTA 1PVJA 5EGWA 1FH0A 4FK5A 2FT2A 3N3GA 2B1NA 5K16A 3O1GA 3F5VA 1NB5A 1QMYA 4WA6A 4BS5A 5EF4A 3IOQA 1MEGA 2R6NA 1MEMA 4XUIA 3TRKA 4YYQA 4G54A 3PDFA 3IHPA 2CB5A 3MP2A 1PXVA 1O0EA 2J7QA 2OZ2A 4W5BA 4AXMA 3IEJA 2E02A 5CHVA 1QDQA 2E03A 4RF0A 4DMXA 1U9QX 3KFQA 4PADA 1BP4A 5CVMA 3BC3A 4N79A 1F2CA 4BOUA 4OELA 3PHXA 3BPFA 2HH5A 3BPMA 1ICFA 2O6XA 3OVXA 4BOZA 2J7QC 2XU5A 3H8CA 3H89A 4FJCA 3ERVA 4QH6A 3KW9A 1AYUA 4IUMA 3O65A 1AECA 2AS8A 2BU3A 3KKUA 2BTWB 4I04A 3IV2A 2NQIA 3MHSA 4REZA 1PE6A 2ATOA 4CDDB 3O0UA 3QJ3A 4RKXA 3N4CA 2AUZA 8PCHA 3LXSA 4K7CA 2AUXA 2CIOA 1DEUA 2JTCA 2E00A 3BBAA 4W5CA 1K3BB 1PPDA 1GLOA 3B79A 4MI7A 3TNXA 2OULA 3ZNHA 2AU1A 3MTNA 3PRMA 4YVAA 1GECE 4I05A 1SP4B 3OF8A 5CHTA 3PBHA 1DKIA 4X6JA 2E01A 4X6IA 4MZSA 3PHUA 5CVNB 3CH2X 3OVZA 1EF7A 1QXPA 1EWOA 1Y4HA 3KSEA 4XZXA 1VSNA 2P86A 3GCBA 1AU0A 3MJ5A 3HWNA 2DOSA 3NHEA 3PHWA 1NQCA 3MORA 5J94A 1PPNA 1F2BA 3W31A 2R9MA 4YYUA 1F29A 1KFXL 3MTVA 1EWMA 5E6JA 1IWDA 3OISA 1KHPA 3CBJA 3PSEA 1TU6A 4OVZB 1MS6A 2G7YA 4BPVA 1CQDA 4R3DA 1Q6KA 4OVZA 3IMAA 4D8BA 3BCNA 2DCDA 3PRPA 1AYWA 2NQAA 2G8EA 2DC7A 2XU4A 2VHSA 7PCKA 2DJFB 2FO5A 4CZWA 3CH3X 4D8EA 1CJLA 2DC8A 3S3RA 1AU4A 4RNAA 3RNVA 4M0WA 1CSBB 5PADA 2PADA 2BDLA 4OW0A 2Z84A 9PAPA 3BY4A 1THEA 4N8WA 5JA7A 2Y6EA 1NL6A 4XR7A 1JQPA 3C9EA 3WXFA 3KWBX 1BY8A 1POPA 1U9XA 1STFE 2NQGA 3S3QA 4D8IA 1KFUL 4ZTBA 1MDWA 2R9OA 1UKFA 4BOSA 4P16A 4N4ZA 4KLBA 1YK7A 2WBFX 5EZSA 2DCAA 4P6EA 1CTEA 2NQDB 1TL9A 2XU3A 1S4VA 2FRQA 1CB5A 2JQGR 3P5XA 4CDCB 1AYVA 4MSXA 2G6DA 2DZYA 4PT5A 1AIMA 2FUDA 3USVA 2PBHA 2PREA 2HWKA 3MHHA 3E9SA
chains in the Genus database with same CATH topology
1PIPA 2YJCA 4W4UA 3D6SA 4BS6A 4FIPA 4OEMA 2P7UA 2YJ8A 3BOWA 1Y08A 3QT4A 3I06A 2DCCA 3P5WA 2FRAA 4CDEB 3QSDA 4QRGA 1U9VA 4NV8A 4BSQA 1F2AA 1GCBA 3H7DA 1MHWA 2B1MA 1QOLA 1W5RA 1YVBA 3I3TA 4X6HA 4RY2A 1AU2A 1CV8A 2XU1A 3H6SA 5CVOB 1NPZA 3LFYA 2DJGB 2F7DA 2FYEA 3AI8A 1KXRA 4YYVA 1ZCMA 2PNSA 1A6RA 1U9WA 1MIRA 4YYSA 1AU3A 2IPPB 4YYWA 1YT7A 4YYRA 4YV8A 5A24A 2HD5A 1PCIA 2YJ9A 1VJVA 2AVWA 3PNRA 4Q8HA 2YJ2A 1YALA 2R9NA 1NLJA 2F1GA 2YJBA 4AXLA 2HHNA 2FQ9A 3H8BA 5F02A 1EWPA 2AYOA 5FPWA 4MZOA 3U8EA 1ITOA 2G8JA 1PPPA 3WXEA 4PP1A 1BGOA 4BGFA 4P6GA 3BWKA 1BQIA 4I07A 1ZIVA 3P5UA 1CS8A 1PBHA 3WXGA 2AYNA 1HUCB 3CBKA 1PADA 1ME4A 4QRXA 2AIMA 3K24A 4CDFB 1GMYA 2VHFA 1EWLA 2DCBA 3HHAA 4PI3A 3OF9A 3N3KA 3IUTA 2HXZA 3E1ZB 5JH3A 2DZZA 3KWZA 3RVWA 1NB3A 2OP3A 2C0YA 3V6CA 1M6DA 3V6EA 1KHQA 3M99A 2VFCA 2R9FA 2BSZA 2DC9A 2P0RA 3P5VA 4DMYA 3HHIA 4Q8GA 3RVVA 4HWYA 2H7JA 2BDZA 2IBIA 3DF0A 1XKGA 1CPJA 1ATKA 6PADA 1GX3A 2FTDA 3F75A 4PP2E 2R9CA 1SNKA 2JQFR 1U5IA 3K8UA 3HD3A 3K9MA 1ME3A 3PW3A 3RVXA 2Y5BA 3ZUAA 1X9YA 1YK8A 2DC6A 4QBBA 1CVZA 1DF0A 4BQVA 2ARYA 1PPOA 4ZUXU 2GFOA 3KX1A 1TLOA 2GHUA 4QRVA 2VFBA 2ACTA 5EGWA 1FH0A 4FK5A 2FT2A 3N3GA 2B1NA 5K16A 3O1GA 3F5VA 1NB5A 1QMYA 4WA6A 4BS5A 5EF4A 1E2TA 1MEGA 2R6NA 3IOQA 1MEMA 4B55A 4XUIA 4YYQA 4G54A 3PDFA 3IHPA 2CB5A 1PXVA 1O0EA 2OZ2A 4W5BA 4AXMA 3IEJA 1W4TA 2E02A 5CHVA 1QDQA 2E03A 4DMXA 1U9QX 3KFQA 4PADA 1BP4A 5CVMA 3BC3A 4N79A 1F2CA 4OELA 3BPFA 2HH5A 3BPMA 1ICFA 2O6XA 3OVXA 4C5PA 2XU5A 3H8CA 3H89A 4FJCA 3ERVA 4QH6A 3KW9A 1AYUA 1AECA 2AS8A 3KKUA 4I04A 3IV2A 2NQIA 3MHSA 1PE6A 2ATOA 4CDDB 3O0UA 3QJ3A 3N4CA 2AUZA 8PCHA 3LXSA 4K7CA 2AUXA 2CIOA 1DEUA 2E00A 4W5CA 1K3BB 1PPDA 1GLOA 3B79A 3TNXA 3LTWA 2OULA 2AU1A 3MTNA 4YVAA 1GECE 4I05A 1SP4B 3OF8A 5CHTA 1W6FA 3PBHA 4X6JA 2E01A 4X6IA 4MZSA 5CVNB 3CH2X 3OVZA 1EF7A 1QXPA 1EWOA 4NV7A 1Y4HA 3KSEA 1VSNA 2P86A 3GCBA 1AU0A 3HWNA 3NHEA 1NQCA 3MORA 5J94A 1PPNA 1F2BA 2R9MA 4YYUA 1F29A 1KFXL 1EWMA 1IWDA 3OISA 1KHPA 3CBJA 1TU6A 1MS6A 2G7YA 4BPVA 1CQDA 1Q6KA 3IMAA 3BCNA 2DCDA 1AYWA 2NQAA 2G8EA 2DC7A 2XU4A 2VHSA 7PCKA 2DJFB 2FO5A 4CZWA 3CH3X 1CJLA 3D9WA 2DC8A 3S3RA 1AU4A 1CSBB 5PADA 2PADA 2BDLA 9PAPA 1THEA 4N8WA 5JA7A 2Y6EA 1NL6A 4XR7A 1JQPA 3C9EA 3WXFA 3KWBX 1BY8A 1POPA 1U9XA 1STFE 2NQGA 3S3QA 1KFUL 1MDWA 2R9OA 4N4ZA 4KLBA 1YK7A 2WBFX 2DCAA 4P6EA 1CTEA 2NQDB 4GUZA 1TL9A 2XU3A 1S4VA 2FRQA 1CB5A 2JQGR 3P5XA 4CDCB 1AYVA 4MSXA 2G6DA 2DZYA 1AIMA 2FUDA 3USVA 2PBHA 2PREA 3MHHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PIP A;  2YJC A;  4W4U A;  3D6S A;  4BS6 A;  4FIP A;  4OEM A;  2P7U A;  2YJ8 A;  3BOW A;  1Y08 A;  3QT4 A;  3I06 A;  2DCC A;  3P5W A;  2FRA A;  4CDE B;  3QSD A;  4QRG A;  1U9V A;  4BSQ A;  1F2A A;  1GCB A;  3H7D A;  1MHW A;  2B1M A;  1QOL A;  1YVB A;  3I3T A;  4X6H A;  4RY2 A;  1AU2 A;  1CV8 A;  2XU1 A;  3H6S A;  5CVO B;  1NPZ A;  3LFY A;  2DJG B;  2F7D A;  2FYE A;  3AI8 A;  1KXR A;  4YYV A;  1ZCM A;  2PNS A;  1A6R A;  1U9W A;  1MIR A;  4YYS A;  1AU3 A;  2IPP B;  4YYW A;  1YT7 A;  4YYR A;  4YV8 A;  5A24 A;  2HD5 A;  1PCI A;  2YJ9 A;  1VJV A;  2AVW A;  3PNR A;  4Q8H A;  2YJ2 A;  1YAL A;  2R9N A;  1NLJ A;  2F1G A;  2YJB A;  4AXL A;  2HHN A;  2FQ9 A;  3H8B A;  5F02 A;  1EWP A;  2AYO A;  5FPW A;  4MZO A;  3U8E A;  1ITO A;  2G8J A;  1PPP A;  3WXE A;  4PP1 A;  1BGO A;  4P6G A;  3BWK A;  1BQI A;  4I07 A;  1ZIV A;  3P5U A;  1CS8 A;  1PBH A;  3WXG A;  2AYN A;  1HUC B;  3CBK A;  1PAD A;  1ME4 A;  4QRX A;  2AIM A;  3K24 A;  4CDF B;  1GMY A;  2VHF A;  1EWL A;  2DCB A;  3HHA A;  4PI3 A;  3OF9 A;  3N3K A;  3IUT A;  2HXZ A;  3E1Z B;  5JH3 A;  2DZZ A;  3KWZ A;  3RVW A;  1NB3 A;  2OP3 A;  2C0Y A;  3V6C A;  1M6D A;  3V6E A;  1KHQ A;  3M99 A;  2R9F A;  2DC9 A;  2P0R A;  3P5V A;  4DMY A;  3HHI A;  4Q8G A;  3RVV A;  4HWY A;  2H7J A;  2BDZ A;  2IBI A;  3DF0 A;  1XKG A;  1CPJ A;  1ATK A;  6PAD A;  2FTD A;  3F75 A;  4PP2 E;  2R9C A;  1SNK A;  2JQF R;  1U5I A;  3K8U A;  3HD3 A;  3K9M A;  1ME3 A;  3PW3 A;  3RVX A;  2Y5B A;  3ZUA A;  1X9Y A;  1YK8 A;  2DC6 A;  4QBB A;  1CVZ A;  1DF0 A;  4BQV A;  2ARY A;  1PPO A;  4ZUX U;  2GFO A;  3KX1 A;  1TLO A;  2GHU A;  4QRV A;  2ACT A;  5EGW A;  1FH0 A;  4FK5 A;  2FT2 A;  3N3G A;  2B1N A;  5K16 A;  3O1G A;  3F5V A;  1NB5 A;  1QMY A;  4WA6 A;  4BS5 A;  5EF4 A;  3IOQ A;  1MEG A;  2R6N A;  1MEM A;  4XUI A;  4YYQ A;  4G54 A;  3PDF A;  3IHP A;  2CB5 A;  1PXV A;  1O0E A;  2OZ2 A;  4W5B A;  4AXM A;  3IEJ A;  2E02 A;  5CHV A;  1QDQ A;  2E03 A;  4DMX A;  1U9Q X;  3KFQ A;  4PAD A;  1BP4 A;  5CVM A;  3BC3 A;  4N79 A;  1F2C A;  4OEL A;  3BPF A;  2HH5 A;  3BPM A;  1ICF A;  2O6X A;  3OVX A;  2XU5 A;  3H8C A;  3H89 A;  4FJC A;  3ERV A;  4QH6 A;  3KW9 A;  1AYU A;  1AEC A;  2AS8 A;  3KKU A;  4I04 A;  3IV2 A;  2NQI A;  3MHS A;  1PE6 A;  2ATO A;  4CDD B;  3O0U A;  3QJ3 A;  3N4C A;  2AUZ A;  8PCH A;  3LXS A;  4K7C A;  2AUX A;  2CIO A;  1DEU A;  2E00 A;  4W5C A;  1K3B B;  1PPD A;  1GLO A;  3B79 A;  3TNX A;  2OUL A;  2AU1 A;  3MTN A;  4YVA A;  1GEC E;  4I05 A;  1SP4 B;  3OF8 A;  5CHT A;  3PBH A;  4X6J A;  2E01 A;  4X6I A;  4MZS A;  5CVN B;  3CH2 X;  3OVZ A;  1EF7 A;  1QXP A;  1EWO A;  1Y4H A;  3KSE A;  1VSN A;  2P86 A;  3GCB A;  1AU0 A;  3HWN A;  3NHE A;  1NQC A;  3MOR A;  5J94 A;  1PPN A;  1F2B A;  2R9M A;  4YYU A;  1F29 A;  1KFX L;  1EWM A;  1IWD A;  3OIS A;  1KHP A;  3CBJ A;  1TU6 A;  1MS6 A;  2G7Y A;  4BPV A;  1CQD A;  1Q6K A;  3IMA A;  3BCN A;  2DCD A;  1AYW A;  2NQA A;  2G8E A;  2DC7 A;  2XU4 A;  2VHS A;  7PCK A;  2DJF B;  2FO5 A;  4CZW A;  3CH3 X;  1CJL A;  2DC8 A;  3S3R A;  1AU4 A;  1CSB B;  5PAD A;  2PAD A;  2BDL A;  9PAP A;  1THE A;  4N8W A;  5JA7 A;  2Y6E A;  1NL6 A;  4XR7 A;  1JQP A;  3C9E A;  3WXF A;  3KWB X;  1BY8 A;  1POP A;  1U9X A;  1STF E;  2NQG A;  3S3Q A;  1KFU L;  1MDW A;  2R9O A;  4N4Z A;  4KLB A;  1YK7 A;  2WBF X;  2DCA A;  4P6E A;  1CTE A;  2NQD B;  1TL9 A;  2XU3 A;  1S4V A;  2FRQ A;  1CB5 A;  2JQG R;  3P5X A;  4CDC B;  1AYV A;  4MSX A;  2G6D A;  2DZY A;  1AIM A;  2FUD A;  3USV A;  2PBH A;  2PRE A;  3MHH A; 
#chains in the Genus database with same CATH topology
 5KO3 A;  1PIP A;  2YJC A;  4W4U A;  3D6S A;  4BS6 A;  4FIP A;  4OEM A;  2AGA A;  2P7U A;  4MM3 B;  2YJ8 A;  3BOW A;  1Y08 A;  3C0R A;  2UZJ A;  3QT4 A;  3I06 A;  4GUA A;  4IP3 A;  2DCC A;  3P5W A;  2FRA A;  4CDE B;  3QSD A;  4QRG A;  1U9V A;  4BSQ A;  1F2A A;  1GCB A;  3H7D A;  1MHW A;  2B1M A;  1QOL A;  1YVB A;  3I3T A;  4X6H A;  4RY2 A;  1AU2 A;  1CV8 A;  2XU1 A;  3H6S A;  5CVO B;  4BOQ A;  1NPZ A;  3LFY A;  2DJG B;  2F7D A;  2FYE A;  3AI8 A;  1KXR A;  4YYV A;  1ZCM A;  2PNS A;  1A6R A;  1U9W A;  1MIR A;  4YYS A;  1AU3 A;  2IPP B;  4YYW A;  3IFU A;  1YT7 A;  4YYR A;  4YV8 A;  2JRI A;  5A24 A;  2HD5 A;  1PCI A;  2YJ9 A;  1VJV A;  2AVW A;  3PNR A;  4Q8H A;  2YJ2 A;  1YAL A;  2R9N A;  1NLJ A;  2F1G A;  2YJB A;  4AXL A;  2HHN A;  2FQ9 A;  3H8B A;  5F02 A;  1EWP A;  2AYO A;  5FPW A;  4MZO A;  3U8E A;  3OQC A;  1ITO A;  2G8J A;  1PPP A;  3BB7 A;  3WXE A;  4PP1 A;  1BGO A;  1YZB A;  4P6G A;  3BWK A;  2FE8 A;  1BQI A;  4I07 A;  1ZIV A;  3P5U A;  1CS8 A;  4HXD B;  1PBH A;  3WXG A;  2AYN A;  1HUC B;  3CBK A;  1PAD A;  1ME4 A;  4QRX A;  2AIM A;  3K24 A;  4CDF B;  1GMY A;  2VHF A;  1EWL A;  2DCB A;  3HHA A;  4PI3 A;  3OF9 A;  3N3K A;  3IUT A;  2HXZ A;  3E1Z B;  3B21 A;  5JH3 A;  2DZZ A;  2BTW A;  3KWZ A;  3RVW A;  1NB3 A;  2OP3 A;  2C0Y A;  3V6C A;  1M6D A;  3V6E A;  1KHQ A;  3W30 A;  3M99 A;  2R9F A;  2DC9 A;  2P0R A;  3P5V A;  4DMY A;  3HHI A;  4Q8G A;  3RVV A;  4HWY A;  2H7J A;  2BDZ A;  2IBI A;  3DF0 A;  1XKG A;  1CPJ A;  1ATK A;  6PAD A;  2FTD A;  3F75 A;  4PP2 E;  4A5U A;  2R9C A;  1SNK A;  2JQF R;  1U5I A;  3K8U A;  3HD3 A;  3K9M A;  1ME3 A;  3PW3 A;  3RVX A;  2Y5B A;  3ZUA A;  1X9Y A;  4WUR A;  1YK8 A;  2DC6 A;  3PT2 A;  5EZQ A;  4QBB A;  1CVZ A;  4BOP A;  1DF0 A;  4BQV A;  2ARY A;  1PPO A;  3TMP A;  4ZUX U;  2GFO A;  3KX1 A;  1TLO A;  4RF1 A;  2GHU A;  4QRV A;  5JZE A;  2ACT A;  1PVJ A;  5EGW A;  1FH0 A;  4FK5 A;  2FT2 A;  3N3G A;  2B1N A;  5K16 A;  3O1G A;  3F5V A;  1NB5 A;  1QMY A;  4WA6 A;  4BS5 A;  5EF4 A;  3IOQ A;  1MEG A;  2R6N A;  1MEM A;  4XUI A;  3TRK A;  4YYQ A;  4G54 A;  3PDF A;  3IHP A;  2CB5 A;  3MP2 A;  1PXV A;  1O0E A;  2J7Q A;  2OZ2 A;  4W5B A;  4AXM A;  3IEJ A;  2E02 A;  5CHV A;  1QDQ A;  2E03 A;  4RF0 A;  4DMX A;  1U9Q X;  3KFQ A;  4PAD A;  1BP4 A;  5CVM A;  3BC3 A;  4N79 A;  1F2C A;  4BOU A;  4OEL A;  3PHX A;  3BPF A;  2HH5 A;  3BPM A;  1ICF A;  2O6X A;  3OVX A;  4BOZ A;  2J7Q C;  2XU5 A;  3H8C A;  3H89 A;  4FJC A;  3ERV A;  4QH6 A;  3KW9 A;  1AYU A;  4IUM A;  3O65 A;  1AEC A;  2AS8 A;  2BU3 A;  3KKU A;  2BTW B;  4I04 A;  3IV2 A;  2NQI A;  3MHS A;  4REZ A;  1PE6 A;  2ATO A;  4CDD B;  3O0U A;  3QJ3 A;  4RKX A;  3N4C A;  2AUZ A;  8PCH A;  3LXS A;  4K7C A;  2AUX A;  2CIO A;  1DEU A;  2JTC A;  2E00 A;  3BBA A;  4W5C A;  1K3B B;  1PPD A;  1GLO A;  3B79 A;  4MI7 A;  3TNX A;  2OUL A;  3ZNH A;  2AU1 A;  3MTN A;  3PRM A;  4YVA A;  1GEC E;  4I05 A;  1SP4 B;  3OF8 A;  5CHT A;  3PBH A;  1DKI A;  4X6J A;  2E01 A;  4X6I A;  4MZS A;  3PHU A;  5CVN B;  3CH2 X;  3OVZ A;  1EF7 A;  1QXP A;  1EWO A;  1Y4H A;  3KSE A;  4XZX A;  1VSN A;  2P86 A;  3GCB A;  1AU0 A;  3MJ5 A;  3HWN A;  2DOS A;  3NHE A;  3PHW A;  1NQC A;  3MOR A;  5J94 A;  1PPN A;  1F2B A;  3W31 A;  2R9M A;  4YYU A;  1F29 A;  1KFX L;  3MTV A;  1EWM A;  5E6J A;  1IWD A;  3OIS A;  1KHP A;  3CBJ A;  3PSE A;  1TU6 A;  4OVZ B;  1MS6 A;  2G7Y A;  4BPV A;  1CQD A;  4R3D A;  1Q6K A;  4OVZ A;  3IMA A;  4D8B A;  3BCN A;  2DCD A;  3PRP A;  1AYW A;  2NQA A;  2G8E A;  2DC7 A;  2XU4 A;  2VHS A;  7PCK A;  2DJF B;  2FO5 A;  4CZW A;  3CH3 X;  4D8E A;  1CJL A;  2DC8 A;  3S3R A;  1AU4 A;  4RNA A;  3RNV A;  4M0W A;  1CSB B;  5PAD A;  2PAD A;  2BDL A;  4OW0 A;  2Z84 A;  9PAP A;  3BY4 A;  1THE A;  4N8W A;  5JA7 A;  2Y6E A;  1NL6 A;  4XR7 A;  1JQP A;  3C9E A;  3WXF A;  3KWB X;  1BY8 A;  1POP A;  1U9X A;  1STF E;  2NQG A;  3S3Q A;  4D8I A;  1KFU L;  4ZTB A;  1MDW A;  2R9O A;  1UKF A;  4BOS A;  4P16 A;  4N4Z A;  4KLB A;  1YK7 A;  2WBF X;  5EZS A;  2DCA A;  4P6E A;  1CTE A;  2NQD B;  1TL9 A;  2XU3 A;  1S4V A;  2FRQ A;  1CB5 A;  2JQG R;  3P5X A;  4CDC B;  1AYV A;  4MSX A;  2G6D A;  2DZY A;  4PT5 A;  1AIM A;  2FUD A;  3USV A;  2PBH A;  2PRE A;  2HWK A;  3MHH A;  3E9S A; 
#chains in the Genus database with same CATH homology
 1PIP A;  2YJC A;  4W4U A;  3D6S A;  4BS6 A;  4FIP A;  4OEM A;  2P7U A;  2YJ8 A;  3BOW A;  1Y08 A;  3QT4 A;  3I06 A;  2DCC A;  3P5W A;  2FRA A;  4CDE B;  3QSD A;  4QRG A;  1U9V A;  4NV8 A;  4BSQ A;  1F2A A;  1GCB A;  3H7D A;  1MHW A;  2B1M A;  1QOL A;  1W5R A;  1YVB A;  3I3T A;  4X6H A;  4RY2 A;  1AU2 A;  1CV8 A;  2XU1 A;  3H6S A;  5CVO B;  1NPZ A;  3LFY A;  2DJG B;  2F7D A;  2FYE A;  3AI8 A;  1KXR A;  4YYV A;  1ZCM A;  2PNS A;  1A6R A;  1U9W A;  1MIR A;  4YYS A;  1AU3 A;  2IPP B;  4YYW A;  1YT7 A;  4YYR A;  4YV8 A;  5A24 A;  2HD5 A;  1PCI A;  2YJ9 A;  1VJV A;  2AVW A;  3PNR A;  4Q8H A;  2YJ2 A;  1YAL A;  2R9N A;  1NLJ A;  2F1G A;  2YJB A;  4AXL A;  2HHN A;  2FQ9 A;  3H8B A;  5F02 A;  1EWP A;  2AYO A;  5FPW A;  4MZO A;  3U8E A;  1ITO A;  2G8J A;  1PPP A;  3WXE A;  4PP1 A;  1BGO A;  4BGF A;  4P6G A;  3BWK A;  1BQI A;  4I07 A;  1ZIV A;  3P5U A;  1CS8 A;  1PBH A;  3WXG A;  2AYN A;  1HUC B;  3CBK A;  1PAD A;  1ME4 A;  4QRX A;  2AIM A;  3K24 A;  4CDF B;  1GMY A;  2VHF A;  1EWL A;  2DCB A;  3HHA A;  4PI3 A;  3OF9 A;  3N3K A;  3IUT A;  2HXZ A;  3E1Z B;  5JH3 A;  2DZZ A;  3KWZ A;  3RVW A;  1NB3 A;  2OP3 A;  2C0Y A;  3V6C A;  1M6D A;  3V6E A;  1KHQ A;  3M99 A;  2VFC A;  2R9F A;  2BSZ A;  2DC9 A;  2P0R A;  3P5V A;  4DMY A;  3HHI A;  4Q8G A;  3RVV A;  4HWY A;  2H7J A;  2BDZ A;  2IBI A;  3DF0 A;  1XKG A;  1CPJ A;  1ATK A;  6PAD A;  1GX3 A;  2FTD A;  3F75 A;  4PP2 E;  2R9C A;  1SNK A;  2JQF R;  1U5I A;  3K8U A;  3HD3 A;  3K9M A;  1ME3 A;  3PW3 A;  3RVX A;  2Y5B A;  3ZUA A;  1X9Y A;  1YK8 A;  2DC6 A;  4QBB A;  1CVZ A;  1DF0 A;  4BQV A;  2ARY A;  1PPO A;  4ZUX U;  2GFO A;  3KX1 A;  1TLO A;  2GHU A;  4QRV A;  2VFB A;  2ACT A;  5EGW A;  1FH0 A;  4FK5 A;  2FT2 A;  3N3G A;  2B1N A;  5K16 A;  3O1G A;  3F5V A;  1NB5 A;  1QMY A;  4WA6 A;  4BS5 A;  5EF4 A;  1E2T A;  1MEG A;  2R6N A;  3IOQ A;  1MEM A;  4B55 A;  4XUI A;  4YYQ A;  4G54 A;  3PDF A;  3IHP A;  2CB5 A;  1PXV A;  1O0E A;  2OZ2 A;  4W5B A;  4AXM A;  3IEJ A;  1W4T A;  2E02 A;  5CHV A;  1QDQ A;  2E03 A;  4DMX A;  1U9Q X;  3KFQ A;  4PAD A;  1BP4 A;  5CVM A;  3BC3 A;  4N79 A;  1F2C A;  4OEL A;  3BPF A;  2HH5 A;  3BPM A;  1ICF A;  2O6X A;  3OVX A;  4C5P A;  2XU5 A;  3H8C A;  3H89 A;  4FJC A;  3ERV A;  4QH6 A;  3KW9 A;  1AYU A;  1AEC A;  2AS8 A;  3KKU A;  4I04 A;  3IV2 A;  2NQI A;  3MHS A;  1PE6 A;  2ATO A;  4CDD B;  3O0U A;  3QJ3 A;  3N4C A;  2AUZ A;  8PCH A;  3LXS A;  4K7C A;  2AUX A;  2CIO A;  1DEU A;  2E00 A;  4W5C A;  1K3B B;  1PPD A;  1GLO A;  3B79 A;  3TNX A;  3LTW A;  2OUL A;  2AU1 A;  3MTN A;  4YVA A;  1GEC E;  4I05 A;  1SP4 B;  3OF8 A;  5CHT A;  1W6F A;  3PBH A;  4X6J A;  2E01 A;  4X6I A;  4MZS A;  5CVN B;  3CH2 X;  3OVZ A;  1EF7 A;  1QXP A;  1EWO A;  4NV7 A;  1Y4H A;  3KSE A;  1VSN A;  2P86 A;  3GCB A;  1AU0 A;  3HWN A;  3NHE A;  1NQC A;  3MOR A;  5J94 A;  1PPN A;  1F2B A;  2R9M A;  4YYU A;  1F29 A;  1KFX L;  1EWM A;  1IWD A;  3OIS A;  1KHP A;  3CBJ A;  1TU6 A;  1MS6 A;  2G7Y A;  4BPV A;  1CQD A;  1Q6K A;  3IMA A;  3BCN A;  2DCD A;  1AYW A;  2NQA A;  2G8E A;  2DC7 A;  2XU4 A;  2VHS A;  7PCK A;  2DJF B;  2FO5 A;  4CZW A;  3CH3 X;  1CJL A;  3D9W A;  2DC8 A;  3S3R A;  1AU4 A;  1CSB B;  5PAD A;  2PAD A;  2BDL A;  9PAP A;  1THE A;  4N8W A;  5JA7 A;  2Y6E A;  1NL6 A;  4XR7 A;  1JQP A;  3C9E A;  3WXF A;  3KWB X;  1BY8 A;  1POP A;  1U9X A;  1STF E;  2NQG A;  3S3Q A;  1KFU L;  1MDW A;  2R9O A;  4N4Z A;  4KLB A;  1YK7 A;  2WBF X;  2DCA A;  4P6E A;  1CTE A;  2NQD B;  4GUZ A;  1TL9 A;  2XU3 A;  1S4V A;  2FRQ A;  1CB5 A;  2JQG R;  3P5X A;  4CDC B;  1AYV A;  4MSX A;  2G6D A;  2DZY A;  1AIM A;  2FUD A;  3USV A;  2PBH A;  2PRE A;  3MHH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...