4CDFB

Human dpp1 in complex with (2s,4s)-n-((1s)-1-cyano-2-(4-(4- cyanophenyl)phenyl)ethyl)-4-hydroxy-piperidine-2-carboxamide
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
162
structure length
162
Chain Sequence
HLPTSWDWRNVHGINFVSPVRNQASCGSCYSFASMGMLEARIRILTNNSQTPILSPQEVVSCSQYAQGCEGGFPYLIAGKYAQDFGLVEEACFPYTGTDSPCKMKEDCFRYYSSEYHYVGGFYGGCNEALMKLELVHHGPMAVAFEVYDDFLHYKKGIYHHT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DIPEPTIDYL PEPTIDASE 1 EXCLUSION DOMAIN CHAIN
publication title Cathepsin C Inhibitors: Property Optimization and Identification of a Clinical Candidate.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 45
structure length 162
sequence length 162
chains with identical sequence E
ec nomenclature ec 3.4.14.1: Dipeptidyl-peptidase I.
pdb deposition date 2013-10-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 4cdfB01
1PBHA 3N3GA 2DCDA 1QDQA 3C9EA 3O0UA 3IUTA 2F1GA 3MHSA 2E03A 1SP4B 4YYWA 1YK7A 1AU3A 3CH3X 4I05A 4X6JA 3MHHA 1CTEA 1ME4A 1IWDA 4P6EA 3M99A 1BP4A 5PADA 3U8EA 3BPMA 1CV8A 1XKGA 1KXRA 4MZSA 3F5VA 3CBJA 1CSBB 4HWYA 1F29A 3BOWA 4N8WA 2BDLA 1CPJA 3AI8A 3IOQA 4I04A 2JQFR 3F75A 1GMYA 2R9FA 1YALA 4XR7A 2FUDA 2R9CA 3K9MA 7PCKA 4BS6A 2AUXA 2HD5A 3WXFA 1MDWA 2G8JA 1VJVA 1GECE 4YVAA 2E01A 2DC7A 3BPFA 2XU1A 2FRAA 1MIRA 2YJBA 2XU3A 2AVWA 3H6SA 4G54A 2FQ9A 5A24A 1M6DA 4QRXA 1PPDA 2DCBA 1EWPA 2YJ8A 2FO5A 2O6XA 1BQIA 4I07A 5J94A 3KWBX 1YVBA 3PDFA 1U9WA 3QSDA 3D6SA 3OF8A 2R9NA 4QRGA 5CVOB 1SNKA 2AUZA 1POPA 2YJ2A 3QT4A 3WXGA 1AU0A 1STFE 1GCBA 3CBKA 3IHPA 3BWKA 3PNRA 4W5CA 2DCCA 3HHIA 1PXVA 3USVA 2E00A 2G7YA 1MEMA 3PW3A 1AECA 1PPNA 3S3RA 2B1NA 2P7UA 3OVXA 1F2AA 2OULA 1TLOA 4BQVA 2YJCA 1ZIVA 1U9XA 2FTDA 2PNSA 1ITOA 5EF4A 1F2CA 3LXSA 1MEGA 4X6IA 4W4UA 1YT7A 1NB5A 1CQDA 4KLBA 2B1MA 1VSNA 2H7JA 2Y6EA 3P5WA 2XU5A 1KHQA 1KHPA 1CJLA 3KKUA 2DCAA 1NB3A 2HHNA 4N79A 1AIMA 1NL6A 3V6EA 4YYQA 4CDEB 2OZ2A 1Q6KA 4BS5A 2NQDB 5CVMA 1ME3A 3RVWA 2WBFX 1QMYA 2NQGA 4YYSA 1DF0A 3B79A 3P5UA 1ICFA 3CH2X 5CVNB 2AYOA 4WA6A 1HUCB 1BGOA 2DZYA 5JA7A 5K16A 2BDZA 2AIMA 2DC9A 3N3KA 1PADA 1U9QX 1K3BB 1EF7A 1TL9A 4PP2E 8PCHA 3IV2A 3I3TA 2FRQA 4BPVA 2FYEA 3KW9A 1O0EA 1THEA 5JH3A 1CS8A 1DEUA 2DJGB 4N4ZA 1Y4HA 3TNXA 3ERVA 5CHVA 4CDFB 3PBHA 1EWMA 2P86A 3I06A 3E1ZB 2R6NA 4OELA 3H8BA 2ACTA 4BSQA 4YYUA 4MZOA 2F7DA 1PPPA 4FIPA 3QJ3A 3H89A 2DC8A 1ATKA 1X9YA 2XU4A 2IPPB 2Y5BA 1F2BA 6PADA 1MHWA 4DMYA 2C0YA 2AU1A 2DJFB 4AXMA 1U5IA 2GFOA 1GLOA 1CVZA 1MS6A 4FK5A 4YYRA 4K7CA 2NQAA 1QXPA 1YK8A 1KFXL 3K24A 4RY2A 4CDCB 4Q8HA 3MORA 2G6DA 3P5VA 2ATOA 3KWZA 2OP3A 2R9OA 2CIOA 2PADA 1AYUA 1AYWA 3H7DA 3OISA 5CHTA 4CZWA 1BY8A 3IEJA 4AXLA 1NLJA 1CB5A 3KX1A 2VHFA 1PIPA 1Y08A 1A6RA 1NPZA 1AYVA 4OEMA 5EGWA 2ARYA 4DMXA 3HD3A 2DZZA 2P0RA 1JQPA 2JQGR 4P6GA 1PE6A 3KFQA 2R9MA 3BC3A 1AU4A 1S4VA 2FT2A 2PREA 3P5XA 2DC6A 4W5BA 3WXEA 4QRVA 4Q8GA 2GHUA 3IMAA 3N4CA 2YJ9A 3MTNA 1PCIA 2HH5A 4YYVA 2HXZA 3K8UA 4PI3A 1EWLA 3HHAA 4X6HA 3RVVA 1PPOA 4PP1A 4CDDB 3HWNA 1FH0A 3H8CA 4QBBA 4ZUXU 1KFUL 3S3QA 4YV8A 3V6CA 3RVXA 3O1GA 5F02A 1U9VA 1EWOA 1NQCA 1QOLA 2AS8A 4PADA 4QH6A 3LFYA 2CB5A 3OVZA 4FJCA 4MSXA 4XUIA 3OF9A 2VHSA 1TU6A 2AYNA 1AU2A 5FPWA 3ZUAA 3KSEA 3GCBA 2G8EA 2E02A 2PBHA 1ZCMA 3DF0A 9PAPA 2IBIA 2NQIA 3NHEA 3BCNA
chains in the Genus database with same CATH superfamily
1PBHA 3N3GA 4HXDB 2DCDA 1QDQA 3C9EA 3O0UA 3IUTA 2F1GA 3MHSA 1YZBA 2E03A 1SP4B 4YYWA 1YK7A 2J7QC 1AU3A 2HWKA 3CH3X 4I05A 4X6JA 1PVJA 3MHHA 1CTEA 3C0RA 3O65A 1ME4A 1IWDA 4P6EA 3M99A 1BP4A 5PADA 3U8EA 3BPMA 1CV8A 1XKGA 1KXRA 4MZSA 3F5VA 3CBJA 1CSBB 4HWYA 1F29A 3BOWA 4N8WA 2BDLA 1CPJA 3AI8A 3IOQA 4I04A 2JQFR 3F75A 1GMYA 3B21A 2R9FA 1YALA 4XR7A 2FUDA 2R9CA 3K9MA 4M0WA 7PCKA 4BS6A 2AUXA 2HD5A 3WXFA 1MDWA 4BOPA 5EZSA 2G8JA 2Z84A 1VJVA 1GECE 4YVAA 2E01A 4IP3A 2DC7A 3BPFA 2XU1A 2FRAA 1MIRA 2YJBA 2JRIA 2XU3A 2AVWA 3H6SA 4G54A 2FQ9A 5A24A 1M6DA 4QRXA 1PPDA 4OVZA 2DCBA 1EWPA 2YJ8A 4OW0A 4ZTBA 2FO5A 4PT5A 2O6XA 1BQIA 4I07A 4RF1A 5J94A 3BBAA 3KWBX 1YVBA 3PDFA 1U9WA 3PHWA 3QSDA 3D6SA 3OF8A 2R9NA 3PSEA 4QRGA 5CVOB 1SNKA 2AGAA 2AUZA 1POPA 5JZEA 2YJ2A 3QT4A 3WXGA 2BU3A 1AU0A 1STFE 1GCBA 3CBKA 3IHPA 3PRPA 4RKXA 3BWKA 3PNRA 4W5CA 2DCCA 3HHIA 1PXVA 3USVA 3PRMA 2E00A 2G7YA 1MEMA 3PW3A 1AECA 1PPNA 3S3RA 2B1NA 2P7UA 3OVXA 1F2AA 2OULA 1TLOA 4BQVA 4BOUA 2YJCA 1ZIVA 1U9XA 2FTDA 2PNSA 1ITOA 5EF4A 1F2CA 2DOSA 3LXSA 1MEGA 4X6IA 3TRKA 4W4UA 1YT7A 1NB5A 3ZNHA 1CQDA 4KLBA 2B1MA 1VSNA 2H7JA 2Y6EA 3P5WA 3TMPA 2XU5A 1KHQA 1KHPA 4BOSA 1CJLA 3KKUA 2DCAA 1NB3A 2HHNA 3MTVA 4N79A 1DKIA 1AIMA 1NL6A 3V6EA 4YYQA 4CDEB 2OZ2A 1Q6KA 4BS5A 3BY4A 3OQCA 2NQDB 5CVMA 1ME3A 3RVWA 2WBFX 1QMYA 2NQGA 4YYSA 1DF0A 3B79A 3P5UA 1ICFA 3CH2X 5CVNB 2JTCA 2AYOA 4WA6A 4R3DA 1HUCB 1BGOA 5E6JA 2DZYA 5JA7A 4GUAA 5K16A 2BDZA 2AIMA 2DC9A 3N3KA 1PADA 1U9QX 1K3BB 1EF7A 1TL9A 4PP2E 8PCHA 3IV2A 3I3TA 2FRQA 4BPVA 2FYEA 3PHXA 3KW9A 1O0EA 1THEA 5JH3A 1CS8A 1DEUA 2DJGB 4N4ZA 4IUMA 1Y4HA 3TNXA 3ERVA 5CHVA 4CDFB 3PBHA 1EWMA 2P86A 3W31A 3I06A 3E1ZB 2R6NA 4OELA 4REZA 3H8BA 2BTWB 4RF0A 2ACTA 4BSQA 4BOZA 4YYUA 4MZOA 2F7DA 1PPPA 4FIPA 3PHUA 3QJ3A 3H89A 2DC8A 1ATKA 1X9YA 2J7QA 2XU4A 3BB7A 2IPPB 2Y5BA 1F2BA 6PADA 1MHWA 4DMYA 2C0YA 2AU1A 2DJFB 4AXMA 4MM3B 1U5IA 2GFOA 4OVZB 1GLOA 1CVZA 1MS6A 4FK5A 4P16A 4YYRA 4K7CA 2NQAA 1QXPA 4MI7A 4BOQA 1YK8A 1KFXL 3K24A 4RY2A 4CDCB 4Q8HA 3MORA 2G6DA 3P5VA 2ATOA 3KWZA 2OP3A 2R9OA 2CIOA 2PADA 1AYUA 1AYWA 3H7DA 3OISA 4D8BA 5CHTA 4CZWA 1BY8A 3IEJA 4AXLA 1NLJA 1CB5A 3KX1A 2VHFA 1PIPA 1Y08A 1A6RA 1NPZA 1AYVA 4OEMA 5EGWA 2ARYA 4DMXA 2UZJA 3HD3A 2DZZA 5KO3A 2P0RA 1UKFA 1JQPA 2JQGR 4D8IA 4P6GA 1PE6A 3KFQA 2R9MA 3BC3A 1AU4A 3MP2A 1S4VA 2FT2A 2PREA 3P5XA 2DC6A 4WURA 4W5BA 3WXEA 4QRVA 4XZXA 5EZQA 4Q8GA 2GHUA 3IMAA 3N4CA 4RNAA 2YJ9A 2BTWA 3MTNA 1PCIA 2HH5A 4YYVA 3W30A 2HXZA 3K8UA 3MJ5A 4PI3A 1EWLA 4A5UA 3HHAA 4X6HA 3RVVA 1PPOA 4PP1A 4CDDB 3RNVA 3HWNA 1FH0A 4D8EA 2FE8A 3H8CA 4QBBA 4ZUXU 1KFUL 3S3QA 4YV8A 3V6CA 3RVXA 3O1GA 3IFUA 1U9VA 5F02A 1EWOA 1NQCA 1QOLA 2AS8A 4PADA 4QH6A 3PT2A 3LFYA 2CB5A 3OVZA 4FJCA 4MSXA 4XUIA 3OF9A 2VHSA 3E9SA 1TU6A 2AYNA 1AU2A 5FPWA 3ZUAA 3KSEA 3GCBA 2G8EA 2E02A 2PBHA 1ZCMA 3DF0A 9PAPA 2IBIA 2NQIA 3NHEA 3BCNA
chains in the Genus database with same CATH topology
1PBHA 3N3GA 2DCDA 1QDQA 3C9EA 3O0UA 3IUTA 2F1GA 3MHSA 2E03A 1SP4B 4YYWA 1YK7A 1AU3A 3CH3X 4I05A 4X6JA 3MHHA 1CTEA 1ME4A 1IWDA 4P6EA 3M99A 1BP4A 5PADA 3U8EA 3BPMA 1CV8A 1XKGA 1KXRA 4MZSA 1GX3A 3F5VA 3CBJA 1CSBB 4HWYA 1F29A 3BOWA 1E2TA 4N8WA 2BDLA 1CPJA 3AI8A 3IOQA 4I04A 2JQFR 3F75A 1GMYA 2R9FA 1YALA 4XR7A 2FUDA 2R9CA 3K9MA 7PCKA 4BS6A 2AUXA 2HD5A 3WXFA 4NV8A 1MDWA 2G8JA 1VJVA 4GUZA 1GECE 4YVAA 2E01A 2DC7A 3BPFA 2XU1A 2FRAA 1MIRA 2YJBA 2XU3A 2AVWA 3H6SA 4G54A 2FQ9A 5A24A 1M6DA 4QRXA 1PPDA 2DCBA 1EWPA 2YJ8A 2FO5A 2O6XA 1BQIA 4I07A 5J94A 3KWBX 1YVBA 3PDFA 1U9WA 3QSDA 3D6SA 3OF8A 2R9NA 4QRGA 5CVOB 1SNKA 2AUZA 1POPA 2YJ2A 3QT4A 3WXGA 1AU0A 1STFE 1GCBA 3CBKA 3IHPA 3BWKA 3PNRA 4W5CA 2DCCA 3HHIA 1PXVA 3USVA 2E00A 2G7YA 1MEMA 3PW3A 1AECA 1W5RA 1PPNA 3S3RA 2B1NA 2P7UA 3OVXA 1F2AA 2OULA 1TLOA 4BQVA 2YJCA 1ZIVA 4BGFA 1U9XA 2FTDA 2PNSA 1ITOA 5EF4A 1F2CA 3LXSA 1MEGA 4X6IA 4W4UA 1YT7A 1NB5A 1CQDA 4KLBA 2B1MA 1VSNA 2H7JA 2Y6EA 3P5WA 2XU5A 1KHQA 1KHPA 1CJLA 3KKUA 2DCAA 1NB3A 2HHNA 4N79A 1AIMA 1NL6A 3V6EA 4YYQA 4CDEB 2OZ2A 1Q6KA 4BS5A 2BSZA 2NQDB 5CVMA 1ME3A 3RVWA 2WBFX 1QMYA 2NQGA 4YYSA 1DF0A 3B79A 3P5UA 1ICFA 3CH2X 5CVNB 2AYOA 4WA6A 1HUCB 1BGOA 2DZYA 5JA7A 5K16A 2BDZA 2AIMA 2DC9A 3N3KA 1PADA 1U9QX 1K3BB 1EF7A 1TL9A 4PP2E 8PCHA 3IV2A 3I3TA 2FRQA 4BPVA 2FYEA 3D9WA 3KW9A 1O0EA 1THEA 5JH3A 1CS8A 1DEUA 2DJGB 4N4ZA 1Y4HA 3TNXA 3ERVA 5CHVA 4CDFB 3PBHA 1EWMA 2P86A 3I06A 3E1ZB 2R6NA 4OELA 1W4TA 3H8BA 2ACTA 4BSQA 4YYUA 4MZOA 2F7DA 1PPPA 4FIPA 3QJ3A 3H89A 2DC8A 1ATKA 1X9YA 2XU4A 2IPPB 2VFBA 1F2BA 2Y5BA 6PADA 1MHWA 4DMYA 2C0YA 2AU1A 2DJFB 4AXMA 1U5IA 2GFOA 1GLOA 1CVZA 1MS6A 4FK5A 4YYRA 4K7CA 2NQAA 1QXPA 4NV7A 1YK8A 1KFXL 3K24A 4RY2A 4CDCB 4Q8HA 3MORA 2G6DA 3P5VA 2ATOA 3KWZA 2OP3A 2R9OA 2CIOA 2PADA 1AYUA 1AYWA 3H7DA 3OISA 5CHTA 4CZWA 1BY8A 3IEJA 4AXLA 1NLJA 1CB5A 3KX1A 2VHFA 1PIPA 1Y08A 1A6RA 1NPZA 1AYVA 4OEMA 5EGWA 2ARYA 4DMXA 3HD3A 2DZZA 2P0RA 1JQPA 2JQGR 4P6GA 1PE6A 3KFQA 2R9MA 3BC3A 1AU4A 1S4VA 2FT2A 2PREA 3P5XA 2DC6A 4W5BA 3WXEA 4QRVA 4C5PA 4Q8GA 2GHUA 3IMAA 3N4CA 2YJ9A 3MTNA 1PCIA 2HH5A 4YYVA 2HXZA 3K8UA 4PI3A 1EWLA 3HHAA 4X6HA 3RVVA 1PPOA 4PP1A 4CDDB 3HWNA 1FH0A 3LTWA 3H8CA 4QBBA 4ZUXU 1KFUL 3S3QA 4YV8A 3V6CA 3RVXA 3O1GA 5F02A 1U9VA 1EWOA 1NQCA 1QOLA 2AS8A 4PADA 4QH6A 3LFYA 2CB5A 3OVZA 4FJCA 4MSXA 4XUIA 3OF9A 2VHSA 4B55A 1TU6A 2AYNA 1AU2A 5FPWA 3ZUAA 1W6FA 3KSEA 3GCBA 2G8EA 2E02A 2PBHA 1ZCMA 3DF0A 9PAPA 2IBIA 2NQIA 3NHEA 3BCNA 2VFCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PBH A;  3N3G A;  2DCD A;  1QDQ A;  3C9E A;  3O0U A;  3IUT A;  2F1G A;  3MHS A;  2E03 A;  1SP4 B;  4YYW A;  1YK7 A;  1AU3 A;  3CH3 X;  4I05 A;  4X6J A;  3MHH A;  1CTE A;  1ME4 A;  1IWD A;  4P6E A;  3M99 A;  1BP4 A;  5PAD A;  3U8E A;  3BPM A;  1CV8 A;  1XKG A;  1KXR A;  4MZS A;  3F5V A;  3CBJ A;  1CSB B;  4HWY A;  1F29 A;  3BOW A;  4N8W A;  2BDL A;  1CPJ A;  3AI8 A;  3IOQ A;  4I04 A;  2JQF R;  3F75 A;  1GMY A;  2R9F A;  1YAL A;  4XR7 A;  2FUD A;  2R9C A;  3K9M A;  7PCK A;  4BS6 A;  2AUX A;  2HD5 A;  3WXF A;  1MDW A;  2G8J A;  1VJV A;  1GEC E;  4YVA A;  2E01 A;  2DC7 A;  3BPF A;  2XU1 A;  2FRA A;  1MIR A;  2YJB A;  2XU3 A;  2AVW A;  3H6S A;  4G54 A;  2FQ9 A;  5A24 A;  1M6D A;  4QRX A;  1PPD A;  2DCB A;  1EWP A;  2YJ8 A;  2FO5 A;  2O6X A;  1BQI A;  4I07 A;  5J94 A;  3KWB X;  1YVB A;  3PDF A;  1U9W A;  3QSD A;  3D6S A;  3OF8 A;  2R9N A;  4QRG A;  5CVO B;  1SNK A;  2AUZ A;  1POP A;  2YJ2 A;  3QT4 A;  3WXG A;  1AU0 A;  1STF E;  1GCB A;  3CBK A;  3IHP A;  3BWK A;  3PNR A;  4W5C A;  2DCC A;  3HHI A;  1PXV A;  3USV A;  2E00 A;  2G7Y A;  1MEM A;  3PW3 A;  1AEC A;  1PPN A;  3S3R A;  2B1N A;  2P7U A;  3OVX A;  1F2A A;  2OUL A;  1TLO A;  4BQV A;  2YJC A;  1ZIV A;  1U9X A;  2FTD A;  2PNS A;  1ITO A;  5EF4 A;  1F2C A;  3LXS A;  1MEG A;  4X6I A;  4W4U A;  1YT7 A;  1NB5 A;  1CQD A;  4KLB A;  2B1M A;  1VSN A;  2H7J A;  2Y6E A;  3P5W A;  2XU5 A;  1KHQ A;  1KHP A;  1CJL A;  3KKU A;  2DCA A;  1NB3 A;  2HHN A;  4N79 A;  1AIM A;  1NL6 A;  3V6E A;  4YYQ A;  4CDE B;  2OZ2 A;  1Q6K A;  4BS5 A;  2NQD B;  5CVM A;  1ME3 A;  3RVW A;  2WBF X;  1QMY A;  2NQG A;  4YYS A;  1DF0 A;  3B79 A;  3P5U A;  1ICF A;  3CH2 X;  5CVN B;  2AYO A;  4WA6 A;  1HUC B;  1BGO A;  2DZY A;  5JA7 A;  5K16 A;  2BDZ A;  2AIM A;  2DC9 A;  3N3K A;  1PAD A;  1U9Q X;  1K3B B;  1EF7 A;  1TL9 A;  4PP2 E;  8PCH A;  3IV2 A;  3I3T A;  2FRQ A;  4BPV A;  2FYE A;  3KW9 A;  1O0E A;  1THE A;  5JH3 A;  1CS8 A;  1DEU A;  2DJG B;  4N4Z A;  1Y4H A;  3TNX A;  3ERV A;  5CHV A;  4CDF B;  3PBH A;  1EWM A;  2P86 A;  3I06 A;  3E1Z B;  2R6N A;  4OEL A;  3H8B A;  2ACT A;  4BSQ A;  4YYU A;  4MZO A;  2F7D A;  1PPP A;  4FIP A;  3QJ3 A;  3H89 A;  2DC8 A;  1ATK A;  1X9Y A;  2XU4 A;  2IPP B;  2Y5B A;  1F2B A;  6PAD A;  1MHW A;  4DMY A;  2C0Y A;  2AU1 A;  2DJF B;  4AXM A;  1U5I A;  2GFO A;  1GLO A;  1CVZ A;  1MS6 A;  4FK5 A;  4YYR A;  4K7C A;  2NQA A;  1QXP A;  1YK8 A;  1KFX L;  3K24 A;  4RY2 A;  4CDC B;  4Q8H A;  3MOR A;  2G6D A;  3P5V A;  2ATO A;  3KWZ A;  2OP3 A;  2R9O A;  2CIO A;  2PAD A;  1AYU A;  1AYW A;  3H7D A;  3OIS A;  5CHT A;  4CZW A;  1BY8 A;  3IEJ A;  4AXL A;  1NLJ A;  1CB5 A;  3KX1 A;  2VHF A;  1PIP A;  1Y08 A;  1A6R A;  1NPZ A;  1AYV A;  4OEM A;  5EGW A;  2ARY A;  4DMX A;  3HD3 A;  2DZZ A;  2P0R A;  1JQP A;  2JQG R;  4P6G A;  1PE6 A;  3KFQ A;  2R9M A;  3BC3 A;  1AU4 A;  1S4V A;  2FT2 A;  2PRE A;  3P5X A;  2DC6 A;  4W5B A;  3WXE A;  4QRV A;  4Q8G A;  2GHU A;  3IMA A;  3N4C A;  2YJ9 A;  3MTN A;  1PCI A;  2HH5 A;  4YYV A;  2HXZ A;  3K8U A;  4PI3 A;  1EWL A;  3HHA A;  4X6H A;  3RVV A;  1PPO A;  4PP1 A;  4CDD B;  3HWN A;  1FH0 A;  3H8C A;  4QBB A;  4ZUX U;  1KFU L;  3S3Q A;  4YV8 A;  3V6C A;  3RVX A;  3O1G A;  5F02 A;  1U9V A;  1EWO A;  1NQC A;  1QOL A;  2AS8 A;  4PAD A;  4QH6 A;  3LFY A;  2CB5 A;  3OVZ A;  4FJC A;  4MSX A;  4XUI A;  3OF9 A;  2VHS A;  1TU6 A;  2AYN A;  1AU2 A;  5FPW A;  3ZUA A;  3KSE A;  3GCB A;  2G8E A;  2E02 A;  2PBH A;  1ZCM A;  3DF0 A;  9PAP A;  2IBI A;  2NQI A;  3NHE A;  3BCN A; 
#chains in the Genus database with same CATH topology
 1PBH A;  3N3G A;  4HXD B;  2DCD A;  1QDQ A;  3C9E A;  3O0U A;  3IUT A;  2F1G A;  3MHS A;  1YZB A;  2E03 A;  1SP4 B;  4YYW A;  1YK7 A;  2J7Q C;  1AU3 A;  2HWK A;  3CH3 X;  4I05 A;  4X6J A;  1PVJ A;  3MHH A;  1CTE A;  3C0R A;  3O65 A;  1ME4 A;  1IWD A;  4P6E A;  3M99 A;  1BP4 A;  5PAD A;  3U8E A;  3BPM A;  1CV8 A;  1XKG A;  1KXR A;  4MZS A;  3F5V A;  3CBJ A;  1CSB B;  4HWY A;  1F29 A;  3BOW A;  4N8W A;  2BDL A;  1CPJ A;  3AI8 A;  3IOQ A;  4I04 A;  2JQF R;  3F75 A;  1GMY A;  3B21 A;  2R9F A;  1YAL A;  4XR7 A;  2FUD A;  2R9C A;  3K9M A;  4M0W A;  7PCK A;  4BS6 A;  2AUX A;  2HD5 A;  3WXF A;  1MDW A;  4BOP A;  5EZS A;  2G8J A;  2Z84 A;  1VJV A;  1GEC E;  4YVA A;  2E01 A;  4IP3 A;  2DC7 A;  3BPF A;  2XU1 A;  2FRA A;  1MIR A;  2YJB A;  2JRI A;  2XU3 A;  2AVW A;  3H6S A;  4G54 A;  2FQ9 A;  5A24 A;  1M6D A;  4QRX A;  1PPD A;  4OVZ A;  2DCB A;  1EWP A;  2YJ8 A;  4OW0 A;  4ZTB A;  2FO5 A;  4PT5 A;  2O6X A;  1BQI A;  4I07 A;  4RF1 A;  5J94 A;  3BBA A;  3KWB X;  1YVB A;  3PDF A;  1U9W A;  3PHW A;  3QSD A;  3D6S A;  3OF8 A;  2R9N A;  3PSE A;  4QRG A;  5CVO B;  1SNK A;  2AGA A;  2AUZ A;  1POP A;  5JZE A;  2YJ2 A;  3QT4 A;  3WXG A;  2BU3 A;  1AU0 A;  1STF E;  1GCB A;  3CBK A;  3IHP A;  3PRP A;  4RKX A;  3BWK A;  3PNR A;  4W5C A;  2DCC A;  3HHI A;  1PXV A;  3USV A;  3PRM A;  2E00 A;  2G7Y A;  1MEM A;  3PW3 A;  1AEC A;  1PPN A;  3S3R A;  2B1N A;  2P7U A;  3OVX A;  1F2A A;  2OUL A;  1TLO A;  4BQV A;  4BOU A;  2YJC A;  1ZIV A;  1U9X A;  2FTD A;  2PNS A;  1ITO A;  5EF4 A;  1F2C A;  2DOS A;  3LXS A;  1MEG A;  4X6I A;  3TRK A;  4W4U A;  1YT7 A;  1NB5 A;  3ZNH A;  1CQD A;  4KLB A;  2B1M A;  1VSN A;  2H7J A;  2Y6E A;  3P5W A;  3TMP A;  2XU5 A;  1KHQ A;  1KHP A;  4BOS A;  1CJL A;  3KKU A;  2DCA A;  1NB3 A;  2HHN A;  3MTV A;  4N79 A;  1DKI A;  1AIM A;  1NL6 A;  3V6E A;  4YYQ A;  4CDE B;  2OZ2 A;  1Q6K A;  4BS5 A;  3BY4 A;  3OQC A;  2NQD B;  5CVM A;  1ME3 A;  3RVW A;  2WBF X;  1QMY A;  2NQG A;  4YYS A;  1DF0 A;  3B79 A;  3P5U A;  1ICF A;  3CH2 X;  5CVN B;  2JTC A;  2AYO A;  4WA6 A;  4R3D A;  1HUC B;  1BGO A;  5E6J A;  2DZY A;  5JA7 A;  4GUA A;  5K16 A;  2BDZ A;  2AIM A;  2DC9 A;  3N3K A;  1PAD A;  1U9Q X;  1K3B B;  1EF7 A;  1TL9 A;  4PP2 E;  8PCH A;  3IV2 A;  3I3T A;  2FRQ A;  4BPV A;  2FYE A;  3PHX A;  3KW9 A;  1O0E A;  1THE A;  5JH3 A;  1CS8 A;  1DEU A;  2DJG B;  4N4Z A;  4IUM A;  1Y4H A;  3TNX A;  3ERV A;  5CHV A;  4CDF B;  3PBH A;  1EWM A;  2P86 A;  3W31 A;  3I06 A;  3E1Z B;  2R6N A;  4OEL A;  4REZ A;  3H8B A;  2BTW B;  4RF0 A;  2ACT A;  4BSQ A;  4BOZ A;  4YYU A;  4MZO A;  2F7D A;  1PPP A;  4FIP A;  3PHU A;  3QJ3 A;  3H89 A;  2DC8 A;  1ATK A;  1X9Y A;  2J7Q A;  2XU4 A;  3BB7 A;  2IPP B;  2Y5B A;  1F2B A;  6PAD A;  1MHW A;  4DMY A;  2C0Y A;  2AU1 A;  2DJF B;  4AXM A;  4MM3 B;  1U5I A;  2GFO A;  4OVZ B;  1GLO A;  1CVZ A;  1MS6 A;  4FK5 A;  4P16 A;  4YYR A;  4K7C A;  2NQA A;  1QXP A;  4MI7 A;  4BOQ A;  1YK8 A;  1KFX L;  3K24 A;  4RY2 A;  4CDC B;  4Q8H A;  3MOR A;  2G6D A;  3P5V A;  2ATO A;  3KWZ A;  2OP3 A;  2R9O A;  2CIO A;  2PAD A;  1AYU A;  1AYW A;  3H7D A;  3OIS A;  4D8B A;  5CHT A;  4CZW A;  1BY8 A;  3IEJ A;  4AXL A;  1NLJ A;  1CB5 A;  3KX1 A;  2VHF A;  1PIP A;  1Y08 A;  1A6R A;  1NPZ A;  1AYV A;  4OEM A;  5EGW A;  2ARY A;  4DMX A;  2UZJ A;  3HD3 A;  2DZZ A;  5KO3 A;  2P0R A;  1UKF A;  1JQP A;  2JQG R;  4D8I A;  4P6G A;  1PE6 A;  3KFQ A;  2R9M A;  3BC3 A;  1AU4 A;  3MP2 A;  1S4V A;  2FT2 A;  2PRE A;  3P5X A;  2DC6 A;  4WUR A;  4W5B A;  3WXE A;  4QRV A;  4XZX A;  5EZQ A;  4Q8G A;  2GHU A;  3IMA A;  3N4C A;  4RNA A;  2YJ9 A;  2BTW A;  3MTN A;  1PCI A;  2HH5 A;  4YYV A;  3W30 A;  2HXZ A;  3K8U A;  3MJ5 A;  4PI3 A;  1EWL A;  4A5U A;  3HHA A;  4X6H A;  3RVV A;  1PPO A;  4PP1 A;  4CDD B;  3RNV A;  3HWN A;  1FH0 A;  4D8E A;  2FE8 A;  3H8C A;  4QBB A;  4ZUX U;  1KFU L;  3S3Q A;  4YV8 A;  3V6C A;  3RVX A;  3O1G A;  3IFU A;  1U9V A;  5F02 A;  1EWO A;  1NQC A;  1QOL A;  2AS8 A;  4PAD A;  4QH6 A;  3PT2 A;  3LFY A;  2CB5 A;  3OVZ A;  4FJC A;  4MSX A;  4XUI A;  3OF9 A;  2VHS A;  3E9S A;  1TU6 A;  2AYN A;  1AU2 A;  5FPW A;  3ZUA A;  3KSE A;  3GCB A;  2G8E A;  2E02 A;  2PBH A;  1ZCM A;  3DF0 A;  9PAP A;  2IBI A;  2NQI A;  3NHE A;  3BCN A; 
#chains in the Genus database with same CATH homology
 1PBH A;  3N3G A;  2DCD A;  1QDQ A;  3C9E A;  3O0U A;  3IUT A;  2F1G A;  3MHS A;  2E03 A;  1SP4 B;  4YYW A;  1YK7 A;  1AU3 A;  3CH3 X;  4I05 A;  4X6J A;  3MHH A;  1CTE A;  1ME4 A;  1IWD A;  4P6E A;  3M99 A;  1BP4 A;  5PAD A;  3U8E A;  3BPM A;  1CV8 A;  1XKG A;  1KXR A;  4MZS A;  1GX3 A;  3F5V A;  3CBJ A;  1CSB B;  4HWY A;  1F29 A;  3BOW A;  1E2T A;  4N8W A;  2BDL A;  1CPJ A;  3AI8 A;  3IOQ A;  4I04 A;  2JQF R;  3F75 A;  1GMY A;  2R9F A;  1YAL A;  4XR7 A;  2FUD A;  2R9C A;  3K9M A;  7PCK A;  4BS6 A;  2AUX A;  2HD5 A;  3WXF A;  4NV8 A;  1MDW A;  2G8J A;  1VJV A;  4GUZ A;  1GEC E;  4YVA A;  2E01 A;  2DC7 A;  3BPF A;  2XU1 A;  2FRA A;  1MIR A;  2YJB A;  2XU3 A;  2AVW A;  3H6S A;  4G54 A;  2FQ9 A;  5A24 A;  1M6D A;  4QRX A;  1PPD A;  2DCB A;  1EWP A;  2YJ8 A;  2FO5 A;  2O6X A;  1BQI A;  4I07 A;  5J94 A;  3KWB X;  1YVB A;  3PDF A;  1U9W A;  3QSD A;  3D6S A;  3OF8 A;  2R9N A;  4QRG A;  5CVO B;  1SNK A;  2AUZ A;  1POP A;  2YJ2 A;  3QT4 A;  3WXG A;  1AU0 A;  1STF E;  1GCB A;  3CBK A;  3IHP A;  3BWK A;  3PNR A;  4W5C A;  2DCC A;  3HHI A;  1PXV A;  3USV A;  2E00 A;  2G7Y A;  1MEM A;  3PW3 A;  1AEC A;  1W5R A;  1PPN A;  3S3R A;  2B1N A;  2P7U A;  3OVX A;  1F2A A;  2OUL A;  1TLO A;  4BQV A;  2YJC A;  1ZIV A;  4BGF A;  1U9X A;  2FTD A;  2PNS A;  1ITO A;  5EF4 A;  1F2C A;  3LXS A;  1MEG A;  4X6I A;  4W4U A;  1YT7 A;  1NB5 A;  1CQD A;  4KLB A;  2B1M A;  1VSN A;  2H7J A;  2Y6E A;  3P5W A;  2XU5 A;  1KHQ A;  1KHP A;  1CJL A;  3KKU A;  2DCA A;  1NB3 A;  2HHN A;  4N79 A;  1AIM A;  1NL6 A;  3V6E A;  4YYQ A;  4CDE B;  2OZ2 A;  1Q6K A;  4BS5 A;  2BSZ A;  2NQD B;  5CVM A;  1ME3 A;  3RVW A;  2WBF X;  1QMY A;  2NQG A;  4YYS A;  1DF0 A;  3B79 A;  3P5U A;  1ICF A;  3CH2 X;  5CVN B;  2AYO A;  4WA6 A;  1HUC B;  1BGO A;  2DZY A;  5JA7 A;  5K16 A;  2BDZ A;  2AIM A;  2DC9 A;  3N3K A;  1PAD A;  1U9Q X;  1K3B B;  1EF7 A;  1TL9 A;  4PP2 E;  8PCH A;  3IV2 A;  3I3T A;  2FRQ A;  4BPV A;  2FYE A;  3D9W A;  3KW9 A;  1O0E A;  1THE A;  5JH3 A;  1CS8 A;  1DEU A;  2DJG B;  4N4Z A;  1Y4H A;  3TNX A;  3ERV A;  5CHV A;  4CDF B;  3PBH A;  1EWM A;  2P86 A;  3I06 A;  3E1Z B;  2R6N A;  4OEL A;  1W4T A;  3H8B A;  2ACT A;  4BSQ A;  4YYU A;  4MZO A;  2F7D A;  1PPP A;  4FIP A;  3QJ3 A;  3H89 A;  2DC8 A;  1ATK A;  1X9Y A;  2XU4 A;  2IPP B;  2VFB A;  1F2B A;  2Y5B A;  6PAD A;  1MHW A;  4DMY A;  2C0Y A;  2AU1 A;  2DJF B;  4AXM A;  1U5I A;  2GFO A;  1GLO A;  1CVZ A;  1MS6 A;  4FK5 A;  4YYR A;  4K7C A;  2NQA A;  1QXP A;  4NV7 A;  1YK8 A;  1KFX L;  3K24 A;  4RY2 A;  4CDC B;  4Q8H A;  3MOR A;  2G6D A;  3P5V A;  2ATO A;  3KWZ A;  2OP3 A;  2R9O A;  2CIO A;  2PAD A;  1AYU A;  1AYW A;  3H7D A;  3OIS A;  5CHT A;  4CZW A;  1BY8 A;  3IEJ A;  4AXL A;  1NLJ A;  1CB5 A;  3KX1 A;  2VHF A;  1PIP A;  1Y08 A;  1A6R A;  1NPZ A;  1AYV A;  4OEM A;  5EGW A;  2ARY A;  4DMX A;  3HD3 A;  2DZZ A;  2P0R A;  1JQP A;  2JQG R;  4P6G A;  1PE6 A;  3KFQ A;  2R9M A;  3BC3 A;  1AU4 A;  1S4V A;  2FT2 A;  2PRE A;  3P5X A;  2DC6 A;  4W5B A;  3WXE A;  4QRV A;  4C5P A;  4Q8G A;  2GHU A;  3IMA A;  3N4C A;  2YJ9 A;  3MTN A;  1PCI A;  2HH5 A;  4YYV A;  2HXZ A;  3K8U A;  4PI3 A;  1EWL A;  3HHA A;  4X6H A;  3RVV A;  1PPO A;  4PP1 A;  4CDD B;  3HWN A;  1FH0 A;  3LTW A;  3H8C A;  4QBB A;  4ZUX U;  1KFU L;  3S3Q A;  4YV8 A;  3V6C A;  3RVX A;  3O1G A;  5F02 A;  1U9V A;  1EWO A;  1NQC A;  1QOL A;  2AS8 A;  4PAD A;  4QH6 A;  3LFY A;  2CB5 A;  3OVZ A;  4FJC A;  4MSX A;  4XUI A;  3OF9 A;  2VHS A;  4B55 A;  1TU6 A;  2AYN A;  1AU2 A;  5FPW A;  3ZUA A;  1W6F A;  3KSE A;  3GCB A;  2G8E A;  2E02 A;  2PBH A;  1ZCM A;  3DF0 A;  9PAP A;  2IBI A;  2NQI A;  3NHE A;  3BCN A;  2VFC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...