3KX1A

Cathepsin k in complex with a selective 2-cyano-pyrimidine inhibitor
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
213
structure length
213
Chain Sequence
DSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Cathepsin K
publication title Design and optimization of a series of novel 2-cyano-pyrimidines as cathepsin K inhibitors
pubmed doi rcsb
source organism Homo sapiens
total genus 60
structure length 213
sequence length 213
ec nomenclature ec 3.4.22.38: Cathepsin K.
pdb deposition date 2009-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3kx1A00
3H8BA 3IV2A 4XR7A 3P5UA 4XUIA 2R9FA 2P7UA 1MHWA 4QRGA 1Y08A 1CSBB 2DCAA 1M6DA 1PPNA 3KW9A 3O1GA 4RY2A 3ERVA 4AXMA 1NB3A 1ZCMA 2HD5A 1VJVA 1GMYA 2DJFB 1A6RA 1BP4A 3WXFA 3OF9A 3CBKA 3RVWA 4BPVA 4BSQA 5JA7A 5K16A 3F75A 1IWDA 3TNXA 1AU2A 2JQGR 1YK7A 2GFOA 4CDEB 2DC8A 2CB5A 2DC6A 3CH3X 1PIPA 1K3BB 2XU5A 2JQFR 5JH3A 4W5CA 2NQDB 4DMXA 4WA6A 1PPOA 3KX1A 2CIOA 4YYVA 2E01A 2DC9A 2DZZA 3WXGA 3P5WA 1TLOA 1PBHA 8PCHA 1PXVA 5F02A 2R6NA 3KWZA 1F2BA 1KFXL 3PDFA 3PBHA 2XU3A 3BWKA 3V6EA 3U8EA 3D6SA 4P6GA 1ZIVA 4X6HA 3IUTA 2XU4A 3OISA 4FJCA 2PNSA 1CTEA 5PADA 3MHHA 4BS6A 2P0RA 2IBIA 1AIMA 1PADA 2E03A 3K24A 1X9YA 2FO5A 3NHEA 3P5VA 2P86A 3H6SA 2OZ2A 3MTNA 1CV8A 4YYQA 2R9CA 3N3KA 4X6JA 1F29A 3QT4A 4G54A 1HUCB 2OP3A 5EF4A 2G6DA 2FRQA 3C9EA 4QRXA 1KFUL 4W4UA 1PCIA 2AIMA 3USVA 4K7CA 3N3GA 2YJCA 3BPFA 1S4VA 1SNKA 1MEMA 1NB5A 3WXEA 1AU3A 1YVBA 1ITOA 1U5IA 3OVXA 1ME3A 2G8JA 3DF0A 1O0EA 1KHQA 2BDLA 5J94A 2F7DA 2G7YA 1FH0A 4I05A 1VSNA 3HHIA 5CHVA 2FT2A 3H7DA 1Y4HA 4BQVA 3RVXA 3GCBA 3MHSA 4BS5A 1CJLA 1CS8A 1PPDA 3CH2X 3IMAA 1AYVA 3E1ZB 4YYWA 2PREA 4FK5A 3BC3A 2AS8A 1CQDA 1NL6A 1SP4B 3BCNA 4Q8GA 2F1GA 4Q8HA 2BDZA 4QH6A 1DEUA 2AU1A 2NQGA 1YK8A 2FQ9A 2IPPB 2Y5BA 1MEGA 2ARYA 1BGOA 1ATKA 3HWNA 2AUZA 1TU6A 2G8EA 1AECA 1XKGA 2DCCA 3B79A 1QMYA 2VHFA 3V6CA 2ATOA 2ACTA 4YYSA 2R9OA 2C0YA 2FUDA 1CPJA 4AXLA 1GCBA 4YYUA 1KHPA 1U9XA 2PBHA 2AYOA 5CHTA 2YJ8A 1KXRA 3H89A 1F2AA 2DJGB 3BOWA 3F5VA 3QJ3A 4I07A 4OELA 3QSDA 1NQCA 4I04A 4HWYA 4N8WA 7PCKA 1CB5A 1ME4A 2NQAA 2AVWA 1EWOA 1DF0A 3I06A 5CVNB 3MORA 2VHSA 2YJBA 1QDQA 2HHNA 3K8UA 2DCBA 3OF8A 2H7JA 1EF7A 3KFQA 1NLJA 2DCDA 1U9QX 2FTDA 4KLBA 4CDFB 3BPMA 4DMYA 4CZWA 4PI3A 1THEA 2DC7A 2WBFX 2Y6EA 2YJ9A 4ZUXU 2AYNA 2B1MA 4PP2E 3OVZA 3AI8A 1GLOA 5CVOB 3K9MA 2B1NA 1CVZA 3HD3A 1NPZA 3LXSA 3I3TA 1AU0A 1AYWA 3IEJA 4N4ZA 1MDWA 1PE6A 3PNRA 1U9VA 3IHPA 1EWMA 1QXPA 2AUXA 2E02A 3N4CA 1GECE 4CDDB 3LFYA 3M99A 4PP1A 3S3QA 3KWBX 1U9WA 3IOQA 2XU1A 3CBJA 2DZYA 3KKUA 1QOLA 1Q6KA 4P6EA 4QBBA 5FPWA 4N79A 4X6IA 2NQIA 4MZOA 5CVMA 4CDCB 1BY8A 4MSXA 2YJ2A 9PAPA 3KSEA 3HHAA 4PADA 2OULA 4YVAA 3P5XA 1YT7A 6PADA 1F2CA 2R9NA 3PW3A 3H8CA 1TL9A 1STFE 2R9MA 1MS6A 3ZUAA 4FIPA 5EGWA 1PPPA 2O6XA 1EWLA 4YV8A 4QRVA 2E00A 3S3RA 2HXZA 4W5BA 2FRAA 4OEMA 1AYUA 3O0UA 2PADA 2FYEA 1BQIA 5A24A 1MIRA 2HH5A 1YALA 1ICFA 2GHUA 1EWPA 4YYRA 1JQPA 1AU4A 4MZSA 1POPA 3RVVA
chains in the Genus database with same CATH superfamily
3H8BA 3BY4A 3IV2A 4XR7A 3P5UA 4XUIA 4MM3B 2R9FA 2P7UA 1MHWA 4QRGA 1Y08A 5JZEA 1CSBB 2DCAA 1M6DA 1PPNA 3KW9A 3O1GA 4RY2A 3ERVA 4AXMA 5EZQA 1NB3A 1ZCMA 2HD5A 3PHXA 3PSEA 1VJVA 1GMYA 2DJFB 1A6RA 3TRKA 1BP4A 3WXFA 3OF9A 3CBKA 3RVWA 4BPVA 4BSQA 3TMPA 5JA7A 3PHUA 4R3DA 3F75A 4OVZB 5K16A 4RKXA 1IWDA 3TNXA 1AU2A 2JQGR 1YK7A 2GFOA 4CDEB 4BOPA 2DC8A 2CB5A 2DC6A 3CH3X 1PIPA 4GUAA 5EZSA 1K3BB 4ZTBA 2XU5A 2JQFR 5JH3A 4W5CA 2NQDB 4DMXA 4WA6A 1PPOA 3KX1A 3ZNHA 2JRIA 2CIOA 4YYVA 2E01A 2DC9A 2DZZA 3WXGA 4BOSA 3P5WA 1TLOA 1PBHA 8PCHA 3MTVA 1PXVA 5F02A 2R6NA 3KWZA 1F2BA 1KFXL 3IFUA 3PDFA 3PBHA 2XU3A 3BWKA 3V6EA 3U8EA 3D6SA 4P6GA 1ZIVA 4X6HA 5KO3A 3IUTA 2XU4A 3OISA 4FJCA 5E6JA 2PNSA 1CTEA 5PADA 3MHHA 4BS6A 2P0RA 2IBIA 1AIMA 1PADA 2E03A 3K24A 1X9YA 2FO5A 3NHEA 3P5VA 2P86A 2Z84A 3H6SA 2OZ2A 3MTNA 1CV8A 4M0WA 4YYQA 2R9CA 3N3KA 2BTWA 2AGAA 4X6JA 1F29A 3QT4A 3W31A 4IP3A 4G54A 1HUCB 4OVZA 2OP3A 5EF4A 4BOQA 4XZXA 2G6DA 2FRQA 3C9EA 4QRXA 4BOZA 1KFUL 4W4UA 1PCIA 3E9SA 2AIMA 3MP2A 3USVA 4K7CA 3N3GA 2YJCA 3BPFA 1S4VA 1SNKA 1MEMA 1NB5A 3WXEA 1AU3A 1YVBA 1ITOA 1U5IA 3OVXA 3B21A 1ME3A 2G8JA 3DF0A 1O0EA 1KHQA 2BDLA 5J94A 3RNVA 2F7DA 2G7YA 1FH0A 2BTWB 4I05A 1VSNA 3HHIA 5CHVA 2FT2A 3H7DA 1Y4HA 4BQVA 3RVXA 3GCBA 3MHSA 4BS5A 1CJLA 1CS8A 1PPDA 3CH2X 1DKIA 3IMAA 1AYVA 3E1ZB 4YYWA 2PREA 4FK5A 3BC3A 2AS8A 1CQDA 1NL6A 1SP4B 3BCNA 4Q8GA 2F1GA 4Q8HA 2BDZA 4QH6A 1DEUA 2AU1A 2NQGA 2FE8A 3W30A 1YK8A 2FQ9A 2IPPB 2Y5BA 1MEGA 2ARYA 1BGOA 4HXDB 1ATKA 3HWNA 2AUZA 1TU6A 2G8EA 1AECA 1XKGA 4RF0A 2DCCA 3B79A 1QMYA 3OQCA 2VHFA 3V6CA 2ATOA 2ACTA 4YYSA 2R9OA 4RNAA 2C0YA 2FUDA 1CPJA 4AXLA 1GCBA 4YYUA 1KHPA 1U9XA 2PBHA 2AYOA 3PRMA 5CHTA 2YJ8A 1KXRA 2JTCA 3H89A 1F2AA 2DJGB 3BOWA 3F5VA 3QJ3A 4I07A 4OELA 3QSDA 1NQCA 4I04A 4HWYA 4N8WA 4BOUA 7PCKA 1CB5A 1ME4A 2NQAA 2AVWA 1EWOA 1DF0A 3PHWA 3I06A 5CVNB 3MORA 2VHSA 2YJBA 1QDQA 2HHNA 2UZJA 3K8UA 2DCBA 3OF8A 2H7JA 3MJ5A 1EF7A 4OW0A 4WURA 4D8EA 3KFQA 1NLJA 2DCDA 1U9QX 2FTDA 4KLBA 4CDFB 3BPMA 4DMYA 4CZWA 4PI3A 1THEA 2DC7A 2WBFX 2Y6EA 2YJ9A 4ZUXU 2AYNA 2DOSA 2B1MA 4PP2E 3OVZA 3AI8A 1GLOA 5CVOB 4D8BA 3K9MA 2B1NA 1CVZA 4A5UA 3HD3A 4IUMA 1NPZA 3LXSA 3I3TA 1AU0A 1AYWA 3IEJA 4N4ZA 1MDWA 2J7QA 1PE6A 3PNRA 1U9VA 3IHPA 1EWMA 4REZA 1QXPA 2AUXA 1PVJA 2E02A 3N4CA 4RF1A 1GECE 2BU3A 4CDDB 3LFYA 3M99A 3PRPA 4PP1A 3S3QA 4P16A 3KWBX 1U9WA 3IOQA 2XU1A 4MI7A 3CBJA 2DZYA 3KKUA 1QOLA 3O65A 1Q6KA 4P6EA 4QBBA 5FPWA 4N79A 4X6IA 2NQIA 1YZBA 4MZOA 5CVMA 4CDCB 1BY8A 4MSXA 2YJ2A 9PAPA 3KSEA 3HHAA 4PADA 2OULA 3BB7A 4YVAA 3P5XA 2J7QC 1YT7A 6PADA 1F2CA 2R9NA 3PW3A 3H8CA 1TL9A 1STFE 2R9MA 1MS6A 3ZUAA 4FIPA 5EGWA 3PT2A 1PPPA 2O6XA 1EWLA 4YV8A 4QRVA 2E00A 3S3RA 2HXZA 4W5BA 3BBAA 2FRAA 4OEMA 1AYUA 3O0UA 2PADA 2FYEA 1BQIA 5A24A 4PT5A 1MIRA 4D8IA 2HH5A 1YALA 1ICFA 2GHUA 1EWPA 1UKFA 2HWKA 4YYRA 1JQPA 3C0RA 1AU4A 4MZSA 1POPA 3RVVA
chains in the Genus database with same CATH topology
3H8BA 4GUZA 3IV2A 4XR7A 3P5UA 4XUIA 2R9FA 2P7UA 1MHWA 4QRGA 1Y08A 1CSBB 2DCAA 1M6DA 1PPNA 3KW9A 3O1GA 4RY2A 3ERVA 4AXMA 1NB3A 1ZCMA 2HD5A 1VJVA 1GMYA 2DJFB 1A6RA 1BP4A 3WXFA 3OF9A 3CBKA 3RVWA 4BPVA 4BSQA 4NV8A 5JA7A 5K16A 3F75A 1IWDA 3TNXA 1AU2A 2JQGR 1YK7A 2GFOA 4CDEB 2DC8A 2CB5A 2DC6A 3CH3X 1PIPA 1K3BB 2XU5A 2JQFR 5JH3A 4W5CA 2NQDB 4DMXA 4WA6A 1PPOA 3KX1A 2CIOA 4YYVA 2E01A 2DC9A 2DZZA 3WXGA 3P5WA 1TLOA 1PBHA 8PCHA 1PXVA 5F02A 2R6NA 3KWZA 1F2BA 1KFXL 3PDFA 3PBHA 2XU3A 3BWKA 3V6EA 3U8EA 3D6SA 4P6GA 1ZIVA 4X6HA 3IUTA 2XU4A 3OISA 4NV7A 4FJCA 2PNSA 1CTEA 5PADA 3MHHA 4BS6A 2P0RA 2IBIA 1AIMA 1PADA 2E03A 3K24A 1X9YA 2FO5A 3NHEA 3P5VA 2P86A 3H6SA 2OZ2A 1GX3A 3MTNA 1CV8A 4YYQA 2R9CA 3N3KA 4X6JA 1F29A 3QT4A 4G54A 1HUCB 1W5RA 2OP3A 3LTWA 5EF4A 2G6DA 2FRQA 3C9EA 4QRXA 4BGFA 1KFUL 4W4UA 1PCIA 2AIMA 3D9WA 3USVA 4K7CA 3N3GA 2YJCA 3BPFA 1S4VA 1SNKA 1MEMA 1NB5A 3WXEA 1AU3A 1YVBA 1ITOA 1U5IA 3OVXA 1ME3A 2G8JA 3DF0A 1O0EA 1KHQA 2BDLA 5J94A 2F7DA 2G7YA 1FH0A 4I05A 1VSNA 3HHIA 5CHVA 2FT2A 3H7DA 1Y4HA 4BQVA 3RVXA 3GCBA 3MHSA 4BS5A 1CJLA 1CS8A 1PPDA 3CH2X 3IMAA 1AYVA 3E1ZB 4YYWA 2PREA 4FK5A 3BC3A 2AS8A 1CQDA 1NL6A 1SP4B 3BCNA 4C5PA 4Q8GA 2F1GA 4Q8HA 2BDZA 4QH6A 1DEUA 2AU1A 2NQGA 1YK8A 2FQ9A 2IPPB 1E2TA 2Y5BA 1MEGA 2ARYA 1BGOA 1ATKA 3HWNA 2AUZA 1TU6A 2G8EA 1AECA 1XKGA 2DCCA 3B79A 1QMYA 2VHFA 3V6CA 2ATOA 2ACTA 4YYSA 2R9OA 2C0YA 2FUDA 1CPJA 4AXLA 1GCBA 4YYUA 1KHPA 1U9XA 2PBHA 2AYOA 5CHTA 2YJ8A 1KXRA 3H89A 1F2AA 2DJGB 3BOWA 3F5VA 3QJ3A 4I07A 2VFCA 4OELA 3QSDA 1NQCA 4I04A 4HWYA 4N8WA 7PCKA 1CB5A 1ME4A 2NQAA 2AVWA 1EWOA 1DF0A 3I06A 5CVNB 3MORA 2VHSA 2YJBA 1QDQA 2HHNA 3K8UA 2DCBA 3OF8A 2H7JA 1EF7A 3KFQA 1NLJA 2DCDA 1U9QX 2FTDA 4KLBA 4CDFB 3BPMA 4DMYA 4CZWA 4PI3A 1THEA 2DC7A 2WBFX 2Y6EA 2YJ9A 4ZUXU 2AYNA 2B1MA 4PP2E 3OVZA 3AI8A 1GLOA 5CVOB 3K9MA 2B1NA 1CVZA 3HD3A 1NPZA 3LXSA 3I3TA 1AU0A 1AYWA 3IEJA 4N4ZA 1MDWA 1PE6A 3PNRA 1U9VA 3IHPA 1EWMA 1QXPA 2AUXA 2E02A 3N4CA 1GECE 4CDDB 3LFYA 3M99A 4PP1A 3S3QA 3KWBX 1U9WA 3IOQA 2XU1A 3CBJA 2DZYA 1W6FA 3KKUA 1QOLA 1Q6KA 4P6EA 4QBBA 5FPWA 4N79A 4X6IA 2NQIA 4MZOA 5CVMA 4CDCB 1BY8A 4MSXA 2YJ2A 1W4TA 9PAPA 3KSEA 3HHAA 4PADA 2OULA 4YVAA 3P5XA 1YT7A 6PADA 1F2CA 2R9NA 2VFBA 3PW3A 3H8CA 1TL9A 1STFE 2R9MA 1MS6A 3ZUAA 4FIPA 5EGWA 1PPPA 2O6XA 1EWLA 4YV8A 2BSZA 4QRVA 2E00A 3S3RA 2HXZA 4W5BA 2FRAA 4OEMA 1AYUA 3O0UA 4B55A 2PADA 2FYEA 1BQIA 5A24A 1MIRA 2HH5A 1YALA 1ICFA 2GHUA 1EWPA 4YYRA 1JQPA 1AU4A 4MZSA 1POPA 3RVVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H8B A;  3IV2 A;  4XR7 A;  3P5U A;  4XUI A;  2R9F A;  2P7U A;  1MHW A;  4QRG A;  1Y08 A;  1CSB B;  2DCA A;  1M6D A;  1PPN A;  3KW9 A;  3O1G A;  4RY2 A;  3ERV A;  4AXM A;  1NB3 A;  1ZCM A;  2HD5 A;  1VJV A;  1GMY A;  2DJF B;  1A6R A;  1BP4 A;  3WXF A;  3OF9 A;  3CBK A;  3RVW A;  4BPV A;  4BSQ A;  5JA7 A;  5K16 A;  3F75 A;  1IWD A;  3TNX A;  1AU2 A;  2JQG R;  1YK7 A;  2GFO A;  4CDE B;  2DC8 A;  2CB5 A;  2DC6 A;  3CH3 X;  1PIP A;  1K3B B;  2XU5 A;  2JQF R;  5JH3 A;  4W5C A;  2NQD B;  4DMX A;  4WA6 A;  1PPO A;  3KX1 A;  2CIO A;  4YYV A;  2E01 A;  2DC9 A;  2DZZ A;  3WXG A;  3P5W A;  1TLO A;  1PBH A;  8PCH A;  1PXV A;  5F02 A;  2R6N A;  3KWZ A;  1F2B A;  1KFX L;  3PDF A;  3PBH A;  2XU3 A;  3BWK A;  3V6E A;  3U8E A;  3D6S A;  4P6G A;  1ZIV A;  4X6H A;  3IUT A;  2XU4 A;  3OIS A;  4FJC A;  2PNS A;  1CTE A;  5PAD A;  3MHH A;  4BS6 A;  2P0R A;  2IBI A;  1AIM A;  1PAD A;  2E03 A;  3K24 A;  1X9Y A;  2FO5 A;  3NHE A;  3P5V A;  2P86 A;  3H6S A;  2OZ2 A;  3MTN A;  1CV8 A;  4YYQ A;  2R9C A;  3N3K A;  4X6J A;  1F29 A;  3QT4 A;  4G54 A;  1HUC B;  2OP3 A;  5EF4 A;  2G6D A;  2FRQ A;  3C9E A;  4QRX A;  1KFU L;  4W4U A;  1PCI A;  2AIM A;  3USV A;  4K7C A;  3N3G A;  2YJC A;  3BPF A;  1S4V A;  1SNK A;  1MEM A;  1NB5 A;  3WXE A;  1AU3 A;  1YVB A;  1ITO A;  1U5I A;  3OVX A;  1ME3 A;  2G8J A;  3DF0 A;  1O0E A;  1KHQ A;  2BDL A;  5J94 A;  2F7D A;  2G7Y A;  1FH0 A;  4I05 A;  1VSN A;  3HHI A;  5CHV A;  2FT2 A;  3H7D A;  1Y4H A;  4BQV A;  3RVX A;  3GCB A;  3MHS A;  4BS5 A;  1CJL A;  1CS8 A;  1PPD A;  3CH2 X;  3IMA A;  1AYV A;  3E1Z B;  4YYW A;  2PRE A;  4FK5 A;  3BC3 A;  2AS8 A;  1CQD A;  1NL6 A;  1SP4 B;  3BCN A;  4Q8G A;  2F1G A;  4Q8H A;  2BDZ A;  4QH6 A;  1DEU A;  2AU1 A;  2NQG A;  1YK8 A;  2FQ9 A;  2IPP B;  2Y5B A;  1MEG A;  2ARY A;  1BGO A;  1ATK A;  3HWN A;  2AUZ A;  1TU6 A;  2G8E A;  1AEC A;  1XKG A;  2DCC A;  3B79 A;  1QMY A;  2VHF A;  3V6C A;  2ATO A;  2ACT A;  4YYS A;  2R9O A;  2C0Y A;  2FUD A;  1CPJ A;  4AXL A;  1GCB A;  4YYU A;  1KHP A;  1U9X A;  2PBH A;  2AYO A;  5CHT A;  2YJ8 A;  1KXR A;  3H89 A;  1F2A A;  2DJG B;  3BOW A;  3F5V A;  3QJ3 A;  4I07 A;  4OEL A;  3QSD A;  1NQC A;  4I04 A;  4HWY A;  4N8W A;  7PCK A;  1CB5 A;  1ME4 A;  2NQA A;  2AVW A;  1EWO A;  1DF0 A;  3I06 A;  5CVN B;  3MOR A;  2VHS A;  2YJB A;  1QDQ A;  2HHN A;  3K8U A;  2DCB A;  3OF8 A;  2H7J A;  1EF7 A;  3KFQ A;  1NLJ A;  2DCD A;  1U9Q X;  2FTD A;  4KLB A;  4CDF B;  3BPM A;  4DMY A;  4CZW A;  4PI3 A;  1THE A;  2DC7 A;  2WBF X;  2Y6E A;  2YJ9 A;  4ZUX U;  2AYN A;  2B1M A;  4PP2 E;  3OVZ A;  3AI8 A;  1GLO A;  5CVO B;  3K9M A;  2B1N A;  1CVZ A;  3HD3 A;  1NPZ A;  3LXS A;  3I3T A;  1AU0 A;  1AYW A;  3IEJ A;  4N4Z A;  1MDW A;  1PE6 A;  3PNR A;  1U9V A;  3IHP A;  1EWM A;  1QXP A;  2AUX A;  2E02 A;  3N4C A;  1GEC E;  4CDD B;  3LFY A;  3M99 A;  4PP1 A;  3S3Q A;  3KWB X;  1U9W A;  3IOQ A;  2XU1 A;  3CBJ A;  2DZY A;  3KKU A;  1QOL A;  1Q6K A;  4P6E A;  4QBB A;  5FPW A;  4N79 A;  4X6I A;  2NQI A;  4MZO A;  5CVM A;  4CDC B;  1BY8 A;  4MSX A;  2YJ2 A;  9PAP A;  3KSE A;  3HHA A;  4PAD A;  2OUL A;  4YVA A;  3P5X A;  1YT7 A;  6PAD A;  1F2C A;  2R9N A;  3PW3 A;  3H8C A;  1TL9 A;  1STF E;  2R9M A;  1MS6 A;  3ZUA A;  4FIP A;  5EGW A;  1PPP A;  2O6X A;  1EWL A;  4YV8 A;  4QRV A;  2E00 A;  3S3R A;  2HXZ A;  4W5B A;  2FRA A;  4OEM A;  1AYU A;  3O0U A;  2PAD A;  2FYE A;  1BQI A;  5A24 A;  1MIR A;  2HH5 A;  1YAL A;  1ICF A;  2GHU A;  1EWP A;  4YYR A;  1JQP A;  1AU4 A;  4MZS A;  1POP A;  3RVV A; 
#chains in the Genus database with same CATH topology
 3H8B A;  3BY4 A;  3IV2 A;  4XR7 A;  3P5U A;  4XUI A;  4MM3 B;  2R9F A;  2P7U A;  1MHW A;  4QRG A;  1Y08 A;  5JZE A;  1CSB B;  2DCA A;  1M6D A;  1PPN A;  3KW9 A;  3O1G A;  4RY2 A;  3ERV A;  4AXM A;  5EZQ A;  1NB3 A;  1ZCM A;  2HD5 A;  3PHX A;  3PSE A;  1VJV A;  1GMY A;  2DJF B;  1A6R A;  3TRK A;  1BP4 A;  3WXF A;  3OF9 A;  3CBK A;  3RVW A;  4BPV A;  4BSQ A;  3TMP A;  5JA7 A;  3PHU A;  4R3D A;  3F75 A;  4OVZ B;  5K16 A;  4RKX A;  1IWD A;  3TNX A;  1AU2 A;  2JQG R;  1YK7 A;  2GFO A;  4CDE B;  4BOP A;  2DC8 A;  2CB5 A;  2DC6 A;  3CH3 X;  1PIP A;  4GUA A;  5EZS A;  1K3B B;  4ZTB A;  2XU5 A;  2JQF R;  5JH3 A;  4W5C A;  2NQD B;  4DMX A;  4WA6 A;  1PPO A;  3KX1 A;  3ZNH A;  2JRI A;  2CIO A;  4YYV A;  2E01 A;  2DC9 A;  2DZZ A;  3WXG A;  4BOS A;  3P5W A;  1TLO A;  1PBH A;  8PCH A;  3MTV A;  1PXV A;  5F02 A;  2R6N A;  3KWZ A;  1F2B A;  1KFX L;  3IFU A;  3PDF A;  3PBH A;  2XU3 A;  3BWK A;  3V6E A;  3U8E A;  3D6S A;  4P6G A;  1ZIV A;  4X6H A;  5KO3 A;  3IUT A;  2XU4 A;  3OIS A;  4FJC A;  5E6J A;  2PNS A;  1CTE A;  5PAD A;  3MHH A;  4BS6 A;  2P0R A;  2IBI A;  1AIM A;  1PAD A;  2E03 A;  3K24 A;  1X9Y A;  2FO5 A;  3NHE A;  3P5V A;  2P86 A;  2Z84 A;  3H6S A;  2OZ2 A;  3MTN A;  1CV8 A;  4M0W A;  4YYQ A;  2R9C A;  3N3K A;  2BTW A;  2AGA A;  4X6J A;  1F29 A;  3QT4 A;  3W31 A;  4IP3 A;  4G54 A;  1HUC B;  4OVZ A;  2OP3 A;  5EF4 A;  4BOQ A;  4XZX A;  2G6D A;  2FRQ A;  3C9E A;  4QRX A;  4BOZ A;  1KFU L;  4W4U A;  1PCI A;  3E9S A;  2AIM A;  3MP2 A;  3USV A;  4K7C A;  3N3G A;  2YJC A;  3BPF A;  1S4V A;  1SNK A;  1MEM A;  1NB5 A;  3WXE A;  1AU3 A;  1YVB A;  1ITO A;  1U5I A;  3OVX A;  3B21 A;  1ME3 A;  2G8J A;  3DF0 A;  1O0E A;  1KHQ A;  2BDL A;  5J94 A;  3RNV A;  2F7D A;  2G7Y A;  1FH0 A;  2BTW B;  4I05 A;  1VSN A;  3HHI A;  5CHV A;  2FT2 A;  3H7D A;  1Y4H A;  4BQV A;  3RVX A;  3GCB A;  3MHS A;  4BS5 A;  1CJL A;  1CS8 A;  1PPD A;  3CH2 X;  1DKI A;  3IMA A;  1AYV A;  3E1Z B;  4YYW A;  2PRE A;  4FK5 A;  3BC3 A;  2AS8 A;  1CQD A;  1NL6 A;  1SP4 B;  3BCN A;  4Q8G A;  2F1G A;  4Q8H A;  2BDZ A;  4QH6 A;  1DEU A;  2AU1 A;  2NQG A;  2FE8 A;  3W30 A;  1YK8 A;  2FQ9 A;  2IPP B;  2Y5B A;  1MEG A;  2ARY A;  1BGO A;  4HXD B;  1ATK A;  3HWN A;  2AUZ A;  1TU6 A;  2G8E A;  1AEC A;  1XKG A;  4RF0 A;  2DCC A;  3B79 A;  1QMY A;  3OQC A;  2VHF A;  3V6C A;  2ATO A;  2ACT A;  4YYS A;  2R9O A;  4RNA A;  2C0Y A;  2FUD A;  1CPJ A;  4AXL A;  1GCB A;  4YYU A;  1KHP A;  1U9X A;  2PBH A;  2AYO A;  3PRM A;  5CHT A;  2YJ8 A;  1KXR A;  2JTC A;  3H89 A;  1F2A A;  2DJG B;  3BOW A;  3F5V A;  3QJ3 A;  4I07 A;  4OEL A;  3QSD A;  1NQC A;  4I04 A;  4HWY A;  4N8W A;  4BOU A;  7PCK A;  1CB5 A;  1ME4 A;  2NQA A;  2AVW A;  1EWO A;  1DF0 A;  3PHW A;  3I06 A;  5CVN B;  3MOR A;  2VHS A;  2YJB A;  1QDQ A;  2HHN A;  2UZJ A;  3K8U A;  2DCB A;  3OF8 A;  2H7J A;  3MJ5 A;  1EF7 A;  4OW0 A;  4WUR A;  4D8E A;  3KFQ A;  1NLJ A;  2DCD A;  1U9Q X;  2FTD A;  4KLB A;  4CDF B;  3BPM A;  4DMY A;  4CZW A;  4PI3 A;  1THE A;  2DC7 A;  2WBF X;  2Y6E A;  2YJ9 A;  4ZUX U;  2AYN A;  2DOS A;  2B1M A;  4PP2 E;  3OVZ A;  3AI8 A;  1GLO A;  5CVO B;  4D8B A;  3K9M A;  2B1N A;  1CVZ A;  4A5U A;  3HD3 A;  4IUM A;  1NPZ A;  3LXS A;  3I3T A;  1AU0 A;  1AYW A;  3IEJ A;  4N4Z A;  1MDW A;  2J7Q A;  1PE6 A;  3PNR A;  1U9V A;  3IHP A;  1EWM A;  4REZ A;  1QXP A;  2AUX A;  1PVJ A;  2E02 A;  3N4C A;  4RF1 A;  1GEC E;  2BU3 A;  4CDD B;  3LFY A;  3M99 A;  3PRP A;  4PP1 A;  3S3Q A;  4P16 A;  3KWB X;  1U9W A;  3IOQ A;  2XU1 A;  4MI7 A;  3CBJ A;  2DZY A;  3KKU A;  1QOL A;  3O65 A;  1Q6K A;  4P6E A;  4QBB A;  5FPW A;  4N79 A;  4X6I A;  2NQI A;  1YZB A;  4MZO A;  5CVM A;  4CDC B;  1BY8 A;  4MSX A;  2YJ2 A;  9PAP A;  3KSE A;  3HHA A;  4PAD A;  2OUL A;  3BB7 A;  4YVA A;  3P5X A;  2J7Q C;  1YT7 A;  6PAD A;  1F2C A;  2R9N A;  3PW3 A;  3H8C A;  1TL9 A;  1STF E;  2R9M A;  1MS6 A;  3ZUA A;  4FIP A;  5EGW A;  3PT2 A;  1PPP A;  2O6X A;  1EWL A;  4YV8 A;  4QRV A;  2E00 A;  3S3R A;  2HXZ A;  4W5B A;  3BBA A;  2FRA A;  4OEM A;  1AYU A;  3O0U A;  2PAD A;  2FYE A;  1BQI A;  5A24 A;  4PT5 A;  1MIR A;  4D8I A;  2HH5 A;  1YAL A;  1ICF A;  2GHU A;  1EWP A;  1UKF A;  2HWK A;  4YYR A;  1JQP A;  3C0R A;  1AU4 A;  4MZS A;  1POP A;  3RVV A; 
#chains in the Genus database with same CATH homology
 3H8B A;  4GUZ A;  3IV2 A;  4XR7 A;  3P5U A;  4XUI A;  2R9F A;  2P7U A;  1MHW A;  4QRG A;  1Y08 A;  1CSB B;  2DCA A;  1M6D A;  1PPN A;  3KW9 A;  3O1G A;  4RY2 A;  3ERV A;  4AXM A;  1NB3 A;  1ZCM A;  2HD5 A;  1VJV A;  1GMY A;  2DJF B;  1A6R A;  1BP4 A;  3WXF A;  3OF9 A;  3CBK A;  3RVW A;  4BPV A;  4BSQ A;  4NV8 A;  5JA7 A;  5K16 A;  3F75 A;  1IWD A;  3TNX A;  1AU2 A;  2JQG R;  1YK7 A;  2GFO A;  4CDE B;  2DC8 A;  2CB5 A;  2DC6 A;  3CH3 X;  1PIP A;  1K3B B;  2XU5 A;  2JQF R;  5JH3 A;  4W5C A;  2NQD B;  4DMX A;  4WA6 A;  1PPO A;  3KX1 A;  2CIO A;  4YYV A;  2E01 A;  2DC9 A;  2DZZ A;  3WXG A;  3P5W A;  1TLO A;  1PBH A;  8PCH A;  1PXV A;  5F02 A;  2R6N A;  3KWZ A;  1F2B A;  1KFX L;  3PDF A;  3PBH A;  2XU3 A;  3BWK A;  3V6E A;  3U8E A;  3D6S A;  4P6G A;  1ZIV A;  4X6H A;  3IUT A;  2XU4 A;  3OIS A;  4NV7 A;  4FJC A;  2PNS A;  1CTE A;  5PAD A;  3MHH A;  4BS6 A;  2P0R A;  2IBI A;  1AIM A;  1PAD A;  2E03 A;  3K24 A;  1X9Y A;  2FO5 A;  3NHE A;  3P5V A;  2P86 A;  3H6S A;  2OZ2 A;  1GX3 A;  3MTN A;  1CV8 A;  4YYQ A;  2R9C A;  3N3K A;  4X6J A;  1F29 A;  3QT4 A;  4G54 A;  1HUC B;  1W5R A;  2OP3 A;  3LTW A;  5EF4 A;  2G6D A;  2FRQ A;  3C9E A;  4QRX A;  4BGF A;  1KFU L;  4W4U A;  1PCI A;  2AIM A;  3D9W A;  3USV A;  4K7C A;  3N3G A;  2YJC A;  3BPF A;  1S4V A;  1SNK A;  1MEM A;  1NB5 A;  3WXE A;  1AU3 A;  1YVB A;  1ITO A;  1U5I A;  3OVX A;  1ME3 A;  2G8J A;  3DF0 A;  1O0E A;  1KHQ A;  2BDL A;  5J94 A;  2F7D A;  2G7Y A;  1FH0 A;  4I05 A;  1VSN A;  3HHI A;  5CHV A;  2FT2 A;  3H7D A;  1Y4H A;  4BQV A;  3RVX A;  3GCB A;  3MHS A;  4BS5 A;  1CJL A;  1CS8 A;  1PPD A;  3CH2 X;  3IMA A;  1AYV A;  3E1Z B;  4YYW A;  2PRE A;  4FK5 A;  3BC3 A;  2AS8 A;  1CQD A;  1NL6 A;  1SP4 B;  3BCN A;  4C5P A;  4Q8G A;  2F1G A;  4Q8H A;  2BDZ A;  4QH6 A;  1DEU A;  2AU1 A;  2NQG A;  1YK8 A;  2FQ9 A;  2IPP B;  1E2T A;  2Y5B A;  1MEG A;  2ARY A;  1BGO A;  1ATK A;  3HWN A;  2AUZ A;  1TU6 A;  2G8E A;  1AEC A;  1XKG A;  2DCC A;  3B79 A;  1QMY A;  2VHF A;  3V6C A;  2ATO A;  2ACT A;  4YYS A;  2R9O A;  2C0Y A;  2FUD A;  1CPJ A;  4AXL A;  1GCB A;  4YYU A;  1KHP A;  1U9X A;  2PBH A;  2AYO A;  5CHT A;  2YJ8 A;  1KXR A;  3H89 A;  1F2A A;  2DJG B;  3BOW A;  3F5V A;  3QJ3 A;  4I07 A;  2VFC A;  4OEL A;  3QSD A;  1NQC A;  4I04 A;  4HWY A;  4N8W A;  7PCK A;  1CB5 A;  1ME4 A;  2NQA A;  2AVW A;  1EWO A;  1DF0 A;  3I06 A;  5CVN B;  3MOR A;  2VHS A;  2YJB A;  1QDQ A;  2HHN A;  3K8U A;  2DCB A;  3OF8 A;  2H7J A;  1EF7 A;  3KFQ A;  1NLJ A;  2DCD A;  1U9Q X;  2FTD A;  4KLB A;  4CDF B;  3BPM A;  4DMY A;  4CZW A;  4PI3 A;  1THE A;  2DC7 A;  2WBF X;  2Y6E A;  2YJ9 A;  4ZUX U;  2AYN A;  2B1M A;  4PP2 E;  3OVZ A;  3AI8 A;  1GLO A;  5CVO B;  3K9M A;  2B1N A;  1CVZ A;  3HD3 A;  1NPZ A;  3LXS A;  3I3T A;  1AU0 A;  1AYW A;  3IEJ A;  4N4Z A;  1MDW A;  1PE6 A;  3PNR A;  1U9V A;  3IHP A;  1EWM A;  1QXP A;  2AUX A;  2E02 A;  3N4C A;  1GEC E;  4CDD B;  3LFY A;  3M99 A;  4PP1 A;  3S3Q A;  3KWB X;  1U9W A;  3IOQ A;  2XU1 A;  3CBJ A;  2DZY A;  1W6F A;  3KKU A;  1QOL A;  1Q6K A;  4P6E A;  4QBB A;  5FPW A;  4N79 A;  4X6I A;  2NQI A;  4MZO A;  5CVM A;  4CDC B;  1BY8 A;  4MSX A;  2YJ2 A;  1W4T A;  9PAP A;  3KSE A;  3HHA A;  4PAD A;  2OUL A;  4YVA A;  3P5X A;  1YT7 A;  6PAD A;  1F2C A;  2R9N A;  2VFB A;  3PW3 A;  3H8C A;  1TL9 A;  1STF E;  2R9M A;  1MS6 A;  3ZUA A;  4FIP A;  5EGW A;  1PPP A;  2O6X A;  1EWL A;  4YV8 A;  2BSZ A;  4QRV A;  2E00 A;  3S3R A;  2HXZ A;  4W5B A;  2FRA A;  4OEM A;  1AYU A;  3O0U A;  4B55 A;  2PAD A;  2FYE A;  1BQI A;  5A24 A;  1MIR A;  2HH5 A;  1YAL A;  1ICF A;  2GHU A;  1EWP A;  4YYR A;  1JQP A;  1AU4 A;  4MZS A;  1POP A;  3RVV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...