3WXFA

Crystal structure of cyld usp domain (c596s e674q) in complex with met1-linked diubiquitin
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
310
structure length
299
Chain Sequence
MGLEVMVGKKKGIQGHYNSSYLDSTLFCLFSFSSVLDTVLLRPRSKTDVEYYKETQELLRTEIVNPLRIHGYVCATKIMKLRRILEKVEAASGFTSEQKDPEEFLNILFHHILRVDPLLRLRSAGQKVQDCYFYQIFMDKVMVPTSQQLLEWSFINSDLKFAEAPSCLIIQMPRFGKDFKMFNKIFPSLELDITDLLDDQQMELFAVLCIETSHYVAFVKYGSADSAWLFFDSMADRDGGQNGFNIPQVSRCPEVGEYLKMTPEELHALDPKNIQGYARRLLCDAYMCMYQSPTMSLYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structures of CYLD USP with Met1- or Lys63-linked diubiquitin reveal mechanisms for dual specificity
doi rcsb
source organism Danio rerio
molecule tags Hydrolase/protein binding
molecule keywords Uncharacterized protein
total genus 93
structure length 299
sequence length 310
chains with identical sequence C
ec nomenclature
pdb deposition date 2014-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00443 UCH Ubiquitin carboxyl-terminal hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3wxfA00
4FK5A 2XU5A 4N8WA 2HD5A 5CVMA 3CH2X 1CQDA 2DCBA 1CSBB 2ATOA 3QT4A 3N3KA 4CDFB 3N3GA 5JH3A 1EWOA 3IMAA 1PPDA 1NPZA 2DZYA 4YYVA 1KXRA 1AU4A 2AS8A 1KHPA 3E1ZB 2CB5A 2FYEA 4QBBA 2G8JA 3USVA 2FRQA 3B79A 4DMYA 2YJBA 1PXVA 3H7DA 1AU2A 1GCBA 1STFE 4OEMA 2WBFX 3P5UA 1ZCMA 2FQ9A 1AIMA 1AYVA 1ITOA 3MORA 3H6SA 4CDCB 3QJ3A 1TU6A 3IOQA 4BSQA 2YJ8A 1Q6KA 3KSEA 3CH3X 2DCAA 2OULA 3F75A 1U5IA 1MDWA 2DJFB 2GFOA 3MHSA 1NLJA 2JQFR 1HUCB 3DF0A 3NHEA 3RVWA 3GCBA 3KWBX 4XR7A 3BC3A 1EWLA 1TL9A 3BPFA 1GMYA 1PBHA 1U9QX 2IPPB 4BPVA 4BS6A 2CIOA 2VHFA 1MHWA 2AUZA 3H8BA 1MS6A 4XUIA 1EWPA 3PDFA 1KHQA 4YYQA 4MSXA 2HH5A 1AYUA 1MEMA 1AYWA 1ATKA 3N4CA 4QRVA 3LXSA 1PADA 3PNRA 4X6JA 2HXZA 2XU4A 2G7YA 4X6IA 4PP2E 4OELA 2OZ2A 2ACTA 2P7UA 2XU3A 5F02A 2C0YA 1KFUL 3PBHA 3C9EA 3I06A 3M99A 1CPJA 2O6XA 3OVXA 1CVZA 4CDEB 1TLOA 2F7DA 1VJVA 2G8EA 1XKGA 5FPWA 2B1MA 4AXLA 2ARYA 1YT7A 3WXEA 4P6EA 3U8EA 8PCHA 2JQGR 3OVZA 4YYWA 1CS8A 5CVNB 1QOLA 1SP4B 4QRXA 1MEGA 2VHSA 1QXPA 2NQDB 2NQIA 1M6DA 2DCDA 1S4VA 1PIPA 2YJ2A 2AIMA 2P0RA 1ICFA 3D6SA 1X9YA 1CB5A 1PPNA 2DC9A 4FJCA 6PADA 2B1NA 1KFXL 3KFQA 1F2BA 2R9MA 4HWYA 4K7CA 3OF8A 3V6CA 3BPMA 1F29A 3S3RA 7PCKA 1THEA 3IHPA 3OF9A 4N4ZA 2G6DA 4I05A 4Q8GA 4I07A 4Q8HA 2PADA 5CHVA 2GHUA 1SNKA 3V6EA 4YYRA 3P5VA 1BGOA 3ERVA 1CTEA 1QDQA 2DCCA 2F1GA 2DC6A 3WXGA 3KX1A 2E03A 4W5BA 1BY8A 4I04A 2H7JA 2Y5BA 2NQAA 1NB5A 1EWMA 3HD3A 3RVVA 4KLBA 1DF0A 4P6GA 2YJ9A 3IEJA 3K8UA 4YV8A 1NQCA 3I3TA 1K3BB 1AECA 1BQIA 2R6NA 4DMXA 5A24A 2AYNA 1CV8A 3HHIA 2DC8A 2AVWA 3H8CA 5EF4A 3S3QA 4BQVA 1Y08A 4WA6A 3WXFA 1AU0A 2FRAA 4QRGA 4PADA 1F2CA 3CBKA 5JA7A 2Y6EA 2AU1A 3K24A 2DC7A 3F5VA 2IBIA 4PI3A 5PADA 2E00A 4ZUXU 2YJCA 3LFYA 4RY2A 1YVBA 4G54A 2NQGA 2P86A 1POPA 3O0UA 4BS5A 1FH0A 2AYOA 1F2AA 3TNXA 3MTNA 2XU1A 3PW3A 1GECE 1QMYA 3AI8A 3K9MA 2DZZA 2BDZA 4W4UA 1CJLA 1MIRA 1BP4A 2E01A 1EF7A 3RVXA 5CVOB 3P5XA 4N79A 1PPOA 3MHHA 3KKUA 1PPPA 2OP3A 3BOWA 4YVAA 1DEUA 2PNSA 1O0EA 4PP1A 2E02A 1ME3A 1JQPA 2FT2A 1PE6A 3ZUAA 4X6HA 4CZWA 2HHNA 3BCNA 1NB3A 1YK8A 3IUTA 2PREA 5K16A 2R9CA 4AXMA 1Y4HA 1NL6A 1ME4A 3OISA 2PBHA 5CHTA 2BDLA 1ZIVA 1YALA 4MZSA 4W5CA 5J94A 3KW9A 5EGWA 3QSDA 4QH6A 2FUDA 2R9FA 3H89A 4CDDB 1VSNA 3IV2A 1U9XA 2R9NA 4YYUA 1AU3A 1U9WA 4YYSA 9PAPA 2FTDA 3BWKA 2FO5A 1GLOA 3O1GA 1IWDA 3P5WA 1PCIA 2AUXA 1YK7A 4MZOA 1U9VA 2R9OA 4FIPA 3KWZA 3CBJA 3HHAA 3HWNA 1A6RA 2DJGB
chains in the Genus database with same CATH superfamily
4FK5A 4R3DA 2XU5A 4N8WA 2HD5A 5CVMA 3CH2X 1CQDA 2DCBA 1CSBB 2ATOA 3PRPA 4MI7A 3QT4A 3N3KA 4CDFB 3N3GA 5JH3A 1EWOA 3IMAA 3PHXA 1PPDA 1NPZA 2DZYA 4YYVA 1KXRA 1AU4A 2AS8A 1KHPA 3E1ZB 5E6JA 2CB5A 2FYEA 4QBBA 2G8JA 3USVA 2DJGB 4XZXA 2FRQA 3B79A 4DMYA 2YJBA 1PXVA 3H7DA 1AU2A 1GCBA 1STFE 4OEMA 2WBFX 3P5UA 1ZCMA 1PVJA 3PSEA 4A5UA 2FQ9A 1AIMA 1AYVA 3C0RA 3PRMA 1ITOA 3MORA 3H6SA 4CDCB 3QJ3A 1TU6A 3IOQA 4BSQA 2YJ8A 1Q6KA 3KSEA 3CH3X 2DCAA 2OULA 3F75A 1U5IA 1MDWA 2DJFB 4BOQA 2GFOA 3MHSA 4GUAA 1NLJA 2JQFR 1HUCB 4OVZB 3B21A 3DF0A 3NHEA 3RVWA 3GCBA 3KWBX 4XR7A 3BC3A 1EWLA 1TL9A 3BPFA 1GMYA 1PBHA 1U9QX 2IPPB 4BPVA 4BS6A 2CIOA 2VHFA 1MHWA 2AUZA 3H8BA 1MS6A 4XUIA 1EWPA 3PDFA 1KHQA 4YYQA 4MSXA 2HH5A 1AYUA 1MEMA 4RF0A 1AYWA 1ATKA 3N4CA 4QRVA 3LXSA 1PADA 3PNRA 4D8BA 3MJ5A 4X6JA 2HXZA 2XU4A 2G7YA 4X6IA 4PP2E 4OELA 2J7QC 2OZ2A 2ACTA 5EZQA 3O65A 2P7UA 2XU3A 5F02A 2C0YA 1KFUL 3PBHA 3C9EA 3I06A 3M99A 1CPJA 2O6XA 1UKFA 3OVXA 1CVZA 4CDEB 1TLOA 2F7DA 1VJVA 2G8EA 1YZBA 1XKGA 5FPWA 2B1MA 4AXLA 2ARYA 1YT7A 3WXEA 4P6EA 3U8EA 8PCHA 2JQGR 1DKIA 3PHWA 3OVZA 4YYWA 1CS8A 5CVNB 3MTVA 1QOLA 1SP4B 4BOPA 4QRXA 1MEGA 2AGAA 2VHSA 4OW0A 1QXPA 2NQDB 2NQIA 1M6DA 3TRKA 2DCDA 1S4VA 1PIPA 2YJ2A 2AIMA 2P0RA 2Z84A 1ICFA 3D6SA 4PT5A 1X9YA 1CB5A 1PPNA 4IUMA 2DC9A 4FJCA 6PADA 2B1NA 4ZTBA 1KFXL 3BBAA 3KFQA 1F2BA 2R9MA 4HWYA 4K7CA 3OF8A 3V6CA 3BPMA 1F29A 3S3RA 7PCKA 4M0WA 1THEA 3PT2A 3IHPA 3OF9A 4N4ZA 2G6DA 2BTWB 4I05A 4Q8GA 4I07A 2DOSA 4Q8HA 2PADA 5CHVA 2GHUA 1SNKA 3V6EA 4YYRA 2J7QA 3P5VA 1BGOA 4MM3B 3ERVA 1CTEA 1QDQA 2DCCA 2F1GA 2DC6A 3WXGA 3KX1A 2E03A 4BOSA 4W5BA 1BY8A 4I04A 2H7JA 2Y5BA 5JZEA 2NQAA 1NB5A 1EWMA 2HWKA 3TMPA 3HD3A 3RVVA 4KLBA 1DF0A 4P6GA 2YJ9A 3RNVA 3IEJA 3K8UA 4YV8A 1NQCA 3I3TA 1K3BB 1AECA 1BQIA 2R6NA 4DMXA 5A24A 2AYNA 5KO3A 4D8EA 4P16A 1CV8A 3HHIA 2DC8A 4RKXA 2AVWA 3PHUA 3ZNHA 3H8CA 3W30A 5EF4A 3S3QA 4BQVA 1Y08A 4WA6A 3WXFA 1AU0A 2FRAA 4QRGA 4PADA 1F2CA 3CBKA 5JA7A 2Y6EA 4IP3A 4WURA 2AU1A 2UZJA 3K24A 2DC7A 3F5VA 2IBIA 4PI3A 3W31A 5PADA 2E00A 4ZUXU 4D8IA 2YJCA 3LFYA 4RY2A 1YVBA 2JTCA 4G54A 2NQGA 2P86A 1POPA 3O0UA 4BS5A 1FH0A 2AYOA 1F2AA 3TNXA 3MTNA 4RF1A 2XU1A 3PW3A 1GECE 1QMYA 3AI8A 3E9SA 4BOZA 3K9MA 2DZZA 2BDZA 3OQCA 4W4UA 1CJLA 1MIRA 1BP4A 2E01A 1EF7A 3RVXA 5CVOB 3P5XA 4N79A 1PPOA 3BY4A 3MHHA 3KKUA 1PPPA 2OP3A 3BOWA 4YVAA 1DEUA 2PNSA 1O0EA 4PP1A 3IFUA 2E02A 1ME3A 4BOUA 1JQPA 2FT2A 1PE6A 3ZUAA 4X6HA 4CZWA 2HHNA 3BCNA 2BU3A 4OVZA 2BTWA 1NB3A 1YK8A 4RNAA 3IUTA 2PREA 5K16A 2R9CA 4AXMA 2FE8A 1Y4HA 1NL6A 1ME4A 3OISA 2PBHA 5CHTA 2BDLA 1ZIVA 1YALA 4MZSA 4W5CA 5J94A 3KW9A 5EGWA 3QSDA 4QH6A 2FUDA 2R9FA 3H89A 4CDDB 4HXDB 1VSNA 3IV2A 1U9XA 2R9NA 4YYUA 1AU3A 1U9WA 4YYSA 9PAPA 2FTDA 3BWKA 2FO5A 1GLOA 3O1GA 1IWDA 3P5WA 1PCIA 2AUXA 4REZA 1YK7A 4MZOA 1U9VA 2R9OA 4FIPA 3BB7A 3MP2A 5EZSA 3KWZA 3CBJA 3HHAA 3HWNA 1A6RA 2JRIA
chains in the Genus database with same CATH topology
4FK5A 2XU5A 4N8WA 2HD5A 5CVMA 3CH2X 1CQDA 2DCBA 1CSBB 2ATOA 3QT4A 3N3KA 4CDFB 3N3GA 5JH3A 1EWOA 3IMAA 1PPDA 1NPZA 2DZYA 4YYVA 1KXRA 1AU4A 2AS8A 1KHPA 3E1ZB 2CB5A 2FYEA 4QBBA 2G8JA 3USVA 2FRQA 3B79A 4DMYA 2YJBA 1PXVA 3H7DA 1AU2A 1GX3A 1GCBA 1STFE 4OEMA 2WBFX 3P5UA 1ZCMA 4C5PA 2FQ9A 1AIMA 1AYVA 4GUZA 1ITOA 3MORA 3H6SA 4CDCB 3QJ3A 1TU6A 3IOQA 4BSQA 2YJ8A 1Q6KA 3KSEA 3CH3X 2DCAA 2OULA 3F75A 1U5IA 1MDWA 2DJFB 2GFOA 3MHSA 1NLJA 2JQFR 4BGFA 1HUCB 3DF0A 3NHEA 3RVWA 3GCBA 2VFBA 4B55A 3KWBX 4XR7A 3BC3A 1EWLA 1TL9A 3BPFA 1GMYA 1PBHA 1U9QX 2IPPB 4BPVA 4BS6A 2CIOA 2VHFA 1MHWA 2AUZA 3H8BA 1MS6A 4XUIA 1EWPA 3PDFA 1KHQA 4YYQA 4MSXA 2HH5A 1AYUA 1MEMA 1AYWA 1ATKA 3N4CA 4QRVA 3LXSA 1PADA 3PNRA 4X6JA 2HXZA 2XU4A 2G7YA 4X6IA 4PP2E 4OELA 2OZ2A 3LTWA 2ACTA 2P7UA 2XU3A 5F02A 2C0YA 1KFUL 3PBHA 3C9EA 3I06A 3M99A 1CPJA 2O6XA 3OVXA 1CVZA 4CDEB 1TLOA 2F7DA 1VJVA 2G8EA 1E2TA 1XKGA 5FPWA 2B1MA 4AXLA 2ARYA 1YT7A 3WXEA 4P6EA 3U8EA 8PCHA 2JQGR 3OVZA 4YYWA 1CS8A 5CVNB 1QOLA 1W6FA 1SP4B 4QRXA 1MEGA 2VHSA 1QXPA 2NQDB 2NQIA 1M6DA 2DCDA 1S4VA 1PIPA 2YJ2A 2AIMA 2P0RA 2VFCA 1ICFA 3D6SA 1X9YA 1CB5A 1PPNA 2DC9A 4FJCA 6PADA 2B1NA 1KFXL 3KFQA 1F2BA 2R9MA 4HWYA 4K7CA 3OF8A 3V6CA 3BPMA 1F29A 3S3RA 7PCKA 1THEA 3IHPA 3OF9A 4N4ZA 2G6DA 4I05A 4Q8GA 4I07A 4Q8HA 2PADA 5CHVA 2GHUA 1SNKA 3V6EA 4YYRA 3P5VA 1BGOA 3ERVA 1CTEA 1QDQA 2DCCA 2F1GA 2DC6A 3WXGA 3KX1A 2E03A 4W5BA 1BY8A 4I04A 2H7JA 2Y5BA 2NQAA 1NB5A 1EWMA 3HD3A 3RVVA 4KLBA 1DF0A 4P6GA 2YJ9A 3IEJA 3K8UA 4YV8A 1NQCA 3I3TA 1K3BB 1AECA 1W4TA 1BQIA 2R6NA 4DMXA 5A24A 2AYNA 1CV8A 3HHIA 2DC8A 4NV7A 2AVWA 3H8CA 5EF4A 3S3QA 4BQVA 1Y08A 4WA6A 3WXFA 1AU0A 2FRAA 4QRGA 4PADA 1F2CA 3CBKA 5JA7A 2Y6EA 2AU1A 3K24A 2DC7A 3F5VA 2IBIA 4PI3A 5PADA 2E00A 4ZUXU 2YJCA 3LFYA 4RY2A 1YVBA 4G54A 2NQGA 2P86A 1POPA 3O0UA 4BS5A 1FH0A 2AYOA 1F2AA 3TNXA 3MTNA 2XU1A 3PW3A 1GECE 1QMYA 3AI8A 3K9MA 2DZZA 2BDZA 4W4UA 1CJLA 1MIRA 1BP4A 2E01A 1EF7A 3RVXA 5CVOB 3P5XA 4N79A 1PPOA 3MHHA 3KKUA 1PPPA 2OP3A 3BOWA 4YVAA 1DEUA 2PNSA 1O0EA 4PP1A 1W5RA 2E02A 1ME3A 1JQPA 2FT2A 1PE6A 3ZUAA 4X6HA 4CZWA 2HHNA 3BCNA 1NB3A 1YK8A 3IUTA 2PREA 4NV8A 5K16A 2R9CA 4AXMA 1Y4HA 1NL6A 1ME4A 3D9WA 3OISA 2PBHA 5CHTA 2BDLA 1ZIVA 1YALA 4MZSA 4W5CA 5J94A 3KW9A 5EGWA 3QSDA 4QH6A 2FUDA 2R9FA 3H89A 4CDDB 1VSNA 3IV2A 1U9XA 2R9NA 4YYUA 1AU3A 1U9WA 4YYSA 9PAPA 2FTDA 3BWKA 2FO5A 1GLOA 3O1GA 1IWDA 3P5WA 1PCIA 2AUXA 1YK7A 4MZOA 1U9VA 2R9OA 4FIPA 2BSZA 3KWZA 3CBJA 3HHAA 3HWNA 1A6RA 2DJGB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FK5 A;  2XU5 A;  4N8W A;  2HD5 A;  5CVM A;  3CH2 X;  1CQD A;  2DCB A;  1CSB B;  2ATO A;  3QT4 A;  3N3K A;  4CDF B;  3N3G A;  5JH3 A;  1EWO A;  3IMA A;  1PPD A;  1NPZ A;  2DZY A;  4YYV A;  1KXR A;  1AU4 A;  2AS8 A;  1KHP A;  3E1Z B;  2CB5 A;  2FYE A;  4QBB A;  2G8J A;  3USV A;  2FRQ A;  3B79 A;  4DMY A;  2YJB A;  1PXV A;  3H7D A;  1AU2 A;  1GCB A;  1STF E;  4OEM A;  2WBF X;  3P5U A;  1ZCM A;  2FQ9 A;  1AIM A;  1AYV A;  1ITO A;  3MOR A;  3H6S A;  4CDC B;  3QJ3 A;  1TU6 A;  3IOQ A;  4BSQ A;  2YJ8 A;  1Q6K A;  3KSE A;  3CH3 X;  2DCA A;  2OUL A;  3F75 A;  1U5I A;  1MDW A;  2DJF B;  2GFO A;  3MHS A;  1NLJ A;  2JQF R;  1HUC B;  3DF0 A;  3NHE A;  3RVW A;  3GCB A;  3KWB X;  4XR7 A;  3BC3 A;  1EWL A;  1TL9 A;  3BPF A;  1GMY A;  1PBH A;  1U9Q X;  2IPP B;  4BPV A;  4BS6 A;  2CIO A;  2VHF A;  1MHW A;  2AUZ A;  3H8B A;  1MS6 A;  4XUI A;  1EWP A;  3PDF A;  1KHQ A;  4YYQ A;  4MSX A;  2HH5 A;  1AYU A;  1MEM A;  1AYW A;  1ATK A;  3N4C A;  4QRV A;  3LXS A;  1PAD A;  3PNR A;  4X6J A;  2HXZ A;  2XU4 A;  2G7Y A;  4X6I A;  4PP2 E;  4OEL A;  2OZ2 A;  2ACT A;  2P7U A;  2XU3 A;  5F02 A;  2C0Y A;  1KFU L;  3PBH A;  3C9E A;  3I06 A;  3M99 A;  1CPJ A;  2O6X A;  3OVX A;  1CVZ A;  4CDE B;  1TLO A;  2F7D A;  1VJV A;  2G8E A;  1XKG A;  5FPW A;  2B1M A;  4AXL A;  2ARY A;  1YT7 A;  3WXE A;  4P6E A;  3U8E A;  8PCH A;  2JQG R;  3OVZ A;  4YYW A;  1CS8 A;  5CVN B;  1QOL A;  1SP4 B;  4QRX A;  1MEG A;  2VHS A;  1QXP A;  2NQD B;  2NQI A;  1M6D A;  2DCD A;  1S4V A;  1PIP A;  2YJ2 A;  2AIM A;  2P0R A;  1ICF A;  3D6S A;  1X9Y A;  1CB5 A;  1PPN A;  2DC9 A;  4FJC A;  6PAD A;  2B1N A;  1KFX L;  3KFQ A;  1F2B A;  2R9M A;  4HWY A;  4K7C A;  3OF8 A;  3V6C A;  3BPM A;  1F29 A;  3S3R A;  7PCK A;  1THE A;  3IHP A;  3OF9 A;  4N4Z A;  2G6D A;  4I05 A;  4Q8G A;  4I07 A;  4Q8H A;  2PAD A;  5CHV A;  2GHU A;  1SNK A;  3V6E A;  4YYR A;  3P5V A;  1BGO A;  3ERV A;  1CTE A;  1QDQ A;  2DCC A;  2F1G A;  2DC6 A;  3WXG A;  3KX1 A;  2E03 A;  4W5B A;  1BY8 A;  4I04 A;  2H7J A;  2Y5B A;  2NQA A;  1NB5 A;  1EWM A;  3HD3 A;  3RVV A;  4KLB A;  1DF0 A;  4P6G A;  2YJ9 A;  3IEJ A;  3K8U A;  4YV8 A;  1NQC A;  3I3T A;  1K3B B;  1AEC A;  1BQI A;  2R6N A;  4DMX A;  5A24 A;  2AYN A;  1CV8 A;  3HHI A;  2DC8 A;  2AVW A;  3H8C A;  5EF4 A;  3S3Q A;  4BQV A;  1Y08 A;  4WA6 A;  3WXF A;  1AU0 A;  2FRA A;  4QRG A;  4PAD A;  1F2C A;  3CBK A;  5JA7 A;  2Y6E A;  2AU1 A;  3K24 A;  2DC7 A;  3F5V A;  2IBI A;  4PI3 A;  5PAD A;  2E00 A;  4ZUX U;  2YJC A;  3LFY A;  4RY2 A;  1YVB A;  4G54 A;  2NQG A;  2P86 A;  1POP A;  3O0U A;  4BS5 A;  1FH0 A;  2AYO A;  1F2A A;  3TNX A;  3MTN A;  2XU1 A;  3PW3 A;  1GEC E;  1QMY A;  3AI8 A;  3K9M A;  2DZZ A;  2BDZ A;  4W4U A;  1CJL A;  1MIR A;  1BP4 A;  2E01 A;  1EF7 A;  3RVX A;  5CVO B;  3P5X A;  4N79 A;  1PPO A;  3MHH A;  3KKU A;  1PPP A;  2OP3 A;  3BOW A;  4YVA A;  1DEU A;  2PNS A;  1O0E A;  4PP1 A;  2E02 A;  1ME3 A;  1JQP A;  2FT2 A;  1PE6 A;  3ZUA A;  4X6H A;  4CZW A;  2HHN A;  3BCN A;  1NB3 A;  1YK8 A;  3IUT A;  2PRE A;  5K16 A;  2R9C A;  4AXM A;  1Y4H A;  1NL6 A;  1ME4 A;  3OIS A;  2PBH A;  5CHT A;  2BDL A;  1ZIV A;  1YAL A;  4MZS A;  4W5C A;  5J94 A;  3KW9 A;  5EGW A;  3QSD A;  4QH6 A;  2FUD A;  2R9F A;  3H89 A;  4CDD B;  1VSN A;  3IV2 A;  1U9X A;  2R9N A;  4YYU A;  1AU3 A;  1U9W A;  4YYS A;  9PAP A;  2FTD A;  3BWK A;  2FO5 A;  1GLO A;  3O1G A;  1IWD A;  3P5W A;  1PCI A;  2AUX A;  1YK7 A;  4MZO A;  1U9V A;  2R9O A;  4FIP A;  3KWZ A;  3CBJ A;  3HHA A;  3HWN A;  1A6R A;  2DJG B; 
#chains in the Genus database with same CATH topology
 4FK5 A;  4R3D A;  2XU5 A;  4N8W A;  2HD5 A;  5CVM A;  3CH2 X;  1CQD A;  2DCB A;  1CSB B;  2ATO A;  3PRP A;  4MI7 A;  3QT4 A;  3N3K A;  4CDF B;  3N3G A;  5JH3 A;  1EWO A;  3IMA A;  3PHX A;  1PPD A;  1NPZ A;  2DZY A;  4YYV A;  1KXR A;  1AU4 A;  2AS8 A;  1KHP A;  3E1Z B;  5E6J A;  2CB5 A;  2FYE A;  4QBB A;  2G8J A;  3USV A;  2DJG B;  4XZX A;  2FRQ A;  3B79 A;  4DMY A;  2YJB A;  1PXV A;  3H7D A;  1AU2 A;  1GCB A;  1STF E;  4OEM A;  2WBF X;  3P5U A;  1ZCM A;  1PVJ A;  3PSE A;  4A5U A;  2FQ9 A;  1AIM A;  1AYV A;  3C0R A;  3PRM A;  1ITO A;  3MOR A;  3H6S A;  4CDC B;  3QJ3 A;  1TU6 A;  3IOQ A;  4BSQ A;  2YJ8 A;  1Q6K A;  3KSE A;  3CH3 X;  2DCA A;  2OUL A;  3F75 A;  1U5I A;  1MDW A;  2DJF B;  4BOQ A;  2GFO A;  3MHS A;  4GUA A;  1NLJ A;  2JQF R;  1HUC B;  4OVZ B;  3B21 A;  3DF0 A;  3NHE A;  3RVW A;  3GCB A;  3KWB X;  4XR7 A;  3BC3 A;  1EWL A;  1TL9 A;  3BPF A;  1GMY A;  1PBH A;  1U9Q X;  2IPP B;  4BPV A;  4BS6 A;  2CIO A;  2VHF A;  1MHW A;  2AUZ A;  3H8B A;  1MS6 A;  4XUI A;  1EWP A;  3PDF A;  1KHQ A;  4YYQ A;  4MSX A;  2HH5 A;  1AYU A;  1MEM A;  4RF0 A;  1AYW A;  1ATK A;  3N4C A;  4QRV A;  3LXS A;  1PAD A;  3PNR A;  4D8B A;  3MJ5 A;  4X6J A;  2HXZ A;  2XU4 A;  2G7Y A;  4X6I A;  4PP2 E;  4OEL A;  2J7Q C;  2OZ2 A;  2ACT A;  5EZQ A;  3O65 A;  2P7U A;  2XU3 A;  5F02 A;  2C0Y A;  1KFU L;  3PBH A;  3C9E A;  3I06 A;  3M99 A;  1CPJ A;  2O6X A;  1UKF A;  3OVX A;  1CVZ A;  4CDE B;  1TLO A;  2F7D A;  1VJV A;  2G8E A;  1YZB A;  1XKG A;  5FPW A;  2B1M A;  4AXL A;  2ARY A;  1YT7 A;  3WXE A;  4P6E A;  3U8E A;  8PCH A;  2JQG R;  1DKI A;  3PHW A;  3OVZ A;  4YYW A;  1CS8 A;  5CVN B;  3MTV A;  1QOL A;  1SP4 B;  4BOP A;  4QRX A;  1MEG A;  2AGA A;  2VHS A;  4OW0 A;  1QXP A;  2NQD B;  2NQI A;  1M6D A;  3TRK A;  2DCD A;  1S4V A;  1PIP A;  2YJ2 A;  2AIM A;  2P0R A;  2Z84 A;  1ICF A;  3D6S A;  4PT5 A;  1X9Y A;  1CB5 A;  1PPN A;  4IUM A;  2DC9 A;  4FJC A;  6PAD A;  2B1N A;  4ZTB A;  1KFX L;  3BBA A;  3KFQ A;  1F2B A;  2R9M A;  4HWY A;  4K7C A;  3OF8 A;  3V6C A;  3BPM A;  1F29 A;  3S3R A;  7PCK A;  4M0W A;  1THE A;  3PT2 A;  3IHP A;  3OF9 A;  4N4Z A;  2G6D A;  2BTW B;  4I05 A;  4Q8G A;  4I07 A;  2DOS A;  4Q8H A;  2PAD A;  5CHV A;  2GHU A;  1SNK A;  3V6E A;  4YYR A;  2J7Q A;  3P5V A;  1BGO A;  4MM3 B;  3ERV A;  1CTE A;  1QDQ A;  2DCC A;  2F1G A;  2DC6 A;  3WXG A;  3KX1 A;  2E03 A;  4BOS A;  4W5B A;  1BY8 A;  4I04 A;  2H7J A;  2Y5B A;  5JZE A;  2NQA A;  1NB5 A;  1EWM A;  2HWK A;  3TMP A;  3HD3 A;  3RVV A;  4KLB A;  1DF0 A;  4P6G A;  2YJ9 A;  3RNV A;  3IEJ A;  3K8U A;  4YV8 A;  1NQC A;  3I3T A;  1K3B B;  1AEC A;  1BQI A;  2R6N A;  4DMX A;  5A24 A;  2AYN A;  5KO3 A;  4D8E A;  4P16 A;  1CV8 A;  3HHI A;  2DC8 A;  4RKX A;  2AVW A;  3PHU A;  3ZNH A;  3H8C A;  3W30 A;  5EF4 A;  3S3Q A;  4BQV A;  1Y08 A;  4WA6 A;  3WXF A;  1AU0 A;  2FRA A;  4QRG A;  4PAD A;  1F2C A;  3CBK A;  5JA7 A;  2Y6E A;  4IP3 A;  4WUR A;  2AU1 A;  2UZJ A;  3K24 A;  2DC7 A;  3F5V A;  2IBI A;  4PI3 A;  3W31 A;  5PAD A;  2E00 A;  4ZUX U;  4D8I A;  2YJC A;  3LFY A;  4RY2 A;  1YVB A;  2JTC A;  4G54 A;  2NQG A;  2P86 A;  1POP A;  3O0U A;  4BS5 A;  1FH0 A;  2AYO A;  1F2A A;  3TNX A;  3MTN A;  4RF1 A;  2XU1 A;  3PW3 A;  1GEC E;  1QMY A;  3AI8 A;  3E9S A;  4BOZ A;  3K9M A;  2DZZ A;  2BDZ A;  3OQC A;  4W4U A;  1CJL A;  1MIR A;  1BP4 A;  2E01 A;  1EF7 A;  3RVX A;  5CVO B;  3P5X A;  4N79 A;  1PPO A;  3BY4 A;  3MHH A;  3KKU A;  1PPP A;  2OP3 A;  3BOW A;  4YVA A;  1DEU A;  2PNS A;  1O0E A;  4PP1 A;  3IFU A;  2E02 A;  1ME3 A;  4BOU A;  1JQP A;  2FT2 A;  1PE6 A;  3ZUA A;  4X6H A;  4CZW A;  2HHN A;  3BCN A;  2BU3 A;  4OVZ A;  2BTW A;  1NB3 A;  1YK8 A;  4RNA A;  3IUT A;  2PRE A;  5K16 A;  2R9C A;  4AXM A;  2FE8 A;  1Y4H A;  1NL6 A;  1ME4 A;  3OIS A;  2PBH A;  5CHT A;  2BDL A;  1ZIV A;  1YAL A;  4MZS A;  4W5C A;  5J94 A;  3KW9 A;  5EGW A;  3QSD A;  4QH6 A;  2FUD A;  2R9F A;  3H89 A;  4CDD B;  4HXD B;  1VSN A;  3IV2 A;  1U9X A;  2R9N A;  4YYU A;  1AU3 A;  1U9W A;  4YYS A;  9PAP A;  2FTD A;  3BWK A;  2FO5 A;  1GLO A;  3O1G A;  1IWD A;  3P5W A;  1PCI A;  2AUX A;  4REZ A;  1YK7 A;  4MZO A;  1U9V A;  2R9O A;  4FIP A;  3BB7 A;  3MP2 A;  5EZS A;  3KWZ A;  3CBJ A;  3HHA A;  3HWN A;  1A6R A;  2JRI A; 
#chains in the Genus database with same CATH homology
 4FK5 A;  2XU5 A;  4N8W A;  2HD5 A;  5CVM A;  3CH2 X;  1CQD A;  2DCB A;  1CSB B;  2ATO A;  3QT4 A;  3N3K A;  4CDF B;  3N3G A;  5JH3 A;  1EWO A;  3IMA A;  1PPD A;  1NPZ A;  2DZY A;  4YYV A;  1KXR A;  1AU4 A;  2AS8 A;  1KHP A;  3E1Z B;  2CB5 A;  2FYE A;  4QBB A;  2G8J A;  3USV A;  2FRQ A;  3B79 A;  4DMY A;  2YJB A;  1PXV A;  3H7D A;  1AU2 A;  1GX3 A;  1GCB A;  1STF E;  4OEM A;  2WBF X;  3P5U A;  1ZCM A;  4C5P A;  2FQ9 A;  1AIM A;  1AYV A;  4GUZ A;  1ITO A;  3MOR A;  3H6S A;  4CDC B;  3QJ3 A;  1TU6 A;  3IOQ A;  4BSQ A;  2YJ8 A;  1Q6K A;  3KSE A;  3CH3 X;  2DCA A;  2OUL A;  3F75 A;  1U5I A;  1MDW A;  2DJF B;  2GFO A;  3MHS A;  1NLJ A;  2JQF R;  4BGF A;  1HUC B;  3DF0 A;  3NHE A;  3RVW A;  3GCB A;  2VFB A;  4B55 A;  3KWB X;  4XR7 A;  3BC3 A;  1EWL A;  1TL9 A;  3BPF A;  1GMY A;  1PBH A;  1U9Q X;  2IPP B;  4BPV A;  4BS6 A;  2CIO A;  2VHF A;  1MHW A;  2AUZ A;  3H8B A;  1MS6 A;  4XUI A;  1EWP A;  3PDF A;  1KHQ A;  4YYQ A;  4MSX A;  2HH5 A;  1AYU A;  1MEM A;  1AYW A;  1ATK A;  3N4C A;  4QRV A;  3LXS A;  1PAD A;  3PNR A;  4X6J A;  2HXZ A;  2XU4 A;  2G7Y A;  4X6I A;  4PP2 E;  4OEL A;  2OZ2 A;  3LTW A;  2ACT A;  2P7U A;  2XU3 A;  5F02 A;  2C0Y A;  1KFU L;  3PBH A;  3C9E A;  3I06 A;  3M99 A;  1CPJ A;  2O6X A;  3OVX A;  1CVZ A;  4CDE B;  1TLO A;  2F7D A;  1VJV A;  2G8E A;  1E2T A;  1XKG A;  5FPW A;  2B1M A;  4AXL A;  2ARY A;  1YT7 A;  3WXE A;  4P6E A;  3U8E A;  8PCH A;  2JQG R;  3OVZ A;  4YYW A;  1CS8 A;  5CVN B;  1QOL A;  1W6F A;  1SP4 B;  4QRX A;  1MEG A;  2VHS A;  1QXP A;  2NQD B;  2NQI A;  1M6D A;  2DCD A;  1S4V A;  1PIP A;  2YJ2 A;  2AIM A;  2P0R A;  2VFC A;  1ICF A;  3D6S A;  1X9Y A;  1CB5 A;  1PPN A;  2DC9 A;  4FJC A;  6PAD A;  2B1N A;  1KFX L;  3KFQ A;  1F2B A;  2R9M A;  4HWY A;  4K7C A;  3OF8 A;  3V6C A;  3BPM A;  1F29 A;  3S3R A;  7PCK A;  1THE A;  3IHP A;  3OF9 A;  4N4Z A;  2G6D A;  4I05 A;  4Q8G A;  4I07 A;  4Q8H A;  2PAD A;  5CHV A;  2GHU A;  1SNK A;  3V6E A;  4YYR A;  3P5V A;  1BGO A;  3ERV A;  1CTE A;  1QDQ A;  2DCC A;  2F1G A;  2DC6 A;  3WXG A;  3KX1 A;  2E03 A;  4W5B A;  1BY8 A;  4I04 A;  2H7J A;  2Y5B A;  2NQA A;  1NB5 A;  1EWM A;  3HD3 A;  3RVV A;  4KLB A;  1DF0 A;  4P6G A;  2YJ9 A;  3IEJ A;  3K8U A;  4YV8 A;  1NQC A;  3I3T A;  1K3B B;  1AEC A;  1W4T A;  1BQI A;  2R6N A;  4DMX A;  5A24 A;  2AYN A;  1CV8 A;  3HHI A;  2DC8 A;  4NV7 A;  2AVW A;  3H8C A;  5EF4 A;  3S3Q A;  4BQV A;  1Y08 A;  4WA6 A;  3WXF A;  1AU0 A;  2FRA A;  4QRG A;  4PAD A;  1F2C A;  3CBK A;  5JA7 A;  2Y6E A;  2AU1 A;  3K24 A;  2DC7 A;  3F5V A;  2IBI A;  4PI3 A;  5PAD A;  2E00 A;  4ZUX U;  2YJC A;  3LFY A;  4RY2 A;  1YVB A;  4G54 A;  2NQG A;  2P86 A;  1POP A;  3O0U A;  4BS5 A;  1FH0 A;  2AYO A;  1F2A A;  3TNX A;  3MTN A;  2XU1 A;  3PW3 A;  1GEC E;  1QMY A;  3AI8 A;  3K9M A;  2DZZ A;  2BDZ A;  4W4U A;  1CJL A;  1MIR A;  1BP4 A;  2E01 A;  1EF7 A;  3RVX A;  5CVO B;  3P5X A;  4N79 A;  1PPO A;  3MHH A;  3KKU A;  1PPP A;  2OP3 A;  3BOW A;  4YVA A;  1DEU A;  2PNS A;  1O0E A;  4PP1 A;  1W5R A;  2E02 A;  1ME3 A;  1JQP A;  2FT2 A;  1PE6 A;  3ZUA A;  4X6H A;  4CZW A;  2HHN A;  3BCN A;  1NB3 A;  1YK8 A;  3IUT A;  2PRE A;  4NV8 A;  5K16 A;  2R9C A;  4AXM A;  1Y4H A;  1NL6 A;  1ME4 A;  3D9W A;  3OIS A;  2PBH A;  5CHT A;  2BDL A;  1ZIV A;  1YAL A;  4MZS A;  4W5C A;  5J94 A;  3KW9 A;  5EGW A;  3QSD A;  4QH6 A;  2FUD A;  2R9F A;  3H89 A;  4CDD B;  1VSN A;  3IV2 A;  1U9X A;  2R9N A;  4YYU A;  1AU3 A;  1U9W A;  4YYS A;  9PAP A;  2FTD A;  3BWK A;  2FO5 A;  1GLO A;  3O1G A;  1IWD A;  3P5W A;  1PCI A;  2AUX A;  1YK7 A;  4MZO A;  1U9V A;  2R9O A;  4FIP A;  2BSZ A;  3KWZ A;  3CBJ A;  3HHA A;  3HWN A;  1A6R A;  2DJG B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...