3WXFA

Crystal structure of cyld usp domain (c596s e674q) in complex with met1-linked diubiquitin
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
310
structure length
299
Chain Sequence
MGLEVMVGKKKGIQGHYNSSYLDSTLFCLFSFSSVLDTVLLRPRSKTDVEYYKETQELLRTEIVNPLRIHGYVCATKIMKLRRILEKVEAASGFTSEQKDPEEFLNILFHHILRVDPLLRLRSAGQKVQDCYFYQIFMDKVMVPTSQQLLEWSFINSDLKFAEAPSCLIIQMPRFGKDFKMFNKIFPSLELDITDLLDDQQMELFAVLCIETSHYVAFVKYGSADSAWLFFDSMADRDGGQNGFNIPQVSRCPEVGEYLKMTPEELHALDPKNIQGYARRLLCDAYMCMYQSPTMSLYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structures of CYLD USP with Met1- or Lys63-linked diubiquitin reveal mechanisms for dual specificity
doi rcsb
source organism Danio rerio
molecule tags Hydrolase/protein binding
molecule keywords Uncharacterized protein
total genus 93
structure length 299
sequence length 310
chains with identical sequence C
ec nomenclature
pdb deposition date 2014-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00443 UCH Ubiquitin carboxyl-terminal hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3wxfA00
3GCBA 4QBBA 1PBHA 1QMYA 1YVBA 5FPWA 1NL6A 3PW3A 1POPA 2B1NA 2R9FA 3BWKA 2DCCA 4YYWA 1MS6A 2G8JA 1SNKA 1U9VA 2PBHA 1K3BB 1EWLA 3CBJA 2R9CA 1F2AA 3KW9A 4PI3A 3RVWA 2AS8A 1AECA 4QRXA 4PADA 3IV2A 2IBIA 3IHPA 3U8EA 4ZUXU 2YJ8A 4HWYA 4PP2E 1PCIA 3MTNA 3V6CA 2R9MA 4QRGA 1FH0A 2OP3A 1KXRA 2R9OA 3TNXA 2DC7A 4W5BA 3C9EA 4I04A 3M99A 1CV8A 3P5VA 5A24A 2CB5A 4CDEB 3IMAA 3QJ3A 3H6SA 1AYVA 1YT7A 4BQVA 4N4ZA 3WXGA 2JQGR 2AVWA 2HH5A 2E02A 4YV8A 2OULA 1DEUA 1QOLA 2FUDA 1CS8A 1KHPA 1EWPA 3B79A 2YJBA 2P86A 3HHAA 4CDCB 2R6NA 4YVAA 3IEJA 4FK5A 4OEMA 2G8EA 1Y08A 1PXVA 3I06A 1ITOA 2HXZA 1GECE 4YYRA 1M6DA 4RY2A 1SP4B 2G7YA 2DCAA 1KFXL 3OF9A 3WXEA 3BC3A 3PBHA 4CDDB 2H7JA 4W4UA 2OZ2A 2JQFR 4QRVA 1HUCB 3NHEA 9PAPA 2E00A 2VHSA 1GMYA 3LFYA 2P0RA 2AYOA 4BS6A 3BPFA 1PPDA 3IUTA 2XU5A 1F2BA 3H8CA 3O0UA 4CZWA 2AUZA 3I3TA 2PREA 1PADA 3OVXA 1JQPA 1AU0A 6PADA 1CSBB 1ICFA 4WA6A 3WXFA 1A6RA 2NQAA 2C0YA 2GFOA 2ACTA 2FRAA 1DF0A 4Q8GA 1BY8A 2DCDA 2YJ2A 5K16A 1YK8A 1MEMA 2Y5BA 2NQGA 3KSEA 4BSQA 1AU2A 4I07A 3ZUAA 4K7CA 4BS5A 3D6SA 2AIMA 2FRQA 4X6HA 1PPNA 4N8WA 1PPOA 5JH3A 5CVOB 4YYSA 1ME3A 1ATKA 1TLOA 4Q8HA 2DC8A 3V6EA 4DMXA 2GHUA 1KFUL 1BP4A 2XU1A 2E03A 1AYWA 3MHSA 2DZYA 1MEGA 1U5IA 1O0EA 3P5XA 2Y6EA 4FIPA 1AIMA 3BCNA 2YJ9A 1GLOA 3CBKA 3N3KA 3H7DA 2F7DA 4X6JA 1YALA 1EWOA 2DCBA 2CIOA 3P5UA 1CVZA 3F75A 2HHNA 2VHFA 2NQIA 1Y4HA 2ATOA 3N4CA 4YYQA 2PNSA 4G54A 3S3RA 3USVA 2FTDA 3HWNA 4W5CA 1Q6KA 4MSXA 3LXSA 1BGOA 4YYUA 1AYUA 4BPVA 1THEA 2XU4A 1PPPA 4QH6A 3HHIA 2DC9A 1MHWA 2NQDB 2AYNA 3OF8A 1CB5A 3K8UA 3MORA 4AXLA 1CTEA 2O6XA 1QDQA 1NB3A 2PADA 3IOQA 5EF4A 3BPMA 1GCBA 3KKUA 3RVXA 2IPPB 1S4VA 1CQDA 3CH3X 3RVVA 1CJLA 2AU1A 1EWMA 3QT4A 4P6EA 2BDLA 3OVZA 4OELA 1U9WA 4DMYA 1VSNA 4YYVA 3BOWA 1ME4A 3F5VA 2BDZA 3MHHA 2DJFB 3HD3A 1YK7A 1ZCMA 2WBFX 1IWDA 2E01A 1U9QX 1TL9A 3ERVA 1MDWA 2FQ9A 8PCHA 3K9MA 3KWBX 4MZSA 1BQIA 2DC6A 2HD5A 2B1MA 3E1ZB 5JA7A 4FJCA 4P6GA 7PCKA 3H89A 3N3GA 3PDFA 3K24A 2R9NA 2FT2A 1AU4A 1MIRA 3AI8A 3OISA 4CDFB 1AU3A 2DJGB 2FYEA 5CHTA 1QXPA 3P5WA 2F1GA 4XUIA 2FO5A 4MZOA 1XKGA 5EGWA 5CHVA 2G6DA 3S3QA 2DZZA 3CH2X 1NB5A 2AUXA 5CVNB 3PNRA 4XR7A 1X9YA 1U9XA 3O1GA 3KWZA 2YJCA 4I05A 5PADA 4X6IA 1VJVA 1NLJA 3QSDA 1NPZA 1STFE 4AXMA 4PP1A 5F02A 2P7UA 5CVMA 1PE6A 3KFQA 1F29A 4KLBA 2XU3A 1PIPA 1NQCA 1TU6A 3KX1A 1F2CA 1ZIVA 4N79A 1KHQA 1CPJA 2ARYA 3H8BA 5J94A 3DF0A 1EF7A
chains in the Genus database with same CATH superfamily
3GCBA 4QBBA 1PBHA 4PT5A 1QMYA 1YVBA 5FPWA 1NL6A 3PW3A 1POPA 2B1NA 2R9FA 3BWKA 2DCCA 4IUMA 4YYWA 4RNAA 1MS6A 2G8JA 1SNKA 1U9VA 2PBHA 1K3BB 1EWLA 3CBJA 2R9CA 1F2AA 3KW9A 4BOZA 4PI3A 3MTVA 3RVWA 2AS8A 1AECA 4QRXA 4PADA 3IV2A 2IBIA 4P16A 3IHPA 3U8EA 1YZBA 3W31A 4ZUXU 2YJ8A 4HWYA 4PP2E 1PCIA 3MTNA 3V6CA 2R9MA 5KO3A 4QRGA 1FH0A 2OP3A 1KXRA 2R9OA 3TNXA 2DC7A 4W5BA 3C9EA 4I04A 3M99A 1CV8A 3P5VA 5A24A 2CB5A 4CDEB 3IMAA 3QJ3A 3H6SA 3RNVA 1AYVA 1YT7A 5E6JA 4BQVA 4N4ZA 3MP2A 3WXGA 2JQGR 2AVWA 2HH5A 3BY4A 2JTCA 2E02A 4YV8A 2OULA 4BOUA 1DEUA 1QOLA 2BTWB 2FUDA 1CS8A 1KHPA 1EWPA 3B79A 2YJBA 2P86A 3HHAA 4CDCB 4MI7A 2R6NA 4YVAA 3IEJA 4FK5A 3B21A 4OEMA 2G8EA 1Y08A 1PXVA 3I06A 1ITOA 2HXZA 4XZXA 1GECE 4YYRA 1M6DA 4RY2A 5JZEA 1SP4B 2G7YA 2DCAA 1KFXL 3OF9A 3WXEA 3BC3A 3PBHA 4CDDB 2H7JA 4W4UA 2OZ2A 2JQFR 4QRVA 1HUCB 3NHEA 4MM3B 9PAPA 2E00A 2VHSA 1GMYA 3LFYA 2P0RA 2AYOA 3PHUA 4BS6A 4REZA 3BPFA 1PPDA 3IUTA 2XU5A 1F2BA 3O65A 3H8CA 3BB7A 3O0UA 4CZWA 2AUZA 1PVJA 3I3TA 2PREA 1PADA 3OVXA 1JQPA 1AU0A 6PADA 1CSBB 1ICFA 3PRPA 4WA6A 3WXFA 1A6RA 3TRKA 2NQAA 2C0YA 2GFOA 2ACTA 2FRAA 1DF0A 3OQCA 4Q8GA 1BY8A 2AGAA 2DCDA 2YJ2A 1YK8A 2Y5BA 1MEMA 5K16A 2NQGA 3KSEA 4BSQA 1AU2A 4I07A 3ZUAA 4K7CA 4D8IA 4BS5A 3D6SA 2AIMA 2FRQA 4X6HA 1PPNA 4N8WA 1PPOA 5JH3A 5CVOB 4YYSA 1ME3A 1ATKA 1TLOA 2DOSA 4Q8HA 2DC8A 3V6EA 2HWKA 4DMXA 2GHUA 1KFUL 1BP4A 3C0RA 2XU1A 2E03A 1AYWA 4RF1A 3MHSA 2DZYA 1MEGA 1U5IA 1O0EA 3P5XA 4ZTBA 3MJ5A 2Y6EA 4FIPA 3PT2A 1AIMA 3BCNA 1DKIA 2YJ9A 1GLOA 3CBKA 3N3KA 3H7DA 2F7DA 4X6JA 1YALA 1EWOA 2DCBA 2BTWA 2CIOA 3P5UA 1CVZA 3F75A 2HHNA 3PHXA 2VHFA 2NQIA 1Y4HA 2ATOA 3N4CA 4YYQA 2PNSA 4G54A 3S3RA 3USVA 2FTDA 3HWNA 4W5CA 4GUAA 1Q6KA 4MSXA 3LXSA 2J7QC 1BGOA 2UZJA 4YYUA 1AYUA 4BPVA 1THEA 2XU4A 1PPPA 4QH6A 3HHIA 2DC9A 3ZNHA 1MHWA 2NQDB 2AYNA 3OF8A 1CB5A 2FE8A 3K8UA 3MORA 4AXLA 1CTEA 2O6XA 1QDQA 1NB3A 2PADA 3IOQA 4WURA 5EF4A 3BPMA 4OW0A 4BOSA 5EZSA 1GCBA 3KKUA 3RVXA 2IPPB 1S4VA 4BOQA 1CQDA 3CH3X 3RVVA 4HXDB 2JRIA 1CJLA 3PRMA 2AU1A 3TMPA 4OVZA 4IP3A 1EWMA 3QT4A 4P6EA 2BDLA 3OVZA 4OELA 4M0WA 1U9WA 3W30A 4RF0A 4DMYA 1VSNA 4YYVA 3BOWA 1ME4A 5EZQA 3F5VA 2BDZA 3MHHA 2DJFB 3HD3A 1YK7A 3IFUA 1ZCMA 2WBFX 1IWDA 2E01A 3BBAA 1U9QX 1TL9A 3ERVA 1MDWA 2FQ9A 8PCHA 3K9MA 3KWBX 4MZSA 1BQIA 2DC6A 2HD5A 2B1MA 3E1ZB 5JA7A 4FJCA 4P6GA 7PCKA 4R3DA 3H89A 3N3GA 3PDFA 3K24A 2R9NA 2FT2A 1AU4A 1MIRA 4OVZB 4D8BA 3AI8A 3OISA 4CDFB 1AU3A 2DJGB 2FYEA 5CHTA 2BU3A 1QXPA 2Z84A 3P5WA 2F1GA 4XUIA 2FO5A 4MZOA 1XKGA 5EGWA 5CHVA 2G6DA 4RKXA 3S3QA 2DZZA 3CH2X 3E9SA 4D8EA 1NB5A 2AUXA 5CVNB 3PNRA 4XR7A 1X9YA 1U9XA 3O1GA 3KWZA 4BOPA 2YJCA 4I05A 5PADA 4X6IA 1VJVA 1NLJA 3QSDA 1NPZA 1STFE 1UKFA 3PSEA 4AXMA 4PP1A 5F02A 4A5UA 2P7UA 5CVMA 2J7QA 1PE6A 3KFQA 1F29A 4KLBA 2XU3A 1PIPA 1NQCA 3PHWA 1TU6A 3KX1A 1F2CA 1ZIVA 4N79A 1KHQA 1CPJA 2ARYA 3H8BA 5J94A 3DF0A 1EF7A
chains in the Genus database with same CATH topology
3GCBA 4QBBA 1PBHA 1QMYA 1YVBA 5FPWA 1NL6A 3PW3A 4NV7A 1POPA 2B1NA 2R9FA 3BWKA 2DCCA 4YYWA 1MS6A 2G8JA 1SNKA 1U9VA 2PBHA 1K3BB 1EWLA 3CBJA 2R9CA 1F2AA 3KW9A 4PI3A 3RVWA 2AS8A 1AECA 4QRXA 4PADA 3IV2A 2IBIA 3IHPA 3U8EA 4ZUXU 2YJ8A 4HWYA 4PP2E 1PCIA 3MTNA 3V6CA 2R9MA 4QRGA 1FH0A 2OP3A 1KXRA 2R9OA 3TNXA 2DC7A 4W5BA 3C9EA 4I04A 3M99A 1CV8A 3P5VA 5A24A 2CB5A 4CDEB 3IMAA 3QJ3A 3H6SA 1AYVA 1YT7A 4BQVA 4N4ZA 3WXGA 2JQGR 2AVWA 2HH5A 2E02A 4YV8A 2OULA 1DEUA 1QOLA 2FUDA 1CS8A 1KHPA 1EWPA 3B79A 2YJBA 2P86A 3HHAA 4CDCB 1W4TA 2R6NA 4YVAA 3IEJA 4FK5A 4OEMA 2G8EA 1Y08A 1PXVA 3I06A 1ITOA 2HXZA 1GECE 4YYRA 1M6DA 4RY2A 1SP4B 2G7YA 2DCAA 1KFXL 3OF9A 3WXEA 3BC3A 3PBHA 4CDDB 3LTWA 2H7JA 4W4UA 2OZ2A 2JQFR 4QRVA 1HUCB 3NHEA 9PAPA 2E00A 2VHSA 1GMYA 1W5RA 3LFYA 2P0RA 2AYOA 4BGFA 4BS6A 3BPFA 1PPDA 3IUTA 3D9WA 2XU5A 1F2BA 3H8CA 3O0UA 4CZWA 2AUZA 3I3TA 2PREA 1PADA 3OVXA 1JQPA 1AU0A 6PADA 1CSBB 1ICFA 4WA6A 3WXFA 1A6RA 2NQAA 2C0YA 2GFOA 2ACTA 2FRAA 1DF0A 4Q8GA 1BY8A 2DCDA 2YJ2A 1YK8A 2Y5BA 1MEMA 5K16A 2NQGA 3KSEA 4BSQA 1AU2A 4I07A 3ZUAA 4K7CA 4BS5A 3D6SA 2AIMA 1E2TA 2FRQA 4X6HA 1PPNA 4N8WA 1PPOA 1GX3A 5JH3A 5CVOB 4YYSA 1ME3A 1ATKA 1TLOA 4NV8A 4Q8HA 4B55A 2DC8A 3V6EA 4DMXA 2GHUA 1KFUL 1BP4A 2XU1A 2E03A 1AYWA 3MHSA 2DZYA 1MEGA 1U5IA 1O0EA 3P5XA 2Y6EA 4FIPA 1AIMA 3BCNA 2YJ9A 1GLOA 3CBKA 3N3KA 3H7DA 2F7DA 4X6JA 1YALA 1EWOA 2DCBA 2CIOA 3P5UA 1CVZA 3F75A 2HHNA 2VHFA 2NQIA 1Y4HA 2ATOA 3N4CA 4YYQA 2PNSA 4G54A 3S3RA 3USVA 2FTDA 3HWNA 4W5CA 1Q6KA 4MSXA 3LXSA 1BGOA 4YYUA 2VFBA 1AYUA 4BPVA 1THEA 2XU4A 1PPPA 4QH6A 3HHIA 2DC9A 1MHWA 2NQDB 2AYNA 3OF8A 1CB5A 3K8UA 3MORA 4AXLA 1CTEA 2O6XA 1QDQA 1NB3A 2PADA 3IOQA 5EF4A 3BPMA 1GCBA 3KKUA 3RVXA 2IPPB 1S4VA 1CQDA 3CH3X 3RVVA 1CJLA 2AU1A 1EWMA 3QT4A 4C5PA 4P6EA 2BDLA 3OVZA 4OELA 1U9WA 4DMYA 1VSNA 4YYVA 3BOWA 1ME4A 3F5VA 2BDZA 3MHHA 2DJFB 3HD3A 1YK7A 1ZCMA 2WBFX 1IWDA 2E01A 1U9QX 1TL9A 3ERVA 1MDWA 2FQ9A 8PCHA 3K9MA 3KWBX 4MZSA 1BQIA 2DC6A 2HD5A 2B1MA 3E1ZB 5JA7A 4FJCA 4P6GA 7PCKA 3H89A 3N3GA 3PDFA 3K24A 2R9NA 2FT2A 1AU4A 1MIRA 3AI8A 3OISA 4CDFB 1AU3A 2DJGB 2FYEA 5CHTA 1QXPA 3P5WA 2F1GA 4XUIA 2FO5A 4MZOA 1XKGA 5EGWA 5CHVA 2G6DA 3S3QA 2DZZA 3CH2X 1NB5A 2AUXA 5CVNB 3PNRA 4XR7A 1X9YA 1U9XA 3O1GA 3KWZA 2YJCA 4I05A 5PADA 2BSZA 4X6IA 1VJVA 1NLJA 3QSDA 1NPZA 1STFE 2VFCA 4AXMA 4PP1A 5F02A 2P7UA 5CVMA 1PE6A 3KFQA 1F29A 4KLBA 1W6FA 2XU3A 1PIPA 1NQCA 1TU6A 3KX1A 1F2CA 1ZIVA 4N79A 1KHQA 1CPJA 4GUZA 2ARYA 3H8BA 5J94A 3DF0A 1EF7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GCB A;  4QBB A;  1PBH A;  1QMY A;  1YVB A;  5FPW A;  1NL6 A;  3PW3 A;  1POP A;  2B1N A;  2R9F A;  3BWK A;  2DCC A;  4YYW A;  1MS6 A;  2G8J A;  1SNK A;  1U9V A;  2PBH A;  1K3B B;  1EWL A;  3CBJ A;  2R9C A;  1F2A A;  3KW9 A;  4PI3 A;  3RVW A;  2AS8 A;  1AEC A;  4QRX A;  4PAD A;  3IV2 A;  2IBI A;  3IHP A;  3U8E A;  4ZUX U;  2YJ8 A;  4HWY A;  4PP2 E;  1PCI A;  3MTN A;  3V6C A;  2R9M A;  4QRG A;  1FH0 A;  2OP3 A;  1KXR A;  2R9O A;  3TNX A;  2DC7 A;  4W5B A;  3C9E A;  4I04 A;  3M99 A;  1CV8 A;  3P5V A;  5A24 A;  2CB5 A;  4CDE B;  3IMA A;  3QJ3 A;  3H6S A;  1AYV A;  1YT7 A;  4BQV A;  4N4Z A;  3WXG A;  2JQG R;  2AVW A;  2HH5 A;  2E02 A;  4YV8 A;  2OUL A;  1DEU A;  1QOL A;  2FUD A;  1CS8 A;  1KHP A;  1EWP A;  3B79 A;  2YJB A;  2P86 A;  3HHA A;  4CDC B;  2R6N A;  4YVA A;  3IEJ A;  4FK5 A;  4OEM A;  2G8E A;  1Y08 A;  1PXV A;  3I06 A;  1ITO A;  2HXZ A;  1GEC E;  4YYR A;  1M6D A;  4RY2 A;  1SP4 B;  2G7Y A;  2DCA A;  1KFX L;  3OF9 A;  3WXE A;  3BC3 A;  3PBH A;  4CDD B;  2H7J A;  4W4U A;  2OZ2 A;  2JQF R;  4QRV A;  1HUC B;  3NHE A;  9PAP A;  2E00 A;  2VHS A;  1GMY A;  3LFY A;  2P0R A;  2AYO A;  4BS6 A;  3BPF A;  1PPD A;  3IUT A;  2XU5 A;  1F2B A;  3H8C A;  3O0U A;  4CZW A;  2AUZ A;  3I3T A;  2PRE A;  1PAD A;  3OVX A;  1JQP A;  1AU0 A;  6PAD A;  1CSB B;  1ICF A;  4WA6 A;  3WXF A;  1A6R A;  2NQA A;  2C0Y A;  2GFO A;  2ACT A;  2FRA A;  1DF0 A;  4Q8G A;  1BY8 A;  2DCD A;  2YJ2 A;  5K16 A;  1YK8 A;  1MEM A;  2Y5B A;  2NQG A;  3KSE A;  4BSQ A;  1AU2 A;  4I07 A;  3ZUA A;  4K7C A;  4BS5 A;  3D6S A;  2AIM A;  2FRQ A;  4X6H A;  1PPN A;  4N8W A;  1PPO A;  5JH3 A;  5CVO B;  4YYS A;  1ME3 A;  1ATK A;  1TLO A;  4Q8H A;  2DC8 A;  3V6E A;  4DMX A;  2GHU A;  1KFU L;  1BP4 A;  2XU1 A;  2E03 A;  1AYW A;  3MHS A;  2DZY A;  1MEG A;  1U5I A;  1O0E A;  3P5X A;  2Y6E A;  4FIP A;  1AIM A;  3BCN A;  2YJ9 A;  1GLO A;  3CBK A;  3N3K A;  3H7D A;  2F7D A;  4X6J A;  1YAL A;  1EWO A;  2DCB A;  2CIO A;  3P5U A;  1CVZ A;  3F75 A;  2HHN A;  2VHF A;  2NQI A;  1Y4H A;  2ATO A;  3N4C A;  4YYQ A;  2PNS A;  4G54 A;  3S3R A;  3USV A;  2FTD A;  3HWN A;  4W5C A;  1Q6K A;  4MSX A;  3LXS A;  1BGO A;  4YYU A;  1AYU A;  4BPV A;  1THE A;  2XU4 A;  1PPP A;  4QH6 A;  3HHI A;  2DC9 A;  1MHW A;  2NQD B;  2AYN A;  3OF8 A;  1CB5 A;  3K8U A;  3MOR A;  4AXL A;  1CTE A;  2O6X A;  1QDQ A;  1NB3 A;  2PAD A;  3IOQ A;  5EF4 A;  3BPM A;  1GCB A;  3KKU A;  3RVX A;  2IPP B;  1S4V A;  1CQD A;  3CH3 X;  3RVV A;  1CJL A;  2AU1 A;  1EWM A;  3QT4 A;  4P6E A;  2BDL A;  3OVZ A;  4OEL A;  1U9W A;  4DMY A;  1VSN A;  4YYV A;  3BOW A;  1ME4 A;  3F5V A;  2BDZ A;  3MHH A;  2DJF B;  3HD3 A;  1YK7 A;  1ZCM A;  2WBF X;  1IWD A;  2E01 A;  1U9Q X;  1TL9 A;  3ERV A;  1MDW A;  2FQ9 A;  8PCH A;  3K9M A;  3KWB X;  4MZS A;  1BQI A;  2DC6 A;  2HD5 A;  2B1M A;  3E1Z B;  5JA7 A;  4FJC A;  4P6G A;  7PCK A;  3H89 A;  3N3G A;  3PDF A;  3K24 A;  2R9N A;  2FT2 A;  1AU4 A;  1MIR A;  3AI8 A;  3OIS A;  4CDF B;  1AU3 A;  2DJG B;  2FYE A;  5CHT A;  1QXP A;  3P5W A;  2F1G A;  4XUI A;  2FO5 A;  4MZO A;  1XKG A;  5EGW A;  5CHV A;  2G6D A;  3S3Q A;  2DZZ A;  3CH2 X;  1NB5 A;  2AUX A;  5CVN B;  3PNR A;  4XR7 A;  1X9Y A;  1U9X A;  3O1G A;  3KWZ A;  2YJC A;  4I05 A;  5PAD A;  4X6I A;  1VJV A;  1NLJ A;  3QSD A;  1NPZ A;  1STF E;  4AXM A;  4PP1 A;  5F02 A;  2P7U A;  5CVM A;  1PE6 A;  3KFQ A;  1F29 A;  4KLB A;  2XU3 A;  1PIP A;  1NQC A;  1TU6 A;  3KX1 A;  1F2C A;  1ZIV A;  4N79 A;  1KHQ A;  1CPJ A;  2ARY A;  3H8B A;  5J94 A;  3DF0 A;  1EF7 A; 
#chains in the Genus database with same CATH topology
 3GCB A;  4QBB A;  1PBH A;  4PT5 A;  1QMY A;  1YVB A;  5FPW A;  1NL6 A;  3PW3 A;  1POP A;  2B1N A;  2R9F A;  3BWK A;  2DCC A;  4IUM A;  4YYW A;  4RNA A;  1MS6 A;  2G8J A;  1SNK A;  1U9V A;  2PBH A;  1K3B B;  1EWL A;  3CBJ A;  2R9C A;  1F2A A;  3KW9 A;  4BOZ A;  4PI3 A;  3MTV A;  3RVW A;  2AS8 A;  1AEC A;  4QRX A;  4PAD A;  3IV2 A;  2IBI A;  4P16 A;  3IHP A;  3U8E A;  1YZB A;  3W31 A;  4ZUX U;  2YJ8 A;  4HWY A;  4PP2 E;  1PCI A;  3MTN A;  3V6C A;  2R9M A;  5KO3 A;  4QRG A;  1FH0 A;  2OP3 A;  1KXR A;  2R9O A;  3TNX A;  2DC7 A;  4W5B A;  3C9E A;  4I04 A;  3M99 A;  1CV8 A;  3P5V A;  5A24 A;  2CB5 A;  4CDE B;  3IMA A;  3QJ3 A;  3H6S A;  3RNV A;  1AYV A;  1YT7 A;  5E6J A;  4BQV A;  4N4Z A;  3MP2 A;  3WXG A;  2JQG R;  2AVW A;  2HH5 A;  3BY4 A;  2JTC A;  2E02 A;  4YV8 A;  2OUL A;  4BOU A;  1DEU A;  1QOL A;  2BTW B;  2FUD A;  1CS8 A;  1KHP A;  1EWP A;  3B79 A;  2YJB A;  2P86 A;  3HHA A;  4CDC B;  4MI7 A;  2R6N A;  4YVA A;  3IEJ A;  4FK5 A;  3B21 A;  4OEM A;  2G8E A;  1Y08 A;  1PXV A;  3I06 A;  1ITO A;  2HXZ A;  4XZX A;  1GEC E;  4YYR A;  1M6D A;  4RY2 A;  5JZE A;  1SP4 B;  2G7Y A;  2DCA A;  1KFX L;  3OF9 A;  3WXE A;  3BC3 A;  3PBH A;  4CDD B;  2H7J A;  4W4U A;  2OZ2 A;  2JQF R;  4QRV A;  1HUC B;  3NHE A;  4MM3 B;  9PAP A;  2E00 A;  2VHS A;  1GMY A;  3LFY A;  2P0R A;  2AYO A;  3PHU A;  4BS6 A;  4REZ A;  3BPF A;  1PPD A;  3IUT A;  2XU5 A;  1F2B A;  3O65 A;  3H8C A;  3BB7 A;  3O0U A;  4CZW A;  2AUZ A;  1PVJ A;  3I3T A;  2PRE A;  1PAD A;  3OVX A;  1JQP A;  1AU0 A;  6PAD A;  1CSB B;  1ICF A;  3PRP A;  4WA6 A;  3WXF A;  1A6R A;  3TRK A;  2NQA A;  2C0Y A;  2GFO A;  2ACT A;  2FRA A;  1DF0 A;  3OQC A;  4Q8G A;  1BY8 A;  2AGA A;  2DCD A;  2YJ2 A;  1YK8 A;  2Y5B A;  1MEM A;  5K16 A;  2NQG A;  3KSE A;  4BSQ A;  1AU2 A;  4I07 A;  3ZUA A;  4K7C A;  4D8I A;  4BS5 A;  3D6S A;  2AIM A;  2FRQ A;  4X6H A;  1PPN A;  4N8W A;  1PPO A;  5JH3 A;  5CVO B;  4YYS A;  1ME3 A;  1ATK A;  1TLO A;  2DOS A;  4Q8H A;  2DC8 A;  3V6E A;  2HWK A;  4DMX A;  2GHU A;  1KFU L;  1BP4 A;  3C0R A;  2XU1 A;  2E03 A;  1AYW A;  4RF1 A;  3MHS A;  2DZY A;  1MEG A;  1U5I A;  1O0E A;  3P5X A;  4ZTB A;  3MJ5 A;  2Y6E A;  4FIP A;  3PT2 A;  1AIM A;  3BCN A;  1DKI A;  2YJ9 A;  1GLO A;  3CBK A;  3N3K A;  3H7D A;  2F7D A;  4X6J A;  1YAL A;  1EWO A;  2DCB A;  2BTW A;  2CIO A;  3P5U A;  1CVZ A;  3F75 A;  2HHN A;  3PHX A;  2VHF A;  2NQI A;  1Y4H A;  2ATO A;  3N4C A;  4YYQ A;  2PNS A;  4G54 A;  3S3R A;  3USV A;  2FTD A;  3HWN A;  4W5C A;  4GUA A;  1Q6K A;  4MSX A;  3LXS A;  2J7Q C;  1BGO A;  2UZJ A;  4YYU A;  1AYU A;  4BPV A;  1THE A;  2XU4 A;  1PPP A;  4QH6 A;  3HHI A;  2DC9 A;  3ZNH A;  1MHW A;  2NQD B;  2AYN A;  3OF8 A;  1CB5 A;  2FE8 A;  3K8U A;  3MOR A;  4AXL A;  1CTE A;  2O6X A;  1QDQ A;  1NB3 A;  2PAD A;  3IOQ A;  4WUR A;  5EF4 A;  3BPM A;  4OW0 A;  4BOS A;  5EZS A;  1GCB A;  3KKU A;  3RVX A;  2IPP B;  1S4V A;  4BOQ A;  1CQD A;  3CH3 X;  3RVV A;  4HXD B;  2JRI A;  1CJL A;  3PRM A;  2AU1 A;  3TMP A;  4OVZ A;  4IP3 A;  1EWM A;  3QT4 A;  4P6E A;  2BDL A;  3OVZ A;  4OEL A;  4M0W A;  1U9W A;  3W30 A;  4RF0 A;  4DMY A;  1VSN A;  4YYV A;  3BOW A;  1ME4 A;  5EZQ A;  3F5V A;  2BDZ A;  3MHH A;  2DJF B;  3HD3 A;  1YK7 A;  3IFU A;  1ZCM A;  2WBF X;  1IWD A;  2E01 A;  3BBA A;  1U9Q X;  1TL9 A;  3ERV A;  1MDW A;  2FQ9 A;  8PCH A;  3K9M A;  3KWB X;  4MZS A;  1BQI A;  2DC6 A;  2HD5 A;  2B1M A;  3E1Z B;  5JA7 A;  4FJC A;  4P6G A;  7PCK A;  4R3D A;  3H89 A;  3N3G A;  3PDF A;  3K24 A;  2R9N A;  2FT2 A;  1AU4 A;  1MIR A;  4OVZ B;  4D8B A;  3AI8 A;  3OIS A;  4CDF B;  1AU3 A;  2DJG B;  2FYE A;  5CHT A;  2BU3 A;  1QXP A;  2Z84 A;  3P5W A;  2F1G A;  4XUI A;  2FO5 A;  4MZO A;  1XKG A;  5EGW A;  5CHV A;  2G6D A;  4RKX A;  3S3Q A;  2DZZ A;  3CH2 X;  3E9S A;  4D8E A;  1NB5 A;  2AUX A;  5CVN B;  3PNR A;  4XR7 A;  1X9Y A;  1U9X A;  3O1G A;  3KWZ A;  4BOP A;  2YJC A;  4I05 A;  5PAD A;  4X6I A;  1VJV A;  1NLJ A;  3QSD A;  1NPZ A;  1STF E;  1UKF A;  3PSE A;  4AXM A;  4PP1 A;  5F02 A;  4A5U A;  2P7U A;  5CVM A;  2J7Q A;  1PE6 A;  3KFQ A;  1F29 A;  4KLB A;  2XU3 A;  1PIP A;  1NQC A;  3PHW A;  1TU6 A;  3KX1 A;  1F2C A;  1ZIV A;  4N79 A;  1KHQ A;  1CPJ A;  2ARY A;  3H8B A;  5J94 A;  3DF0 A;  1EF7 A; 
#chains in the Genus database with same CATH homology
 3GCB A;  4QBB A;  1PBH A;  1QMY A;  1YVB A;  5FPW A;  1NL6 A;  3PW3 A;  4NV7 A;  1POP A;  2B1N A;  2R9F A;  3BWK A;  2DCC A;  4YYW A;  1MS6 A;  2G8J A;  1SNK A;  1U9V A;  2PBH A;  1K3B B;  1EWL A;  3CBJ A;  2R9C A;  1F2A A;  3KW9 A;  4PI3 A;  3RVW A;  2AS8 A;  1AEC A;  4QRX A;  4PAD A;  3IV2 A;  2IBI A;  3IHP A;  3U8E A;  4ZUX U;  2YJ8 A;  4HWY A;  4PP2 E;  1PCI A;  3MTN A;  3V6C A;  2R9M A;  4QRG A;  1FH0 A;  2OP3 A;  1KXR A;  2R9O A;  3TNX A;  2DC7 A;  4W5B A;  3C9E A;  4I04 A;  3M99 A;  1CV8 A;  3P5V A;  5A24 A;  2CB5 A;  4CDE B;  3IMA A;  3QJ3 A;  3H6S A;  1AYV A;  1YT7 A;  4BQV A;  4N4Z A;  3WXG A;  2JQG R;  2AVW A;  2HH5 A;  2E02 A;  4YV8 A;  2OUL A;  1DEU A;  1QOL A;  2FUD A;  1CS8 A;  1KHP A;  1EWP A;  3B79 A;  2YJB A;  2P86 A;  3HHA A;  4CDC B;  1W4T A;  2R6N A;  4YVA A;  3IEJ A;  4FK5 A;  4OEM A;  2G8E A;  1Y08 A;  1PXV A;  3I06 A;  1ITO A;  2HXZ A;  1GEC E;  4YYR A;  1M6D A;  4RY2 A;  1SP4 B;  2G7Y A;  2DCA A;  1KFX L;  3OF9 A;  3WXE A;  3BC3 A;  3PBH A;  4CDD B;  3LTW A;  2H7J A;  4W4U A;  2OZ2 A;  2JQF R;  4QRV A;  1HUC B;  3NHE A;  9PAP A;  2E00 A;  2VHS A;  1GMY A;  1W5R A;  3LFY A;  2P0R A;  2AYO A;  4BGF A;  4BS6 A;  3BPF A;  1PPD A;  3IUT A;  3D9W A;  2XU5 A;  1F2B A;  3H8C A;  3O0U A;  4CZW A;  2AUZ A;  3I3T A;  2PRE A;  1PAD A;  3OVX A;  1JQP A;  1AU0 A;  6PAD A;  1CSB B;  1ICF A;  4WA6 A;  3WXF A;  1A6R A;  2NQA A;  2C0Y A;  2GFO A;  2ACT A;  2FRA A;  1DF0 A;  4Q8G A;  1BY8 A;  2DCD A;  2YJ2 A;  1YK8 A;  2Y5B A;  1MEM A;  5K16 A;  2NQG A;  3KSE A;  4BSQ A;  1AU2 A;  4I07 A;  3ZUA A;  4K7C A;  4BS5 A;  3D6S A;  2AIM A;  1E2T A;  2FRQ A;  4X6H A;  1PPN A;  4N8W A;  1PPO A;  1GX3 A;  5JH3 A;  5CVO B;  4YYS A;  1ME3 A;  1ATK A;  1TLO A;  4NV8 A;  4Q8H A;  4B55 A;  2DC8 A;  3V6E A;  4DMX A;  2GHU A;  1KFU L;  1BP4 A;  2XU1 A;  2E03 A;  1AYW A;  3MHS A;  2DZY A;  1MEG A;  1U5I A;  1O0E A;  3P5X A;  2Y6E A;  4FIP A;  1AIM A;  3BCN A;  2YJ9 A;  1GLO A;  3CBK A;  3N3K A;  3H7D A;  2F7D A;  4X6J A;  1YAL A;  1EWO A;  2DCB A;  2CIO A;  3P5U A;  1CVZ A;  3F75 A;  2HHN A;  2VHF A;  2NQI A;  1Y4H A;  2ATO A;  3N4C A;  4YYQ A;  2PNS A;  4G54 A;  3S3R A;  3USV A;  2FTD A;  3HWN A;  4W5C A;  1Q6K A;  4MSX A;  3LXS A;  1BGO A;  4YYU A;  2VFB A;  1AYU A;  4BPV A;  1THE A;  2XU4 A;  1PPP A;  4QH6 A;  3HHI A;  2DC9 A;  1MHW A;  2NQD B;  2AYN A;  3OF8 A;  1CB5 A;  3K8U A;  3MOR A;  4AXL A;  1CTE A;  2O6X A;  1QDQ A;  1NB3 A;  2PAD A;  3IOQ A;  5EF4 A;  3BPM A;  1GCB A;  3KKU A;  3RVX A;  2IPP B;  1S4V A;  1CQD A;  3CH3 X;  3RVV A;  1CJL A;  2AU1 A;  1EWM A;  3QT4 A;  4C5P A;  4P6E A;  2BDL A;  3OVZ A;  4OEL A;  1U9W A;  4DMY A;  1VSN A;  4YYV A;  3BOW A;  1ME4 A;  3F5V A;  2BDZ A;  3MHH A;  2DJF B;  3HD3 A;  1YK7 A;  1ZCM A;  2WBF X;  1IWD A;  2E01 A;  1U9Q X;  1TL9 A;  3ERV A;  1MDW A;  2FQ9 A;  8PCH A;  3K9M A;  3KWB X;  4MZS A;  1BQI A;  2DC6 A;  2HD5 A;  2B1M A;  3E1Z B;  5JA7 A;  4FJC A;  4P6G A;  7PCK A;  3H89 A;  3N3G A;  3PDF A;  3K24 A;  2R9N A;  2FT2 A;  1AU4 A;  1MIR A;  3AI8 A;  3OIS A;  4CDF B;  1AU3 A;  2DJG B;  2FYE A;  5CHT A;  1QXP A;  3P5W A;  2F1G A;  4XUI A;  2FO5 A;  4MZO A;  1XKG A;  5EGW A;  5CHV A;  2G6D A;  3S3Q A;  2DZZ A;  3CH2 X;  1NB5 A;  2AUX A;  5CVN B;  3PNR A;  4XR7 A;  1X9Y A;  1U9X A;  3O1G A;  3KWZ A;  2YJC A;  4I05 A;  5PAD A;  2BSZ A;  4X6I A;  1VJV A;  1NLJ A;  3QSD A;  1NPZ A;  1STF E;  2VFC A;  4AXM A;  4PP1 A;  5F02 A;  2P7U A;  5CVM A;  1PE6 A;  3KFQ A;  1F29 A;  4KLB A;  1W6F A;  2XU3 A;  1PIP A;  1NQC A;  1TU6 A;  3KX1 A;  1F2C A;  1ZIV A;  4N79 A;  1KHQ A;  1CPJ A;  4GUZ A;  2ARY A;  3H8B A;  5J94 A;  3DF0 A;  1EF7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...