3WXFA

Crystal structure of cyld usp domain (c596s e674q) in complex with met1-linked diubiquitin
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
310
structure length
299
Chain Sequence
b'MGLEVMVGKKKGIQGHYNSSYLDSTLFCLFSFSSVLDTVLLRPRSKTDVEYYKETQELLRTEIVNPLRIHGYVCATKIMKLRRILEKVEAASGFTSEQKDPEEFLNILFHHILRVDPLLRLRSAGQKVQDCYFYQIFMDKVMVPTSQQLLEWSFINSDLKFAEAPSCLIIQMPRFGKDFKMFNKIFPSLELDITDLLDDQQMELFAVLCIETSHYVAFVKYGSADSAWLFFDSMADRDGGQNGFNIPQVSRCPEVGEYLKMTPEELHALDPKNIQGYARRLLCDAYMCMYQSPTMSLYK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Uncharacterized protein
publication title Structures of CYLD USP with Met1- or Lys63-linked diubiquitin reveal mechanisms for dual specificity
doi rcsb
source organism Danio rerio
molecule tags Hydrolase/protein binding
total genus 93
structure length 299
sequence length 310
chains with identical sequence C
ec nomenclature
pdb deposition date 2014-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00443 UCH Ubiquitin carboxyl-terminal hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3wxfA00
2DC6A 3RVXA 4AXLA 1PCIA 1CQDA 1ME4A 1TL9A 4FJCA 3IHPA 3KFQA 1PBHA 1XKGA 4DMXA 2ATOA 1NB3A 1Y08A 1MHWA 2E01A 4Q8GA 2AUXA 3M99A 3IOQA 4YYRA 3QJ3A 2DZZA 1QMYA 4P6EA 4X6HA 1MEMA 1ITOA 4RY2A 3OVZA 1AU3A 2PREA 1F29A 1A6RA 4DMYA 2E00A 3U8EA 4AXMA 1MEGA 1YALA 1AECA 2R9MA 5A24A 1ZCMA 1NLJA 5CHTA 3KW9A 1MS6A 2OZ2A 1POPA 2WBFX 1PXVA 1SP4B 4MZOA 4N8WA 1CTEA 4YYQA 4HWYA 1VSNA 1BGOA 3E1ZB 2Y5BA 3IMAA 1AYVA 3MTNA 4N4ZA 1CPJA 3BPMA 3O1GA 1ICFA 2ARYA 1PADA 3H8BA 3KWBX 5CVNB 3V6CA 1EWOA 5K16A 3WXGA 1NQCA 1PIPA 1MIRA 4PP2E 4W4UA 2PBHA 3IV2A 2XU1A 3F5VA 3WXEA 2DCBA 2JQGR 2DJFB 2ACTA 4MZSA 2GHUA 1IWDA 3LFYA 3MHSA 4CDFB 3OISA 1YK8A 4BQVA 4QRVA 2VHFA 3P5VA 2OP3A 2G8EA 3NHEA 2G6DA 1K3BB 8PCHA 3KWZA 2YJ9A 4MSXA 3P5WA 4PI3A 6PADA 1AYUA 3OVXA 3DF0A 3CBJA 1TU6A 3BCNA 3V6EA 3K8UA 2FRAA 1EF7A 3K9MA 1F2AA 1BQIA 2FRQA 1U9XA 1BY8A 2PADA 1SNKA 2IBIA 2F7DA 2AYOA 3IEJA 5CVMA 3KSEA 3H6SA 2DZYA 2HD5A 3CH3X 1CB5A 2GFOA 3RVWA 1QDQA 3RVVA 4OEMA 1DEUA 1TLOA 1F2BA 4BPVA 5FPWA 1BP4A 2DCDA 3HD3A 3BOWA 2HXZA 4PP1A 4X6JA 1HUCB 1PPPA 1X9YA 3HHAA 1YT7A 4PADA 2C0YA 3S3QA 3PNRA 4BS6A 1AU0A 4YYVA 2FYEA 2IPPB 5JH3A 3S3RA 5CHVA 1F2CA 1JQPA 2NQDB 2BDZA 1KXRA 2YJ8A 2G8JA 1PE6A 2AIMA 1S4VA 3ERVA 2HHNA 3KX1A 5J94A 4WA6A 3PDFA 1AU2A 4FK5A 5CVOB 4W5CA 1PPOA 2DC9A 2FTDA 3TNXA 3BWKA 2G7YA 4XUIA 2B1NA 5F02A 1NB5A 1CS8A 2R9CA 3OF9A 1CSBB 1EWMA 1KHPA 3C9EA 4X6IA 1GECE 3CBKA 3OF8A 1U9VA 5JA7A 3AI8A 2AU1A 2HH5A 2YJBA 1Q6KA 1NL6A 1CV8A 1GCBA 5PADA 4I07A 1ATKA 4QRXA 3H7DA 2AUZA 2YJ2A 3QT4A 2NQAA 2YJCA 5EGWA 4K7CA 2OULA 3N4CA 4QRGA 2NQIA 2P86A 2O6XA 1ZIVA 4YYSA 2PNSA 2XU5A 4CZWA 2FO5A 3N3GA 2XU4A 9PAPA 1FH0A 4FIPA 4QH6A 1EWPA 1YVBA 3HWNA 3K24A 3P5XA 1KFXL 2DC8A 2DC7A 4CDEB 2R9NA 1ME3A 4P6GA 2XU3A 3LXSA 3HHIA 4OELA 1AYWA 7PCKA 2JQFR 5EF4A 1GMYA 3BPFA 3PW3A 4YVAA 2FQ9A 3H8CA 2E03A 3B79A 4ZUXU 3MHHA 4KLBA 4W5BA 1O0EA 4YV8A 1GLOA 4YYWA 3IUTA 2P7UA 1EWLA 1Y4HA 2E02A 1CVZA 1M6DA 1U9QX 2B1MA 3I06A 4YYUA 1PPNA 2Y6EA 1QXPA 4QBBA 2F1GA 3PBHA 3D6SA 2DJGB 3N3KA 2BDLA 1VJVA 1KFUL 2R9FA 3BC3A 3GCBA 4I04A 1AU4A 3ZUAA 4G54A 4N79A 4CDDB 1PPDA 3CH2X 2DCAA 1KHQA 2AYNA 2DCCA 1U9WA 1DF0A 2AS8A 2CIOA 4Q8HA 1STFE 2FUDA 2R6NA 1QOLA 2NQGA 1CJLA 4XR7A 2CB5A 2P0RA 1NPZA 2H7JA 3I3TA 3QSDA 2R9OA 3MORA 1MDWA 1THEA 1U5IA 3USVA 4BS5A 2VHSA 1AIMA 3F75A 3H89A 3O0UA 3P5UA 4I05A 3WXFA 3KKUA 1YK7A 4CDCB 4BSQA 2AVWA 2FT2A
chains in the Genus database with same CATH superfamily
2DC6A 3RVXA 4AXLA 1PCIA 4OVZB 1CQDA 1ME4A 1TL9A 4FJCA 3IHPA 3KFQA 1PBHA 2HWKA 1XKGA 3PHXA 4DMXA 2ATOA 1NB3A 4ZTBA 1Y08A 1MHWA 2E01A 4Q8GA 2AUXA 3M99A 5EZQA 4R3DA 3IOQA 4YYRA 3QJ3A 2DZZA 1QMYA 4P6EA 4RKXA 4X6HA 1MEMA 1ITOA 4RY2A 3OVZA 1AU3A 2PREA 1F29A 1A6RA 4DMYA 2E00A 3U8EA 3PRMA 4AXMA 2JTCA 1MEGA 1YALA 1AECA 2R9MA 5A24A 4RF0A 1ZCMA 2FE8A 1NLJA 3OQCA 5CHTA 3KW9A 1MS6A 2OZ2A 1POPA 2WBFX 1PXVA 1SP4B 4MZOA 4N8WA 1CTEA 1YZBA 4YYQA 4HWYA 1VSNA 1BGOA 3PRPA 3E1ZB 3C0RA 2Y5BA 3IMAA 1AYVA 3MTNA 4N4ZA 1CPJA 3BPMA 3O1GA 2BTWB 1ICFA 2ARYA 1PADA 3H8BA 3KWBX 5CVNB 3V6CA 1EWOA 5K16A 4HXDB 3WXGA 1NQCA 1PIPA 1MIRA 4PP2E 3BB7A 4W4UA 2PBHA 3IV2A 4OW0A 2XU1A 3F5VA 3WXEA 2DCBA 2JQGR 2DJFB 4D8IA 2ACTA 4MZSA 2GHUA 1IWDA 3LFYA 1PVJA 3MHSA 4CDFB 3MP2A 3OISA 1YK8A 2J7QA 4BQVA 4QRVA 2VHFA 3P5VA 3BY4A 2OP3A 2G8EA 3NHEA 2G6DA 1K3BB 8PCHA 3KWZA 2YJ9A 4MM3B 3PHWA 4MSXA 3P5WA 4PI3A 6PADA 1AYUA 3OVXA 3DF0A 1DKIA 3CBJA 1TU6A 3BCNA 3V6EA 3K8UA 2FRAA 1EF7A 3K9MA 1F2AA 5KO3A 1BQIA 2FRQA 1U9XA 1BY8A 2PADA 1SNKA 2IBIA 2F7DA 2AYOA 3IEJA 5CVMA 3KSEA 3TMPA 2DOSA 3H6SA 4REZA 4IUMA 2DZYA 2HD5A 3PHUA 3CH3X 1CB5A 4BOQA 2GFOA 4D8BA 4OVZA 3RVWA 1QDQA 3RVVA 4OEMA 1DEUA 1TLOA 1F2BA 3W30A 4P16A 4BPVA 5FPWA 1BP4A 2DCDA 3HD3A 3BOWA 4XZXA 2HXZA 4PP1A 4PT5A 4X6JA 1HUCB 1PPPA 3W31A 1X9YA 3HHAA 4M0WA 1YT7A 4PADA 2C0YA 3S3QA 3PNRA 4RF1A 4BS6A 1AU0A 4WURA 4YYVA 3PT2A 4A5UA 2FYEA 2IPPB 5JH3A 3S3RA 5CHVA 1F2CA 1JQPA 2NQDB 2BDZA 1KXRA 2YJ8A 2G8JA 1PE6A 2AIMA 1S4VA 3ERVA 2HHNA 3KX1A 5J94A 4WA6A 3PDFA 1AU2A 4FK5A 4BOPA 3MJ5A 5CVOB 4W5CA 1PPOA 2DC9A 4BOSA 2FTDA 3TNXA 3BWKA 2G7YA 4XUIA 2JRIA 2B1NA 5F02A 1NB5A 1CS8A 2UZJA 2R9CA 3OF9A 3E9SA 5E6JA 1CSBB 1EWMA 1KHPA 3C9EA 4X6IA 1GECE 3CBKA 3OF8A 1U9VA 5JA7A 3AI8A 2AU1A 3MTVA 2BTWA 2HH5A 2YJBA 3B21A 5JZEA 1Q6KA 1NL6A 4BOZA 1CV8A 1GCBA 5PADA 4I07A 4MI7A 1ATKA 4QRXA 4BOUA 3H7DA 2AGAA 2AUZA 2YJ2A 5EZSA 3QT4A 4GUAA 2NQAA 2YJCA 5EGWA 4K7CA 2OULA 3N4CA 4QRGA 2NQIA 2P86A 2O6XA 1ZIVA 3ZNHA 4YYSA 2PNSA 2XU5A 4CZWA 3O65A 2FO5A 3N3GA 2XU4A 9PAPA 1FH0A 4FIPA 4QH6A 1EWPA 1YVBA 4IP3A 3HWNA 3K24A 3P5XA 1KFXL 2DC8A 2DC7A 4CDEB 2R9NA 1ME3A 4P6GA 2XU3A 3LXSA 3HHIA 4OELA 1AYWA 7PCKA 2JQFR 5EF4A 1GMYA 3BBAA 3BPFA 3PW3A 4YVAA 3RNVA 2FQ9A 3H8CA 2E03A 3B79A 4ZUXU 3MHHA 4KLBA 4W5BA 1O0EA 4YV8A 1GLOA 3IFUA 4YYWA 3IUTA 2P7UA 1EWLA 1Y4HA 2E02A 1CVZA 1M6DA 1U9QX 2Z84A 2B1MA 3I06A 4YYUA 1PPNA 2Y6EA 1QXPA 1UKFA 4QBBA 2F1GA 3PBHA 3D6SA 2DJGB 3N3KA 2BDLA 4D8EA 1VJVA 1KFUL 2R9FA 3BC3A 3GCBA 4I04A 1AU4A 4RNAA 3ZUAA 4G54A 4N79A 4CDDB 1PPDA 3CH2X 2DCAA 1KHQA 2AYNA 2DCCA 1U9WA 1DF0A 2AS8A 2CIOA 4Q8HA 1STFE 2FUDA 2R6NA 3PSEA 1QOLA 2NQGA 1CJLA 4XR7A 2CB5A 2P0RA 1NPZA 3TRKA 2H7JA 3I3TA 3QSDA 2R9OA 3MORA 1MDWA 1THEA 2J7QC 1U5IA 3USVA 4BS5A 2VHSA 1AIMA 3F75A 3H89A 3O0UA 3P5UA 4I05A 3WXFA 2BU3A 3KKUA 1YK7A 4CDCB 4BSQA 2AVWA 2FT2A
chains in the Genus database with same CATH topology
2DC6A 3RVXA 4AXLA 1PCIA 1CQDA 1ME4A 1TL9A 4FJCA 3IHPA 3KFQA 1PBHA 1XKGA 4DMXA 2ATOA 1NB3A 1Y08A 1MHWA 2E01A 4Q8GA 2AUXA 3M99A 3IOQA 4YYRA 3QJ3A 2DZZA 1QMYA 4P6EA 4X6HA 4NV7A 1MEMA 1ITOA 4RY2A 3OVZA 1AU3A 2PREA 1F29A 1A6RA 4DMYA 2E00A 3U8EA 4AXMA 1MEGA 1YALA 1AECA 2R9MA 5A24A 1ZCMA 1NLJA 5CHTA 3KW9A 1MS6A 2OZ2A 1POPA 4BGFA 2WBFX 1PXVA 1SP4B 4MZOA 4N8WA 1CTEA 4YYQA 4HWYA 1VSNA 1BGOA 3E1ZB 2Y5BA 3IMAA 1AYVA 3MTNA 4N4ZA 1CPJA 3BPMA 3O1GA 1ICFA 2ARYA 1PADA 3H8BA 3KWBX 5CVNB 3V6CA 1EWOA 5K16A 3WXGA 1NQCA 1PIPA 1MIRA 4PP2E 4W4UA 2PBHA 3IV2A 2XU1A 3F5VA 3WXEA 2DCBA 2JQGR 2DJFB 2ACTA 4MZSA 2GHUA 1IWDA 3LFYA 3MHSA 4CDFB 3OISA 1YK8A 4BQVA 4QRVA 2VHFA 3P5VA 2OP3A 2G8EA 3NHEA 2G6DA 1K3BB 8PCHA 2BSZA 3KWZA 2YJ9A 4MSXA 3P5WA 4PI3A 6PADA 1AYUA 3OVXA 3DF0A 3D9WA 3CBJA 1TU6A 3BCNA 1W4TA 3V6EA 4C5PA 3K8UA 2FRAA 1EF7A 4B55A 3K9MA 1F2AA 1BQIA 2FRQA 1U9XA 1BY8A 1GX3A 2PADA 1SNKA 2IBIA 2F7DA 2AYOA 3IEJA 5CVMA 3KSEA 3H6SA 2DZYA 2HD5A 3CH3X 1CB5A 2GFOA 3RVWA 1QDQA 3RVVA 4OEMA 1DEUA 1TLOA 1F2BA 4BPVA 5FPWA 1BP4A 2DCDA 3HD3A 3BOWA 2VFCA 2HXZA 4PP1A 4X6JA 1HUCB 1PPPA 1X9YA 3HHAA 1YT7A 4PADA 2C0YA 3S3QA 3PNRA 4BS6A 1AU0A 4YYVA 2FYEA 2IPPB 5JH3A 3S3RA 5CHVA 1F2CA 1JQPA 2NQDB 2BDZA 1KXRA 2YJ8A 2G8JA 1PE6A 2AIMA 1S4VA 3ERVA 2HHNA 3KX1A 5J94A 4WA6A 3PDFA 1AU2A 4FK5A 5CVOB 4W5CA 1PPOA 2DC9A 2FTDA 3TNXA 3BWKA 2G7YA 4XUIA 2B1NA 5F02A 1NB5A 1CS8A 2R9CA 3OF9A 1CSBB 1EWMA 1KHPA 3C9EA 4X6IA 1GECE 3CBKA 3OF8A 1U9VA 5JA7A 3AI8A 2AU1A 2HH5A 2YJBA 1Q6KA 1NL6A 3LTWA 1CV8A 1GCBA 5PADA 4I07A 1ATKA 4QRXA 3H7DA 2AUZA 1W5RA 2YJ2A 3QT4A 2NQAA 2YJCA 4GUZA 5EGWA 4K7CA 2OULA 3N4CA 4QRGA 2NQIA 2P86A 2O6XA 1ZIVA 4YYSA 2PNSA 2XU5A 4CZWA 2FO5A 3N3GA 2XU4A 9PAPA 1FH0A 4FIPA 4QH6A 1EWPA 1YVBA 3HWNA 3K24A 3P5XA 4NV8A 1KFXL 2DC8A 2DC7A 4CDEB 2R9NA 1ME3A 4P6GA 2XU3A 3LXSA 3HHIA 4OELA 1AYWA 7PCKA 2JQFR 5EF4A 1GMYA 3BPFA 3PW3A 4YVAA 2FQ9A 3H8CA 2E03A 3B79A 4ZUXU 3MHHA 4KLBA 4W5BA 1O0EA 4YV8A 2VFBA 1GLOA 4YYWA 3IUTA 2P7UA 1EWLA 1Y4HA 2E02A 1CVZA 1M6DA 1U9QX 2B1MA 3I06A 4YYUA 1PPNA 2Y6EA 1QXPA 4QBBA 2F1GA 3PBHA 3D6SA 1E2TA 2DJGB 3N3KA 2BDLA 1VJVA 1KFUL 2R9FA 3BC3A 3GCBA 4I04A 1AU4A 3ZUAA 4G54A 4N79A 4CDDB 1PPDA 3CH2X 2DCAA 1KHQA 2AYNA 2DCCA 1U9WA 1DF0A 2AS8A 2CIOA 4Q8HA 1STFE 2FUDA 2R6NA 1QOLA 2NQGA 1CJLA 4XR7A 2CB5A 2P0RA 1NPZA 2H7JA 3I3TA 3QSDA 2R9OA 3MORA 1MDWA 1THEA 1W6FA 1U5IA 3USVA 4BS5A 2VHSA 1AIMA 3F75A 3H89A 3O0UA 3P5UA 4I05A 3WXFA 3KKUA 1YK7A 4CDCB 4BSQA 2AVWA 2FT2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DC6 A;  3RVX A;  4AXL A;  1PCI A;  1CQD A;  1ME4 A;  1TL9 A;  4FJC A;  3IHP A;  3KFQ A;  1PBH A;  1XKG A;  4DMX A;  2ATO A;  1NB3 A;  1Y08 A;  1MHW A;  2E01 A;  4Q8G A;  2AUX A;  3M99 A;  3IOQ A;  4YYR A;  3QJ3 A;  2DZZ A;  1QMY A;  4P6E A;  4X6H A;  1MEM A;  1ITO A;  4RY2 A;  3OVZ A;  1AU3 A;  2PRE A;  1F29 A;  1A6R A;  4DMY A;  2E00 A;  3U8E A;  4AXM A;  1MEG A;  1YAL A;  1AEC A;  2R9M A;  5A24 A;  1ZCM A;  1NLJ A;  5CHT A;  3KW9 A;  1MS6 A;  2OZ2 A;  1POP A;  2WBF X;  1PXV A;  1SP4 B;  4MZO A;  4N8W A;  1CTE A;  4YYQ A;  4HWY A;  1VSN A;  1BGO A;  3E1Z B;  2Y5B A;  3IMA A;  1AYV A;  3MTN A;  4N4Z A;  1CPJ A;  3BPM A;  3O1G A;  1ICF A;  2ARY A;  1PAD A;  3H8B A;  3KWB X;  5CVN B;  3V6C A;  1EWO A;  5K16 A;  3WXG A;  1NQC A;  1PIP A;  1MIR A;  4PP2 E;  4W4U A;  2PBH A;  3IV2 A;  2XU1 A;  3F5V A;  3WXE A;  2DCB A;  2JQG R;  2DJF B;  2ACT A;  4MZS A;  2GHU A;  1IWD A;  3LFY A;  3MHS A;  4CDF B;  3OIS A;  1YK8 A;  4BQV A;  4QRV A;  2VHF A;  3P5V A;  2OP3 A;  2G8E A;  3NHE A;  2G6D A;  1K3B B;  8PCH A;  3KWZ A;  2YJ9 A;  4MSX A;  3P5W A;  4PI3 A;  6PAD A;  1AYU A;  3OVX A;  3DF0 A;  3CBJ A;  1TU6 A;  3BCN A;  3V6E A;  3K8U A;  2FRA A;  1EF7 A;  3K9M A;  1F2A A;  1BQI A;  2FRQ A;  1U9X A;  1BY8 A;  2PAD A;  1SNK A;  2IBI A;  2F7D A;  2AYO A;  3IEJ A;  5CVM A;  3KSE A;  3H6S A;  2DZY A;  2HD5 A;  3CH3 X;  1CB5 A;  2GFO A;  3RVW A;  1QDQ A;  3RVV A;  4OEM A;  1DEU A;  1TLO A;  1F2B A;  4BPV A;  5FPW A;  1BP4 A;  2DCD A;  3HD3 A;  3BOW A;  2HXZ A;  4PP1 A;  4X6J A;  1HUC B;  1PPP A;  1X9Y A;  3HHA A;  1YT7 A;  4PAD A;  2C0Y A;  3S3Q A;  3PNR A;  4BS6 A;  1AU0 A;  4YYV A;  2FYE A;  2IPP B;  5JH3 A;  3S3R A;  5CHV A;  1F2C A;  1JQP A;  2NQD B;  2BDZ A;  1KXR A;  2YJ8 A;  2G8J A;  1PE6 A;  2AIM A;  1S4V A;  3ERV A;  2HHN A;  3KX1 A;  5J94 A;  4WA6 A;  3PDF A;  1AU2 A;  4FK5 A;  5CVO B;  4W5C A;  1PPO A;  2DC9 A;  2FTD A;  3TNX A;  3BWK A;  2G7Y A;  4XUI A;  2B1N A;  5F02 A;  1NB5 A;  1CS8 A;  2R9C A;  3OF9 A;  1CSB B;  1EWM A;  1KHP A;  3C9E A;  4X6I A;  1GEC E;  3CBK A;  3OF8 A;  1U9V A;  5JA7 A;  3AI8 A;  2AU1 A;  2HH5 A;  2YJB A;  1Q6K A;  1NL6 A;  1CV8 A;  1GCB A;  5PAD A;  4I07 A;  1ATK A;  4QRX A;  3H7D A;  2AUZ A;  2YJ2 A;  3QT4 A;  2NQA A;  2YJC A;  5EGW A;  4K7C A;  2OUL A;  3N4C A;  4QRG A;  2NQI A;  2P86 A;  2O6X A;  1ZIV A;  4YYS A;  2PNS A;  2XU5 A;  4CZW A;  2FO5 A;  3N3G A;  2XU4 A;  9PAP A;  1FH0 A;  4FIP A;  4QH6 A;  1EWP A;  1YVB A;  3HWN A;  3K24 A;  3P5X A;  1KFX L;  2DC8 A;  2DC7 A;  4CDE B;  2R9N A;  1ME3 A;  4P6G A;  2XU3 A;  3LXS A;  3HHI A;  4OEL A;  1AYW A;  7PCK A;  2JQF R;  5EF4 A;  1GMY A;  3BPF A;  3PW3 A;  4YVA A;  2FQ9 A;  3H8C A;  2E03 A;  3B79 A;  4ZUX U;  3MHH A;  4KLB A;  4W5B A;  1O0E A;  4YV8 A;  1GLO A;  4YYW A;  3IUT A;  2P7U A;  1EWL A;  1Y4H A;  2E02 A;  1CVZ A;  1M6D A;  1U9Q X;  2B1M A;  3I06 A;  4YYU A;  1PPN A;  2Y6E A;  1QXP A;  4QBB A;  2F1G A;  3PBH A;  3D6S A;  2DJG B;  3N3K A;  2BDL A;  1VJV A;  1KFU L;  2R9F A;  3BC3 A;  3GCB A;  4I04 A;  1AU4 A;  3ZUA A;  4G54 A;  4N79 A;  4CDD B;  1PPD A;  3CH2 X;  2DCA A;  1KHQ A;  2AYN A;  2DCC A;  1U9W A;  1DF0 A;  2AS8 A;  2CIO A;  4Q8H A;  1STF E;  2FUD A;  2R6N A;  1QOL A;  2NQG A;  1CJL A;  4XR7 A;  2CB5 A;  2P0R A;  1NPZ A;  2H7J A;  3I3T A;  3QSD A;  2R9O A;  3MOR A;  1MDW A;  1THE A;  1U5I A;  3USV A;  4BS5 A;  2VHS A;  1AIM A;  3F75 A;  3H89 A;  3O0U A;  3P5U A;  4I05 A;  3WXF A;  3KKU A;  1YK7 A;  4CDC B;  4BSQ A;  2AVW A;  2FT2 A; 
#chains in the Genus database with same CATH topology
 2DC6 A;  3RVX A;  4AXL A;  1PCI A;  4OVZ B;  1CQD A;  1ME4 A;  1TL9 A;  4FJC A;  3IHP A;  3KFQ A;  1PBH A;  2HWK A;  1XKG A;  3PHX A;  4DMX A;  2ATO A;  1NB3 A;  4ZTB A;  1Y08 A;  1MHW A;  2E01 A;  4Q8G A;  2AUX A;  3M99 A;  5EZQ A;  4R3D A;  3IOQ A;  4YYR A;  3QJ3 A;  2DZZ A;  1QMY A;  4P6E A;  4RKX A;  4X6H A;  1MEM A;  1ITO A;  4RY2 A;  3OVZ A;  1AU3 A;  2PRE A;  1F29 A;  1A6R A;  4DMY A;  2E00 A;  3U8E A;  3PRM A;  4AXM A;  2JTC A;  1MEG A;  1YAL A;  1AEC A;  2R9M A;  5A24 A;  4RF0 A;  1ZCM A;  2FE8 A;  1NLJ A;  3OQC A;  5CHT A;  3KW9 A;  1MS6 A;  2OZ2 A;  1POP A;  2WBF X;  1PXV A;  1SP4 B;  4MZO A;  4N8W A;  1CTE A;  1YZB A;  4YYQ A;  4HWY A;  1VSN A;  1BGO A;  3PRP A;  3E1Z B;  3C0R A;  2Y5B A;  3IMA A;  1AYV A;  3MTN A;  4N4Z A;  1CPJ A;  3BPM A;  3O1G A;  2BTW B;  1ICF A;  2ARY A;  1PAD A;  3H8B A;  3KWB X;  5CVN B;  3V6C A;  1EWO A;  5K16 A;  4HXD B;  3WXG A;  1NQC A;  1PIP A;  1MIR A;  4PP2 E;  3BB7 A;  4W4U A;  2PBH A;  3IV2 A;  4OW0 A;  2XU1 A;  3F5V A;  3WXE A;  2DCB A;  2JQG R;  2DJF B;  4D8I A;  2ACT A;  4MZS A;  2GHU A;  1IWD A;  3LFY A;  1PVJ A;  3MHS A;  4CDF B;  3MP2 A;  3OIS A;  1YK8 A;  2J7Q A;  4BQV A;  4QRV A;  2VHF A;  3P5V A;  3BY4 A;  2OP3 A;  2G8E A;  3NHE A;  2G6D A;  1K3B B;  8PCH A;  3KWZ A;  2YJ9 A;  4MM3 B;  3PHW A;  4MSX A;  3P5W A;  4PI3 A;  6PAD A;  1AYU A;  3OVX A;  3DF0 A;  1DKI A;  3CBJ A;  1TU6 A;  3BCN A;  3V6E A;  3K8U A;  2FRA A;  1EF7 A;  3K9M A;  1F2A A;  5KO3 A;  1BQI A;  2FRQ A;  1U9X A;  1BY8 A;  2PAD A;  1SNK A;  2IBI A;  2F7D A;  2AYO A;  3IEJ A;  5CVM A;  3KSE A;  3TMP A;  2DOS A;  3H6S A;  4REZ A;  4IUM A;  2DZY A;  2HD5 A;  3PHU A;  3CH3 X;  1CB5 A;  4BOQ A;  2GFO A;  4D8B A;  4OVZ A;  3RVW A;  1QDQ A;  3RVV A;  4OEM A;  1DEU A;  1TLO A;  1F2B A;  3W30 A;  4P16 A;  4BPV A;  5FPW A;  1BP4 A;  2DCD A;  3HD3 A;  3BOW A;  4XZX A;  2HXZ A;  4PP1 A;  4PT5 A;  4X6J A;  1HUC B;  1PPP A;  3W31 A;  1X9Y A;  3HHA A;  4M0W A;  1YT7 A;  4PAD A;  2C0Y A;  3S3Q A;  3PNR A;  4RF1 A;  4BS6 A;  1AU0 A;  4WUR A;  4YYV A;  3PT2 A;  4A5U A;  2FYE A;  2IPP B;  5JH3 A;  3S3R A;  5CHV A;  1F2C A;  1JQP A;  2NQD B;  2BDZ A;  1KXR A;  2YJ8 A;  2G8J A;  1PE6 A;  2AIM A;  1S4V A;  3ERV A;  2HHN A;  3KX1 A;  5J94 A;  4WA6 A;  3PDF A;  1AU2 A;  4FK5 A;  4BOP A;  3MJ5 A;  5CVO B;  4W5C A;  1PPO A;  2DC9 A;  4BOS A;  2FTD A;  3TNX A;  3BWK A;  2G7Y A;  4XUI A;  2JRI A;  2B1N A;  5F02 A;  1NB5 A;  1CS8 A;  2UZJ A;  2R9C A;  3OF9 A;  3E9S A;  5E6J A;  1CSB B;  1EWM A;  1KHP A;  3C9E A;  4X6I A;  1GEC E;  3CBK A;  3OF8 A;  1U9V A;  5JA7 A;  3AI8 A;  2AU1 A;  3MTV A;  2BTW A;  2HH5 A;  2YJB A;  3B21 A;  5JZE A;  1Q6K A;  1NL6 A;  4BOZ A;  1CV8 A;  1GCB A;  5PAD A;  4I07 A;  4MI7 A;  1ATK A;  4QRX A;  4BOU A;  3H7D A;  2AGA A;  2AUZ A;  2YJ2 A;  5EZS A;  3QT4 A;  4GUA A;  2NQA A;  2YJC A;  5EGW A;  4K7C A;  2OUL A;  3N4C A;  4QRG A;  2NQI A;  2P86 A;  2O6X A;  1ZIV A;  3ZNH A;  4YYS A;  2PNS A;  2XU5 A;  4CZW A;  3O65 A;  2FO5 A;  3N3G A;  2XU4 A;  9PAP A;  1FH0 A;  4FIP A;  4QH6 A;  1EWP A;  1YVB A;  4IP3 A;  3HWN A;  3K24 A;  3P5X A;  1KFX L;  2DC8 A;  2DC7 A;  4CDE B;  2R9N A;  1ME3 A;  4P6G A;  2XU3 A;  3LXS A;  3HHI A;  4OEL A;  1AYW A;  7PCK A;  2JQF R;  5EF4 A;  1GMY A;  3BBA A;  3BPF A;  3PW3 A;  4YVA A;  3RNV A;  2FQ9 A;  3H8C A;  2E03 A;  3B79 A;  4ZUX U;  3MHH A;  4KLB A;  4W5B A;  1O0E A;  4YV8 A;  1GLO A;  3IFU A;  4YYW A;  3IUT A;  2P7U A;  1EWL A;  1Y4H A;  2E02 A;  1CVZ A;  1M6D A;  1U9Q X;  2Z84 A;  2B1M A;  3I06 A;  4YYU A;  1PPN A;  2Y6E A;  1QXP A;  1UKF A;  4QBB A;  2F1G A;  3PBH A;  3D6S A;  2DJG B;  3N3K A;  2BDL A;  4D8E A;  1VJV A;  1KFU L;  2R9F A;  3BC3 A;  3GCB A;  4I04 A;  1AU4 A;  4RNA A;  3ZUA A;  4G54 A;  4N79 A;  4CDD B;  1PPD A;  3CH2 X;  2DCA A;  1KHQ A;  2AYN A;  2DCC A;  1U9W A;  1DF0 A;  2AS8 A;  2CIO A;  4Q8H A;  1STF E;  2FUD A;  2R6N A;  3PSE A;  1QOL A;  2NQG A;  1CJL A;  4XR7 A;  2CB5 A;  2P0R A;  1NPZ A;  3TRK A;  2H7J A;  3I3T A;  3QSD A;  2R9O A;  3MOR A;  1MDW A;  1THE A;  2J7Q C;  1U5I A;  3USV A;  4BS5 A;  2VHS A;  1AIM A;  3F75 A;  3H89 A;  3O0U A;  3P5U A;  4I05 A;  3WXF A;  2BU3 A;  3KKU A;  1YK7 A;  4CDC B;  4BSQ A;  2AVW A;  2FT2 A; 
#chains in the Genus database with same CATH homology
 2DC6 A;  3RVX A;  4AXL A;  1PCI A;  1CQD A;  1ME4 A;  1TL9 A;  4FJC A;  3IHP A;  3KFQ A;  1PBH A;  1XKG A;  4DMX A;  2ATO A;  1NB3 A;  1Y08 A;  1MHW A;  2E01 A;  4Q8G A;  2AUX A;  3M99 A;  3IOQ A;  4YYR A;  3QJ3 A;  2DZZ A;  1QMY A;  4P6E A;  4X6H A;  4NV7 A;  1MEM A;  1ITO A;  4RY2 A;  3OVZ A;  1AU3 A;  2PRE A;  1F29 A;  1A6R A;  4DMY A;  2E00 A;  3U8E A;  4AXM A;  1MEG A;  1YAL A;  1AEC A;  2R9M A;  5A24 A;  1ZCM A;  1NLJ A;  5CHT A;  3KW9 A;  1MS6 A;  2OZ2 A;  1POP A;  4BGF A;  2WBF X;  1PXV A;  1SP4 B;  4MZO A;  4N8W A;  1CTE A;  4YYQ A;  4HWY A;  1VSN A;  1BGO A;  3E1Z B;  2Y5B A;  3IMA A;  1AYV A;  3MTN A;  4N4Z A;  1CPJ A;  3BPM A;  3O1G A;  1ICF A;  2ARY A;  1PAD A;  3H8B A;  3KWB X;  5CVN B;  3V6C A;  1EWO A;  5K16 A;  3WXG A;  1NQC A;  1PIP A;  1MIR A;  4PP2 E;  4W4U A;  2PBH A;  3IV2 A;  2XU1 A;  3F5V A;  3WXE A;  2DCB A;  2JQG R;  2DJF B;  2ACT A;  4MZS A;  2GHU A;  1IWD A;  3LFY A;  3MHS A;  4CDF B;  3OIS A;  1YK8 A;  4BQV A;  4QRV A;  2VHF A;  3P5V A;  2OP3 A;  2G8E A;  3NHE A;  2G6D A;  1K3B B;  8PCH A;  2BSZ A;  3KWZ A;  2YJ9 A;  4MSX A;  3P5W A;  4PI3 A;  6PAD A;  1AYU A;  3OVX A;  3DF0 A;  3D9W A;  3CBJ A;  1TU6 A;  3BCN A;  1W4T A;  3V6E A;  4C5P A;  3K8U A;  2FRA A;  1EF7 A;  4B55 A;  3K9M A;  1F2A A;  1BQI A;  2FRQ A;  1U9X A;  1BY8 A;  1GX3 A;  2PAD A;  1SNK A;  2IBI A;  2F7D A;  2AYO A;  3IEJ A;  5CVM A;  3KSE A;  3H6S A;  2DZY A;  2HD5 A;  3CH3 X;  1CB5 A;  2GFO A;  3RVW A;  1QDQ A;  3RVV A;  4OEM A;  1DEU A;  1TLO A;  1F2B A;  4BPV A;  5FPW A;  1BP4 A;  2DCD A;  3HD3 A;  3BOW A;  2VFC A;  2HXZ A;  4PP1 A;  4X6J A;  1HUC B;  1PPP A;  1X9Y A;  3HHA A;  1YT7 A;  4PAD A;  2C0Y A;  3S3Q A;  3PNR A;  4BS6 A;  1AU0 A;  4YYV A;  2FYE A;  2IPP B;  5JH3 A;  3S3R A;  5CHV A;  1F2C A;  1JQP A;  2NQD B;  2BDZ A;  1KXR A;  2YJ8 A;  2G8J A;  1PE6 A;  2AIM A;  1S4V A;  3ERV A;  2HHN A;  3KX1 A;  5J94 A;  4WA6 A;  3PDF A;  1AU2 A;  4FK5 A;  5CVO B;  4W5C A;  1PPO A;  2DC9 A;  2FTD A;  3TNX A;  3BWK A;  2G7Y A;  4XUI A;  2B1N A;  5F02 A;  1NB5 A;  1CS8 A;  2R9C A;  3OF9 A;  1CSB B;  1EWM A;  1KHP A;  3C9E A;  4X6I A;  1GEC E;  3CBK A;  3OF8 A;  1U9V A;  5JA7 A;  3AI8 A;  2AU1 A;  2HH5 A;  2YJB A;  1Q6K A;  1NL6 A;  3LTW A;  1CV8 A;  1GCB A;  5PAD A;  4I07 A;  1ATK A;  4QRX A;  3H7D A;  2AUZ A;  1W5R A;  2YJ2 A;  3QT4 A;  2NQA A;  2YJC A;  4GUZ A;  5EGW A;  4K7C A;  2OUL A;  3N4C A;  4QRG A;  2NQI A;  2P86 A;  2O6X A;  1ZIV A;  4YYS A;  2PNS A;  2XU5 A;  4CZW A;  2FO5 A;  3N3G A;  2XU4 A;  9PAP A;  1FH0 A;  4FIP A;  4QH6 A;  1EWP A;  1YVB A;  3HWN A;  3K24 A;  3P5X A;  4NV8 A;  1KFX L;  2DC8 A;  2DC7 A;  4CDE B;  2R9N A;  1ME3 A;  4P6G A;  2XU3 A;  3LXS A;  3HHI A;  4OEL A;  1AYW A;  7PCK A;  2JQF R;  5EF4 A;  1GMY A;  3BPF A;  3PW3 A;  4YVA A;  2FQ9 A;  3H8C A;  2E03 A;  3B79 A;  4ZUX U;  3MHH A;  4KLB A;  4W5B A;  1O0E A;  4YV8 A;  2VFB A;  1GLO A;  4YYW A;  3IUT A;  2P7U A;  1EWL A;  1Y4H A;  2E02 A;  1CVZ A;  1M6D A;  1U9Q X;  2B1M A;  3I06 A;  4YYU A;  1PPN A;  2Y6E A;  1QXP A;  4QBB A;  2F1G A;  3PBH A;  3D6S A;  1E2T A;  2DJG B;  3N3K A;  2BDL A;  1VJV A;  1KFU L;  2R9F A;  3BC3 A;  3GCB A;  4I04 A;  1AU4 A;  3ZUA A;  4G54 A;  4N79 A;  4CDD B;  1PPD A;  3CH2 X;  2DCA A;  1KHQ A;  2AYN A;  2DCC A;  1U9W A;  1DF0 A;  2AS8 A;  2CIO A;  4Q8H A;  1STF E;  2FUD A;  2R6N A;  1QOL A;  2NQG A;  1CJL A;  4XR7 A;  2CB5 A;  2P0R A;  1NPZ A;  2H7J A;  3I3T A;  3QSD A;  2R9O A;  3MOR A;  1MDW A;  1THE A;  1W6F A;  1U5I A;  3USV A;  4BS5 A;  2VHS A;  1AIM A;  3F75 A;  3H89 A;  3O0U A;  3P5U A;  4I05 A;  3WXF A;  3KKU A;  1YK7 A;  4CDC B;  4BSQ A;  2AVW A;  2FT2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...