3WXFA

Crystal structure of cyld usp domain (c596s e674q) in complex with met1-linked diubiquitin
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
310
structure length
299
Chain Sequence
MGLEVMVGKKKGIQGHYNSSYLDSTLFCLFSFSSVLDTVLLRPRSKTDVEYYKETQELLRTEIVNPLRIHGYVCATKIMKLRRILEKVEAASGFTSEQKDPEEFLNILFHHILRVDPLLRLRSAGQKVQDCYFYQIFMDKVMVPTSQQLLEWSFINSDLKFAEAPSCLIIQMPRFGKDFKMFNKIFPSLELDITDLLDDQQMELFAVLCIETSHYVAFVKYGSADSAWLFFDSMADRDGGQNGFNIPQVSRCPEVGEYLKMTPEELHALDPKNIQGYARRLLCDAYMCMYQSPTMSLYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase/protein binding
molecule keywords Uncharacterized protein
publication title Structures of CYLD USP with Met1- or Lys63-linked diubiquitin reveal mechanisms for dual specificity
doi rcsb
source organism Danio rerio
total genus 93
structure length 299
sequence length 310
chains with identical sequence C
ec nomenclature
pdb deposition date 2014-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00443 UCH Ubiquitin carboxyl-terminal hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3wxfA00
1ITOA 4N4ZA 4P6GA 3V6CA 3HHAA 3WXGA 5CHVA 4AXMA 2XU3A 1KXRA 3BPFA 1BQIA 4I05A 4XR7A 1ZCMA 1AU0A 1SP4B 4YYWA 4XUIA 1U9XA 1YVBA 5EF4A 1EWOA 1U9VA 3HD3A 4K7CA 2HH5A 3BWKA 2AYOA 4WA6A 1QDQA 1MEGA 2DCAA 2DZYA 3F5VA 1MEMA 1IWDA 2HHNA 1NLJA 4Q8HA 2G6DA 3OISA 2DZZA 3K9MA 1CPJA 1DEUA 4YV8A 2R6NA 1Y08A 1AU2A 3F75A 4X6HA 2VHSA 2OULA 7PCKA 3IHPA 5F02A 1KFXL 1GECE 4CDDB 1EWLA 3OVXA 3WXFA 1CJLA 2G7YA 3CBJA 3IUTA 1F2BA 1PXVA 3N3KA 3IEJA 2DC8A 1EWPA 1ME3A 1VJVA 2FRAA 1EF7A 3IV2A 3RVXA 4FK5A 4N8WA 1PIPA 1GCBA 6PADA 4BS5A 2CB5A 4FIPA 4MZOA 2DCDA 3MTNA 3GCBA 3LXSA 2VHFA 1CS8A 1TL9A 2DCCA 3PNRA 2G8JA 1DF0A 1BP4A 1X9YA 1MIRA 1STFE 4P6EA 1U5IA 2YJ2A 4AXLA 1Y4HA 3HWNA 4X6JA 2AUXA 1YALA 3BCNA 2O6XA 1U9QX 1CB5A 4PP1A 5JA7A 3OF9A 1PPPA 2R9CA 3E1ZB 4BPVA 2FTDA 2YJ8A 2E01A 2YJBA 2R9NA 1PPDA 2HXZA 1O0EA 1PPOA 1BY8A 2R9OA 5K16A 1F2CA 3DF0A 1U9WA 3ZUAA 1KFUL 2AYNA 2JQGR 4W5CA 4ZUXU 2AU1A 4BS6A 1QXPA 2DC7A 3V6EA 4I07A 3U8EA 1AIMA 4QH6A 1HUCB 1XKGA 3KFQA 3MORA 3HHIA 2H7JA 1CVZA 3PBHA 2CIOA 3C9EA 1NQCA 3KWZA 3B79A 4CZWA 2R9MA 3ERVA 1AYVA 1ATKA 2NQIA 1VSNA 5FPWA 2ATOA 4CDCB 2E00A 3IMAA 3N3GA 1TU6A 2FO5A 2FYEA 3K24A 4W5BA 2Y5BA 5EGWA 3RVWA 5CVMA 1POPA 2GFOA 2P0RA 2DJFB 2FUDA 2WBFX 3CH3X 4MSXA 3I06A 4QRGA 2F7DA 4DMXA 2AUZA 2JQFR 1NB3A 2P7UA 1AYWA 1S4VA 2FT2A 1F29A 4YVAA 2E03A 1THEA 2DC6A 1MDWA 3USVA 2YJ9A 3LFYA 3BOWA 4QRVA 2B1NA 5CVOB 4YYRA 9PAPA 2FRQA 1CV8A 3OF8A 2NQDB 4I04A 4DMYA 2YJCA 3H8CA 3MHSA 2FQ9A 2ACTA 1AU4A 3QSDA 4FJCA 2ARYA 2B1MA 3RVVA 3MHHA 4PI3A 1K3BB 1SNKA 1PBHA 1M6DA 1AYUA 2E02A 2HD5A 3KWBX 1ME4A 2AIMA 3P5XA 3H8BA 3H7DA 8PCHA 2OZ2A 4MZSA 4Q8GA 3KSEA 1PE6A 1KHQA 4YYUA 5CHTA 1PCIA 3M99A 3S3RA 4HWYA 1JQPA 2NQAA 4YYVA 2IBIA 2G8EA 2OP3A 3QT4A 3O1GA 1PADA 1CQDA 1MS6A 2PADA 1EWMA 2XU5A 5PADA 2BDZA 4CDFB 1MHWA 1TLOA 1GMYA 2IPPB 2P86A 4RY2A 4W4UA 3AI8A 3N4CA 3NHEA 1QOLA 1YT7A 4PADA 4BQVA 3BPMA 4OELA 1YK7A 1A6RA 1NL6A 3QJ3A 2AVWA 1AECA 2XU1A 2C0YA 4N79A 1BGOA 3P5UA 3KW9A 2GHUA 4X6IA 3S3QA 4G54A 4YYSA 5A24A 3TNXA 2F1GA 5JH3A 1GLOA 3PW3A 4YYQA 3PDFA 2NQGA 3CH2X 1AU3A 2PNSA 1F2AA 2R9FA 3KKUA 2Y6EA 3D6SA 1CTEA 1ZIVA 3H89A 1ICFA 5J94A 1CSBB 2BDLA 4BSQA 1YK8A 3WXEA 1NPZA 4OEMA 4QRXA 4CDEB 3K8UA 3KX1A 2DCBA 3OVZA 4PP2E 3O0UA 1FH0A 3BC3A 3P5WA 1KHPA 3I3TA 4QBBA 1QMYA 3CBKA 3IOQA 3P5VA 2PBHA 2DJGB 3H6SA 2XU4A 1Q6KA 1PPNA 4KLBA 2AS8A 2PREA 1NB5A 5CVNB 2DC9A
chains in the Genus database with same CATH superfamily
1ITOA 4M0WA 4N4ZA 4P6GA 3V6CA 3HHAA 3MTVA 3WXGA 4D8EA 5CHVA 4AXMA 2XU3A 1KXRA 3BPFA 1BQIA 4I05A 4XR7A 1ZCMA 1AU0A 3PHWA 1SP4B 4YYWA 4XUIA 1U9XA 1YVBA 5EF4A 1EWOA 1U9VA 2FE8A 3HD3A 4K7CA 2HH5A 3BWKA 2AYOA 4WA6A 4XZXA 1QDQA 1MEGA 2DCAA 2DZYA 1PVJA 3F5VA 4BOZA 1MEMA 1IWDA 2HHNA 1NLJA 4Q8HA 2G6DA 3BB7A 3OISA 2DZZA 4IP3A 3K9MA 1CPJA 1DEUA 4BOPA 4YV8A 3PHXA 2R6NA 4A5UA 1Y08A 1AU2A 3F75A 4X6HA 2VHSA 2BTWA 4D8BA 2OULA 7PCKA 3IHPA 5F02A 1KFXL 1GECE 4CDDB 3E9SA 1EWLA 3OVXA 3WXFA 1CJLA 3MJ5A 2G7YA 3TMPA 3CBJA 4OW0A 3IUTA 1F2BA 1PXVA 4HXDB 3N3KA 3IEJA 2DC8A 1EWPA 1ME3A 1VJVA 2FRAA 3ZNHA 1EF7A 3IV2A 4OVZB 3RVXA 4FK5A 3W31A 4N8WA 1PIPA 1GCBA 6PADA 4BS5A 2CB5A 4FIPA 4MZOA 2DCDA 3MTNA 3GCBA 4MM3B 3TRKA 4BOSA 3PSEA 4RNAA 3LXSA 2VHFA 1CS8A 1TL9A 2DCCA 3PNRA 2G8JA 1DF0A 3OQCA 1BP4A 5EZQA 1X9YA 2BU3A 4D8IA 1MIRA 2BTWB 1STFE 4R3DA 4P6EA 1U5IA 2YJ2A 4AXLA 1Y4HA 3RNVA 3HWNA 4X6JA 4RF1A 2AUXA 1YALA 3BCNA 2O6XA 1U9QX 1CB5A 2JTCA 4PP1A 5JA7A 3OF9A 1PPPA 2R9CA 3E1ZB 3PRMA 3PHUA 4BPVA 2FTDA 2YJ8A 2E01A 2YJBA 1YZBA 4ZTBA 2R9NA 1PPDA 4MI7A 2HXZA 2HWKA 1O0EA 1DKIA 1PPOA 1BY8A 4P16A 2R9OA 5K16A 1F2CA 3DF0A 1U9WA 3ZUAA 1KFUL 2AYNA 4REZA 2JQGR 4W5CA 4ZUXU 2AU1A 4BS6A 1QXPA 2DC7A 4OVZA 3V6EA 4I07A 3U8EA 1AIMA 4QH6A 1HUCB 1XKGA 3KFQA 3MORA 3HHIA 2H7JA 1CVZA 3PBHA 2CIOA 3C9EA 1NQCA 3KWZA 3B79A 4CZWA 2R9MA 3ERVA 1AYVA 1ATKA 2NQIA 5EZSA 1VSNA 5FPWA 2ATOA 4PT5A 4CDCB 2E00A 3IMAA 3N3GA 1TU6A 2FO5A 2FYEA 3K24A 4W5BA 2Y5BA 5EGWA 3RVWA 3BY4A 1POPA 5CVMA 2UZJA 3PRPA 2GFOA 2P0RA 1UKFA 2DJFB 2FUDA 2WBFX 3CH3X 4MSXA 3I06A 4QRGA 2F7DA 4DMXA 2AUZA 2JQFR 2J7QC 1NB3A 2P7UA 1AYWA 1S4VA 2FT2A 1F29A 4YVAA 2E03A 1THEA 2DC6A 1MDWA 3USVA 2YJ9A 3LFYA 3BOWA 4QRVA 2B1NA 5CVOB 4YYRA 9PAPA 2FRQA 3O65A 1CV8A 3OF8A 2NQDB 4I04A 4DMYA 2YJCA 3H8CA 3MHSA 2FQ9A 2ACTA 1AU4A 3QSDA 4FJCA 2ARYA 2B1MA 3RVVA 3MHHA 4PI3A 1K3BB 2DOSA 1SNKA 1PBHA 1M6DA 1AYUA 2E02A 2HD5A 3KWBX 1ME4A 2AIMA 3P5XA 3H8BA 3H7DA 8PCHA 2OZ2A 4MZSA 4Q8GA 3KSEA 1PE6A 1KHQA 4YYUA 5CHTA 1PCIA 3M99A 3S3RA 2JRIA 4HWYA 1JQPA 2NQAA 4YYVA 2IBIA 2G8EA 2OP3A 3QT4A 3O1GA 1PADA 1CQDA 1MS6A 2PADA 1EWMA 2XU5A 5PADA 2BDZA 4CDFB 1MHWA 3C0RA 1TLOA 1GMYA 2IPPB 2P86A 3BBAA 4RY2A 3AI8A 3N4CA 4W4UA 3NHEA 1QOLA 1YT7A 4PADA 4BQVA 3BPMA 4OELA 1YK7A 1A6RA 1NL6A 3QJ3A 2AVWA 1AECA 2XU1A 2C0YA 4N79A 1BGOA 3P5UA 3KW9A 2GHUA 4X6IA 3S3QA 4G54A 4YYSA 2Z84A 5A24A 3PT2A 3TNXA 2F1GA 5JH3A 1GLOA 4GUAA 3PW3A 4YYQA 3PDFA 2NQGA 3CH2X 4BOUA 1AU3A 2PNSA 4RKXA 1F2AA 2R9FA 3KKUA 4WURA 2Y6EA 3D6SA 1CTEA 1ZIVA 3H89A 1ICFA 5KO3A 5J94A 1CSBB 2BDLA 4BSQA 1YK8A 3WXEA 1NPZA 4OEMA 4QRXA 4CDEB 3K8UA 3KX1A 2DCBA 3OVZA 4PP2E 3O0UA 4RF0A 1FH0A 4BOQA 3BC3A 3P5WA 1KHPA 3I3TA 3W30A 4QBBA 1QMYA 2AGAA 2J7QA 3CBKA 3IOQA 5JZEA 3P5VA 2PBHA 3B21A 2DJGB 3H6SA 3MP2A 2XU4A 1Q6KA 4IUMA 5E6JA 1PPNA 4KLBA 2AS8A 3IFUA 2PREA 1NB5A 5CVNB 2DC9A
chains in the Genus database with same CATH topology
1ITOA 4N4ZA 4P6GA 3V6CA 3HHAA 3WXGA 5CHVA 4AXMA 2XU3A 1KXRA 3BPFA 1BQIA 4I05A 4XR7A 1ZCMA 4NV7A 1AU0A 1W5RA 1SP4B 4YYWA 4XUIA 1U9XA 1E2TA 1YVBA 5EF4A 1EWOA 4GUZA 1U9VA 3HD3A 4K7CA 2HH5A 3BWKA 2AYOA 4WA6A 1QDQA 1MEGA 2DCAA 2DZYA 3F5VA 1MEMA 1IWDA 2HHNA 1NLJA 4Q8HA 2G6DA 3OISA 2DZZA 3K9MA 1CPJA 1DEUA 4YV8A 2R6NA 1Y08A 1AU2A 3F75A 1W4TA 4X6HA 3D9WA 2VHSA 2OULA 7PCKA 2VFCA 3IHPA 5F02A 1KFXL 1GECE 4CDDB 1EWLA 3OVXA 3WXFA 1CJLA 2G7YA 3CBJA 3IUTA 1F2BA 1PXVA 3N3KA 3IEJA 2DC8A 1EWPA 1ME3A 1VJVA 2FRAA 1EF7A 3IV2A 3RVXA 4FK5A 4N8WA 1PIPA 1GCBA 6PADA 4BS5A 2CB5A 4FIPA 4MZOA 2DCDA 3MTNA 3GCBA 3LXSA 2VHFA 1CS8A 1TL9A 2DCCA 3PNRA 2G8JA 1DF0A 1BP4A 1X9YA 1MIRA 1STFE 4P6EA 1U5IA 2YJ2A 4AXLA 1Y4HA 3HWNA 4X6JA 2AUXA 1YALA 3BCNA 2O6XA 1U9QX 1CB5A 4PP1A 5JA7A 3OF9A 1PPPA 2R9CA 3E1ZB 4BPVA 2FTDA 2YJ8A 2E01A 2YJBA 2R9NA 1PPDA 2HXZA 1O0EA 1PPOA 1BY8A 2R9OA 5K16A 1F2CA 3DF0A 1U9WA 3ZUAA 1KFUL 2AYNA 2JQGR 4W5CA 4ZUXU 2AU1A 4BS6A 1QXPA 2DC7A 3V6EA 4I07A 3U8EA 1AIMA 4QH6A 1HUCB 1XKGA 3KFQA 3MORA 3HHIA 2H7JA 1CVZA 3PBHA 2VFBA 2CIOA 3C9EA 1NQCA 3KWZA 3B79A 4CZWA 2R9MA 3ERVA 1AYVA 1ATKA 2NQIA 1VSNA 5FPWA 2ATOA 4CDCB 2E00A 3IMAA 3N3GA 1TU6A 2FO5A 2FYEA 3K24A 4W5BA 2Y5BA 5EGWA 3RVWA 5CVMA 1POPA 2GFOA 2P0RA 2DJFB 2FUDA 2WBFX 3CH3X 4MSXA 3I06A 4QRGA 2F7DA 4DMXA 2AUZA 2JQFR 1NB3A 2P7UA 1AYWA 1S4VA 2FT2A 1F29A 4YVAA 2E03A 1THEA 2DC6A 1MDWA 3USVA 2YJ9A 3LFYA 3BOWA 4QRVA 2B1NA 4B55A 5CVOB 4YYRA 9PAPA 2FRQA 1CV8A 3OF8A 2NQDB 4I04A 4BGFA 4DMYA 2YJCA 3H8CA 3MHSA 2FQ9A 2ACTA 1AU4A 3QSDA 4FJCA 2ARYA 2B1MA 3RVVA 3MHHA 4PI3A 4C5PA 1K3BB 1SNKA 1PBHA 1M6DA 1AYUA 2E02A 2HD5A 3KWBX 1ME4A 2AIMA 3P5XA 3H8BA 3H7DA 8PCHA 2OZ2A 4MZSA 4Q8GA 3KSEA 1PE6A 1KHQA 4YYUA 5CHTA 1PCIA 3M99A 3S3RA 4HWYA 1JQPA 2NQAA 4YYVA 2IBIA 2G8EA 2OP3A 3QT4A 3O1GA 1PADA 1CQDA 1MS6A 2PADA 1EWMA 3LTWA 2XU5A 5PADA 2BDZA 4CDFB 1MHWA 1TLOA 1GMYA 2IPPB 2P86A 4RY2A 4W4UA 3AI8A 3N4CA 3NHEA 1QOLA 1YT7A 4PADA 4BQVA 3BPMA 4OELA 1YK7A 1A6RA 1NL6A 3QJ3A 2AVWA 1AECA 2XU1A 2C0YA 4N79A 1BGOA 3P5UA 3KW9A 2GHUA 4X6IA 3S3QA 4G54A 4YYSA 5A24A 3TNXA 2F1GA 5JH3A 1GX3A 1GLOA 3PW3A 4YYQA 3PDFA 2NQGA 3CH2X 1AU3A 2PNSA 1F2AA 2R9FA 3KKUA 1W6FA 2Y6EA 3D6SA 1CTEA 1ZIVA 3H89A 1ICFA 5J94A 1CSBB 2BDLA 4BSQA 1YK8A 3WXEA 1NPZA 4OEMA 4QRXA 4CDEB 2BSZA 3K8UA 3KX1A 2DCBA 3OVZA 4PP2E 3O0UA 1FH0A 3BC3A 3P5WA 1KHPA 3I3TA 4NV8A 4QBBA 1QMYA 3CBKA 3IOQA 3P5VA 2PBHA 2DJGB 3H6SA 2XU4A 1Q6KA 1PPNA 4KLBA 2AS8A 2PREA 1NB5A 5CVNB 2DC9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ITO A;  4N4Z A;  4P6G A;  3V6C A;  3HHA A;  3WXG A;  5CHV A;  4AXM A;  2XU3 A;  1KXR A;  3BPF A;  1BQI A;  4I05 A;  4XR7 A;  1ZCM A;  1AU0 A;  1SP4 B;  4YYW A;  4XUI A;  1U9X A;  1YVB A;  5EF4 A;  1EWO A;  1U9V A;  3HD3 A;  4K7C A;  2HH5 A;  3BWK A;  2AYO A;  4WA6 A;  1QDQ A;  1MEG A;  2DCA A;  2DZY A;  3F5V A;  1MEM A;  1IWD A;  2HHN A;  1NLJ A;  4Q8H A;  2G6D A;  3OIS A;  2DZZ A;  3K9M A;  1CPJ A;  1DEU A;  4YV8 A;  2R6N A;  1Y08 A;  1AU2 A;  3F75 A;  4X6H A;  2VHS A;  2OUL A;  7PCK A;  3IHP A;  5F02 A;  1KFX L;  1GEC E;  4CDD B;  1EWL A;  3OVX A;  3WXF A;  1CJL A;  2G7Y A;  3CBJ A;  3IUT A;  1F2B A;  1PXV A;  3N3K A;  3IEJ A;  2DC8 A;  1EWP A;  1ME3 A;  1VJV A;  2FRA A;  1EF7 A;  3IV2 A;  3RVX A;  4FK5 A;  4N8W A;  1PIP A;  1GCB A;  6PAD A;  4BS5 A;  2CB5 A;  4FIP A;  4MZO A;  2DCD A;  3MTN A;  3GCB A;  3LXS A;  2VHF A;  1CS8 A;  1TL9 A;  2DCC A;  3PNR A;  2G8J A;  1DF0 A;  1BP4 A;  1X9Y A;  1MIR A;  1STF E;  4P6E A;  1U5I A;  2YJ2 A;  4AXL A;  1Y4H A;  3HWN A;  4X6J A;  2AUX A;  1YAL A;  3BCN A;  2O6X A;  1U9Q X;  1CB5 A;  4PP1 A;  5JA7 A;  3OF9 A;  1PPP A;  2R9C A;  3E1Z B;  4BPV A;  2FTD A;  2YJ8 A;  2E01 A;  2YJB A;  2R9N A;  1PPD A;  2HXZ A;  1O0E A;  1PPO A;  1BY8 A;  2R9O A;  5K16 A;  1F2C A;  3DF0 A;  1U9W A;  3ZUA A;  1KFU L;  2AYN A;  2JQG R;  4W5C A;  4ZUX U;  2AU1 A;  4BS6 A;  1QXP A;  2DC7 A;  3V6E A;  4I07 A;  3U8E A;  1AIM A;  4QH6 A;  1HUC B;  1XKG A;  3KFQ A;  3MOR A;  3HHI A;  2H7J A;  1CVZ A;  3PBH A;  2CIO A;  3C9E A;  1NQC A;  3KWZ A;  3B79 A;  4CZW A;  2R9M A;  3ERV A;  1AYV A;  1ATK A;  2NQI A;  1VSN A;  5FPW A;  2ATO A;  4CDC B;  2E00 A;  3IMA A;  3N3G A;  1TU6 A;  2FO5 A;  2FYE A;  3K24 A;  4W5B A;  2Y5B A;  5EGW A;  3RVW A;  5CVM A;  1POP A;  2GFO A;  2P0R A;  2DJF B;  2FUD A;  2WBF X;  3CH3 X;  4MSX A;  3I06 A;  4QRG A;  2F7D A;  4DMX A;  2AUZ A;  2JQF R;  1NB3 A;  2P7U A;  1AYW A;  1S4V A;  2FT2 A;  1F29 A;  4YVA A;  2E03 A;  1THE A;  2DC6 A;  1MDW A;  3USV A;  2YJ9 A;  3LFY A;  3BOW A;  4QRV A;  2B1N A;  5CVO B;  4YYR A;  9PAP A;  2FRQ A;  1CV8 A;  3OF8 A;  2NQD B;  4I04 A;  4DMY A;  2YJC A;  3H8C A;  3MHS A;  2FQ9 A;  2ACT A;  1AU4 A;  3QSD A;  4FJC A;  2ARY A;  2B1M A;  3RVV A;  3MHH A;  4PI3 A;  1K3B B;  1SNK A;  1PBH A;  1M6D A;  1AYU A;  2E02 A;  2HD5 A;  3KWB X;  1ME4 A;  2AIM A;  3P5X A;  3H8B A;  3H7D A;  8PCH A;  2OZ2 A;  4MZS A;  4Q8G A;  3KSE A;  1PE6 A;  1KHQ A;  4YYU A;  5CHT A;  1PCI A;  3M99 A;  3S3R A;  4HWY A;  1JQP A;  2NQA A;  4YYV A;  2IBI A;  2G8E A;  2OP3 A;  3QT4 A;  3O1G A;  1PAD A;  1CQD A;  1MS6 A;  2PAD A;  1EWM A;  2XU5 A;  5PAD A;  2BDZ A;  4CDF B;  1MHW A;  1TLO A;  1GMY A;  2IPP B;  2P86 A;  4RY2 A;  4W4U A;  3AI8 A;  3N4C A;  3NHE A;  1QOL A;  1YT7 A;  4PAD A;  4BQV A;  3BPM A;  4OEL A;  1YK7 A;  1A6R A;  1NL6 A;  3QJ3 A;  2AVW A;  1AEC A;  2XU1 A;  2C0Y A;  4N79 A;  1BGO A;  3P5U A;  3KW9 A;  2GHU A;  4X6I A;  3S3Q A;  4G54 A;  4YYS A;  5A24 A;  3TNX A;  2F1G A;  5JH3 A;  1GLO A;  3PW3 A;  4YYQ A;  3PDF A;  2NQG A;  3CH2 X;  1AU3 A;  2PNS A;  1F2A A;  2R9F A;  3KKU A;  2Y6E A;  3D6S A;  1CTE A;  1ZIV A;  3H89 A;  1ICF A;  5J94 A;  1CSB B;  2BDL A;  4BSQ A;  1YK8 A;  3WXE A;  1NPZ A;  4OEM A;  4QRX A;  4CDE B;  3K8U A;  3KX1 A;  2DCB A;  3OVZ A;  4PP2 E;  3O0U A;  1FH0 A;  3BC3 A;  3P5W A;  1KHP A;  3I3T A;  4QBB A;  1QMY A;  3CBK A;  3IOQ A;  3P5V A;  2PBH A;  2DJG B;  3H6S A;  2XU4 A;  1Q6K A;  1PPN A;  4KLB A;  2AS8 A;  2PRE A;  1NB5 A;  5CVN B;  2DC9 A; 
#chains in the Genus database with same CATH topology
 1ITO A;  4M0W A;  4N4Z A;  4P6G A;  3V6C A;  3HHA A;  3MTV A;  3WXG A;  4D8E A;  5CHV A;  4AXM A;  2XU3 A;  1KXR A;  3BPF A;  1BQI A;  4I05 A;  4XR7 A;  1ZCM A;  1AU0 A;  3PHW A;  1SP4 B;  4YYW A;  4XUI A;  1U9X A;  1YVB A;  5EF4 A;  1EWO A;  1U9V A;  2FE8 A;  3HD3 A;  4K7C A;  2HH5 A;  3BWK A;  2AYO A;  4WA6 A;  4XZX A;  1QDQ A;  1MEG A;  2DCA A;  2DZY A;  1PVJ A;  3F5V A;  4BOZ A;  1MEM A;  1IWD A;  2HHN A;  1NLJ A;  4Q8H A;  2G6D A;  3BB7 A;  3OIS A;  2DZZ A;  4IP3 A;  3K9M A;  1CPJ A;  1DEU A;  4BOP A;  4YV8 A;  3PHX A;  2R6N A;  4A5U A;  1Y08 A;  1AU2 A;  3F75 A;  4X6H A;  2VHS A;  2BTW A;  4D8B A;  2OUL A;  7PCK A;  3IHP A;  5F02 A;  1KFX L;  1GEC E;  4CDD B;  3E9S A;  1EWL A;  3OVX A;  3WXF A;  1CJL A;  3MJ5 A;  2G7Y A;  3TMP A;  3CBJ A;  4OW0 A;  3IUT A;  1F2B A;  1PXV A;  4HXD B;  3N3K A;  3IEJ A;  2DC8 A;  1EWP A;  1ME3 A;  1VJV A;  2FRA A;  3ZNH A;  1EF7 A;  3IV2 A;  4OVZ B;  3RVX A;  4FK5 A;  3W31 A;  4N8W A;  1PIP A;  1GCB A;  6PAD A;  4BS5 A;  2CB5 A;  4FIP A;  4MZO A;  2DCD A;  3MTN A;  3GCB A;  4MM3 B;  3TRK A;  4BOS A;  3PSE A;  4RNA A;  3LXS A;  2VHF A;  1CS8 A;  1TL9 A;  2DCC A;  3PNR A;  2G8J A;  1DF0 A;  3OQC A;  1BP4 A;  5EZQ A;  1X9Y A;  2BU3 A;  4D8I A;  1MIR A;  2BTW B;  1STF E;  4R3D A;  4P6E A;  1U5I A;  2YJ2 A;  4AXL A;  1Y4H A;  3RNV A;  3HWN A;  4X6J A;  4RF1 A;  2AUX A;  1YAL A;  3BCN A;  2O6X A;  1U9Q X;  1CB5 A;  2JTC A;  4PP1 A;  5JA7 A;  3OF9 A;  1PPP A;  2R9C A;  3E1Z B;  3PRM A;  3PHU A;  4BPV A;  2FTD A;  2YJ8 A;  2E01 A;  2YJB A;  1YZB A;  4ZTB A;  2R9N A;  1PPD A;  4MI7 A;  2HXZ A;  2HWK A;  1O0E A;  1DKI A;  1PPO A;  1BY8 A;  4P16 A;  2R9O A;  5K16 A;  1F2C A;  3DF0 A;  1U9W A;  3ZUA A;  1KFU L;  2AYN A;  4REZ A;  2JQG R;  4W5C A;  4ZUX U;  2AU1 A;  4BS6 A;  1QXP A;  2DC7 A;  4OVZ A;  3V6E A;  4I07 A;  3U8E A;  1AIM A;  4QH6 A;  1HUC B;  1XKG A;  3KFQ A;  3MOR A;  3HHI A;  2H7J A;  1CVZ A;  3PBH A;  2CIO A;  3C9E A;  1NQC A;  3KWZ A;  3B79 A;  4CZW A;  2R9M A;  3ERV A;  1AYV A;  1ATK A;  2NQI A;  5EZS A;  1VSN A;  5FPW A;  2ATO A;  4PT5 A;  4CDC B;  2E00 A;  3IMA A;  3N3G A;  1TU6 A;  2FO5 A;  2FYE A;  3K24 A;  4W5B A;  2Y5B A;  5EGW A;  3RVW A;  3BY4 A;  1POP A;  5CVM A;  2UZJ A;  3PRP A;  2GFO A;  2P0R A;  1UKF A;  2DJF B;  2FUD A;  2WBF X;  3CH3 X;  4MSX A;  3I06 A;  4QRG A;  2F7D A;  4DMX A;  2AUZ A;  2JQF R;  2J7Q C;  1NB3 A;  2P7U A;  1AYW A;  1S4V A;  2FT2 A;  1F29 A;  4YVA A;  2E03 A;  1THE A;  2DC6 A;  1MDW A;  3USV A;  2YJ9 A;  3LFY A;  3BOW A;  4QRV A;  2B1N A;  5CVO B;  4YYR A;  9PAP A;  2FRQ A;  3O65 A;  1CV8 A;  3OF8 A;  2NQD B;  4I04 A;  4DMY A;  2YJC A;  3H8C A;  3MHS A;  2FQ9 A;  2ACT A;  1AU4 A;  3QSD A;  4FJC A;  2ARY A;  2B1M A;  3RVV A;  3MHH A;  4PI3 A;  1K3B B;  2DOS A;  1SNK A;  1PBH A;  1M6D A;  1AYU A;  2E02 A;  2HD5 A;  3KWB X;  1ME4 A;  2AIM A;  3P5X A;  3H8B A;  3H7D A;  8PCH A;  2OZ2 A;  4MZS A;  4Q8G A;  3KSE A;  1PE6 A;  1KHQ A;  4YYU A;  5CHT A;  1PCI A;  3M99 A;  3S3R A;  2JRI A;  4HWY A;  1JQP A;  2NQA A;  4YYV A;  2IBI A;  2G8E A;  2OP3 A;  3QT4 A;  3O1G A;  1PAD A;  1CQD A;  1MS6 A;  2PAD A;  1EWM A;  2XU5 A;  5PAD A;  2BDZ A;  4CDF B;  1MHW A;  3C0R A;  1TLO A;  1GMY A;  2IPP B;  2P86 A;  3BBA A;  4RY2 A;  3AI8 A;  3N4C A;  4W4U A;  3NHE A;  1QOL A;  1YT7 A;  4PAD A;  4BQV A;  3BPM A;  4OEL A;  1YK7 A;  1A6R A;  1NL6 A;  3QJ3 A;  2AVW A;  1AEC A;  2XU1 A;  2C0Y A;  4N79 A;  1BGO A;  3P5U A;  3KW9 A;  2GHU A;  4X6I A;  3S3Q A;  4G54 A;  4YYS A;  2Z84 A;  5A24 A;  3PT2 A;  3TNX A;  2F1G A;  5JH3 A;  1GLO A;  4GUA A;  3PW3 A;  4YYQ A;  3PDF A;  2NQG A;  3CH2 X;  4BOU A;  1AU3 A;  2PNS A;  4RKX A;  1F2A A;  2R9F A;  3KKU A;  4WUR A;  2Y6E A;  3D6S A;  1CTE A;  1ZIV A;  3H89 A;  1ICF A;  5KO3 A;  5J94 A;  1CSB B;  2BDL A;  4BSQ A;  1YK8 A;  3WXE A;  1NPZ A;  4OEM A;  4QRX A;  4CDE B;  3K8U A;  3KX1 A;  2DCB A;  3OVZ A;  4PP2 E;  3O0U A;  4RF0 A;  1FH0 A;  4BOQ A;  3BC3 A;  3P5W A;  1KHP A;  3I3T A;  3W30 A;  4QBB A;  1QMY A;  2AGA A;  2J7Q A;  3CBK A;  3IOQ A;  5JZE A;  3P5V A;  2PBH A;  3B21 A;  2DJG B;  3H6S A;  3MP2 A;  2XU4 A;  1Q6K A;  4IUM A;  5E6J A;  1PPN A;  4KLB A;  2AS8 A;  3IFU A;  2PRE A;  1NB5 A;  5CVN B;  2DC9 A; 
#chains in the Genus database with same CATH homology
 1ITO A;  4N4Z A;  4P6G A;  3V6C A;  3HHA A;  3WXG A;  5CHV A;  4AXM A;  2XU3 A;  1KXR A;  3BPF A;  1BQI A;  4I05 A;  4XR7 A;  1ZCM A;  4NV7 A;  1AU0 A;  1W5R A;  1SP4 B;  4YYW A;  4XUI A;  1U9X A;  1E2T A;  1YVB A;  5EF4 A;  1EWO A;  4GUZ A;  1U9V A;  3HD3 A;  4K7C A;  2HH5 A;  3BWK A;  2AYO A;  4WA6 A;  1QDQ A;  1MEG A;  2DCA A;  2DZY A;  3F5V A;  1MEM A;  1IWD A;  2HHN A;  1NLJ A;  4Q8H A;  2G6D A;  3OIS A;  2DZZ A;  3K9M A;  1CPJ A;  1DEU A;  4YV8 A;  2R6N A;  1Y08 A;  1AU2 A;  3F75 A;  1W4T A;  4X6H A;  3D9W A;  2VHS A;  2OUL A;  7PCK A;  2VFC A;  3IHP A;  5F02 A;  1KFX L;  1GEC E;  4CDD B;  1EWL A;  3OVX A;  3WXF A;  1CJL A;  2G7Y A;  3CBJ A;  3IUT A;  1F2B A;  1PXV A;  3N3K A;  3IEJ A;  2DC8 A;  1EWP A;  1ME3 A;  1VJV A;  2FRA A;  1EF7 A;  3IV2 A;  3RVX A;  4FK5 A;  4N8W A;  1PIP A;  1GCB A;  6PAD A;  4BS5 A;  2CB5 A;  4FIP A;  4MZO A;  2DCD A;  3MTN A;  3GCB A;  3LXS A;  2VHF A;  1CS8 A;  1TL9 A;  2DCC A;  3PNR A;  2G8J A;  1DF0 A;  1BP4 A;  1X9Y A;  1MIR A;  1STF E;  4P6E A;  1U5I A;  2YJ2 A;  4AXL A;  1Y4H A;  3HWN A;  4X6J A;  2AUX A;  1YAL A;  3BCN A;  2O6X A;  1U9Q X;  1CB5 A;  4PP1 A;  5JA7 A;  3OF9 A;  1PPP A;  2R9C A;  3E1Z B;  4BPV A;  2FTD A;  2YJ8 A;  2E01 A;  2YJB A;  2R9N A;  1PPD A;  2HXZ A;  1O0E A;  1PPO A;  1BY8 A;  2R9O A;  5K16 A;  1F2C A;  3DF0 A;  1U9W A;  3ZUA A;  1KFU L;  2AYN A;  2JQG R;  4W5C A;  4ZUX U;  2AU1 A;  4BS6 A;  1QXP A;  2DC7 A;  3V6E A;  4I07 A;  3U8E A;  1AIM A;  4QH6 A;  1HUC B;  1XKG A;  3KFQ A;  3MOR A;  3HHI A;  2H7J A;  1CVZ A;  3PBH A;  2VFB A;  2CIO A;  3C9E A;  1NQC A;  3KWZ A;  3B79 A;  4CZW A;  2R9M A;  3ERV A;  1AYV A;  1ATK A;  2NQI A;  1VSN A;  5FPW A;  2ATO A;  4CDC B;  2E00 A;  3IMA A;  3N3G A;  1TU6 A;  2FO5 A;  2FYE A;  3K24 A;  4W5B A;  2Y5B A;  5EGW A;  3RVW A;  5CVM A;  1POP A;  2GFO A;  2P0R A;  2DJF B;  2FUD A;  2WBF X;  3CH3 X;  4MSX A;  3I06 A;  4QRG A;  2F7D A;  4DMX A;  2AUZ A;  2JQF R;  1NB3 A;  2P7U A;  1AYW A;  1S4V A;  2FT2 A;  1F29 A;  4YVA A;  2E03 A;  1THE A;  2DC6 A;  1MDW A;  3USV A;  2YJ9 A;  3LFY A;  3BOW A;  4QRV A;  2B1N A;  4B55 A;  5CVO B;  4YYR A;  9PAP A;  2FRQ A;  1CV8 A;  3OF8 A;  2NQD B;  4I04 A;  4BGF A;  4DMY A;  2YJC A;  3H8C A;  3MHS A;  2FQ9 A;  2ACT A;  1AU4 A;  3QSD A;  4FJC A;  2ARY A;  2B1M A;  3RVV A;  3MHH A;  4PI3 A;  4C5P A;  1K3B B;  1SNK A;  1PBH A;  1M6D A;  1AYU A;  2E02 A;  2HD5 A;  3KWB X;  1ME4 A;  2AIM A;  3P5X A;  3H8B A;  3H7D A;  8PCH A;  2OZ2 A;  4MZS A;  4Q8G A;  3KSE A;  1PE6 A;  1KHQ A;  4YYU A;  5CHT A;  1PCI A;  3M99 A;  3S3R A;  4HWY A;  1JQP A;  2NQA A;  4YYV A;  2IBI A;  2G8E A;  2OP3 A;  3QT4 A;  3O1G A;  1PAD A;  1CQD A;  1MS6 A;  2PAD A;  1EWM A;  3LTW A;  2XU5 A;  5PAD A;  2BDZ A;  4CDF B;  1MHW A;  1TLO A;  1GMY A;  2IPP B;  2P86 A;  4RY2 A;  4W4U A;  3AI8 A;  3N4C A;  3NHE A;  1QOL A;  1YT7 A;  4PAD A;  4BQV A;  3BPM A;  4OEL A;  1YK7 A;  1A6R A;  1NL6 A;  3QJ3 A;  2AVW A;  1AEC A;  2XU1 A;  2C0Y A;  4N79 A;  1BGO A;  3P5U A;  3KW9 A;  2GHU A;  4X6I A;  3S3Q A;  4G54 A;  4YYS A;  5A24 A;  3TNX A;  2F1G A;  5JH3 A;  1GX3 A;  1GLO A;  3PW3 A;  4YYQ A;  3PDF A;  2NQG A;  3CH2 X;  1AU3 A;  2PNS A;  1F2A A;  2R9F A;  3KKU A;  1W6F A;  2Y6E A;  3D6S A;  1CTE A;  1ZIV A;  3H89 A;  1ICF A;  5J94 A;  1CSB B;  2BDL A;  4BSQ A;  1YK8 A;  3WXE A;  1NPZ A;  4OEM A;  4QRX A;  4CDE B;  2BSZ A;  3K8U A;  3KX1 A;  2DCB A;  3OVZ A;  4PP2 E;  3O0U A;  1FH0 A;  3BC3 A;  3P5W A;  1KHP A;  3I3T A;  4NV8 A;  4QBB A;  1QMY A;  3CBK A;  3IOQ A;  3P5V A;  2PBH A;  2DJG B;  3H6S A;  2XU4 A;  1Q6K A;  1PPN A;  4KLB A;  2AS8 A;  2PRE A;  1NB5 A;  5CVN B;  2DC9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...