3QT4A

Structure of digestive procathepsin l 3 of tenebrio molitor larval midgut
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
310
structure length
304
Chain Sequence
b'KSLFQEQWSQFKLTHKKSYSSPIEEIRRQLIFKDNVAKIAEHNAKFEKGEVTYSKAMNQFGDMSKEEFLAYVNRGKAQNLRMPYVSSKKPLAASVDWRSNAVSEVKDQGQCGSSWSFSTTGAVEGQLALQRGRLTSLSEQNLIDCSSSYGNAGCDGGWMDSAFSYIHDYGIMSESAYPYEAQGDYCRFDSSQSVTTLSGYYDLPSGDENSLADAVGQAGPVAVAIDATDELQFYSGGLFYDQTCNQSDLNHGVLVVGYGSDNGQDYWILKNSWGSGWGESGYWRQVRNYGNNCGIATAASYPAL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cathepsin-L-like midgut cysteine proteinase
publication title The 3D structure and function of digestive cathepsin L-like proteinases of Tenebrio molitor larval midgut.
pubmed doi rcsb
source organism Tenebrio molitor
molecule tags Hydrolase
total genus 113
structure length 304
sequence length 310
ec nomenclature ec 3.4.22.15: Cathepsin L.
pdb deposition date 2011-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
A PF08246 Inhibitor_I29 Cathepsin propeptide inhibitor domain (I29)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3qt4A00
4BSQA 1CQDA 1CVZA 1NLJA 4QRXA 1POPA 2P86A 2F1GA 3U8EA 3D6SA 3H8CA 3QJ3A 2CIOA 1NB5A 5JA7A 1A6RA 2GFOA 5CHVA 1PPDA 4MSXA 1TU6A 4G54A 4Q8HA 4W5BA 4N79A 3H6SA 2IPPB 1U9XA 1YT7A 3IUTA 1Q6KA 4QH6A 2NQAA 4DMYA 4YYQA 1GECE 2BDZA 9PAPA 2FYEA 3WXGA 5EGWA 1O0EA 1YK8A 2R6NA 3KX1A 2PADA 1Y08A 1AU3A 4CDDB 2R9OA 1NL6A 1ICFA 5FPWA 4BPVA 1AYVA 1YVBA 2HHNA 4AXMA 1ZCMA 3QSDA 3IV2A 2G7YA 4BS5A 1PPNA 3WXEA 1DF0A 1PADA 1KFXL 2E00A 3B79A 3KKUA 3ERVA 1MS6A 1AU4A 2DC7A 2P7UA 3OF8A 3HWNA 4KLBA 2AUZA 3MORA 2AIMA 1CPJA 1AYUA 3LFYA 1ME4A 1GMYA 3O0UA 4WA6A 1BP4A 3CBKA 3OF9A 2DJGB 3ZUAA 1PIPA 3IMAA 5EF4A 1NB3A 1PXVA 2FQ9A 1NPZA 1VJVA 4YV8A 3MTNA 3F5VA 1AU0A 1ITOA 4YYUA 1U9QX 1F2BA 4PADA 1KHPA 1QXPA 3K8UA 3BCNA 2G8EA 3H89A 2HXZA 3N4CA 1EWPA 3C9EA 1GLOA 3KW9A 1U9WA 3OVXA 4ZUXU 1EWMA 1KXRA 3N3KA 2FRQA 4I07A 7PCKA 3MHSA 1TL9A 1ATKA 3S3RA 2FT2A 4I04A 1MEGA 2Y5BA 2GHUA 5K16A 2NQDB 2P0RA 3PNRA 3IEJA 1TLOA 2AYNA 2PBHA 3KWZA 3OISA 2G6DA 3RVWA 2DZZA 2BDLA 4BQVA 1AIMA 1EWOA 2OZ2A 2AUXA 1QDQA 2YJ9A 1EWLA 4Q8GA 3P5VA 3KFQA 4RY2A 2XU3A 2AYOA 1FH0A 1U9VA 1YALA 4CZWA 3M99A 1BY8A 1YK7A 2XU5A 3KSEA 2B1MA 2G8JA 4OEMA 3BOWA 2DCBA 1F29A 5CHTA 2YJBA 2R9NA 3BPMA 2JQFR 3QT4A 1AYWA 2HD5A 3RVVA 1AECA 4P6EA 1CTEA 2FO5A 2ARYA 1MHWA 1QMYA 1CS8A 3TNXA 4P6GA 4XUIA 4K7CA 4MZSA 5F02A 4YYVA 2XU1A 3PDFA 4HWYA 1CB5A 2HH5A 2PNSA 4YYRA 3HHAA 1MIRA 1CSBB 2DJFB 3IOQA 3V6CA 4CDEB 4PP1A 2R9FA 1F2CA 2O6XA 2DCCA 4X6JA 1CV8A 4PI3A 2R9MA 2C0YA 1PPOA 1PCIA 1STFE 2FUDA 2OP3A 3K24A 3LXSA 3S3QA 3H7DA 3BC3A 2XU4A 2AVWA 1U5IA 2AU1A 5CVMA 5A24A 4QBBA 3CH2X 3PW3A 2DC9A 1S4VA 2FTDA 3F75A 4FK5A 1VSNA 3GCBA 3USVA 1F2AA 1PE6A 2YJCA 3P5UA 2F7DA 3BWKA 1MDWA 2VHFA 2R9CA 3I3TA 1THEA 2H7JA 1PBHA 1HUCB 1AU2A 4MZOA 1BGOA 4QRVA 3NHEA 3E1ZB 1KHQA 1PPPA 1ME3A 2DC6A 3K9MA 3IHPA 2WBFX 4YVAA 1ZIVA 2FRAA 4X6HA 3O1GA 2VHSA 2E02A 4FIPA 2ACTA 3P5XA 4DMXA 2DCAA 4I05A 1K3BB 3PBHA 2CB5A 2NQGA 1SNKA 1SP4B 3RVXA 2YJ2A 4YYSA 2OULA 3V6EA 1MEMA 8PCHA 4N4ZA 4AXLA 5JH3A 4N8WA 3CBJA 5CVNB 4BS6A 2JQGR 1XKGA 4YYWA 2NQIA 4CDFB 4CDCB 3KWBX 1JQPA 1CJLA 1X9YA 2PREA 2E01A 1BQIA 2YJ8A 2DCDA 1DEUA 4W5CA 5J94A 4FJCA 3P5WA 1M6DA 4OELA 4W4UA 3H8BA 3CH3X 2DC8A 2IBIA 5PADA 3HHIA 3MHHA 6PADA 3OVZA 1KFUL 4PP2E 2B1NA 3HD3A 1EF7A 4X6IA 3WXFA 2AS8A 1IWDA 3DF0A 3N3GA 4XR7A 1GCBA 2ATOA 3I06A 1QOLA 3BPFA 2E03A 1Y4HA 2DZYA 2Y6EA 4QRGA 3AI8A 1NQCA 5CVOB
chains in the Genus database with same CATH superfamily
4BSQA 1CQDA 1CVZA 1NLJA 4QRXA 1POPA 2P86A 2F1GA 3U8EA 3D6SA 3H8CA 3QJ3A 2DOSA 2CIOA 3BB7A 1NB5A 5JA7A 1A6RA 2GFOA 5CHVA 1PPDA 4MSXA 1YZBA 1TU6A 4G54A 4Q8HA 4W5BA 2HWKA 4N79A 3H6SA 4IUMA 2IPPB 3PRMA 1U9XA 1YT7A 3IUTA 1Q6KA 4QH6A 2NQAA 4DMYA 4YYQA 1GECE 2BDZA 9PAPA 2FYEA 3WXGA 5EGWA 1O0EA 1YK8A 2R6NA 4IP3A 3KX1A 2PADA 1Y08A 1AU3A 3E9SA 2UZJA 2Z84A 4CDDB 4XZXA 2R9OA 1NL6A 1ICFA 4BOSA 5FPWA 4BPVA 1AYVA 1YVBA 2HHNA 4AXMA 1ZCMA 3QSDA 3IV2A 3PSEA 2G7YA 4BS5A 1PPNA 3WXEA 1DF0A 1PADA 1KFXL 2E00A 3B79A 3KKUA 3ERVA 4P16A 4D8BA 4D8IA 1MS6A 1AU4A 2DC7A 2P7UA 3OF8A 3HWNA 4KLBA 1PVJA 2AUZA 3MORA 2AIMA 1CPJA 2BTWB 1AYUA 3LFYA 1ME4A 2JRIA 1GMYA 3O0UA 4WA6A 1BP4A 3CBKA 3PRPA 3OF9A 2DJGB 3ZUAA 1PIPA 4RF0A 3IMAA 5EF4A 1NB3A 1PXVA 2FQ9A 1NPZA 1VJVA 4YV8A 2BU3A 4OVZA 3MJ5A 3MTNA 3F5VA 1AU0A 1ITOA 4YYUA 1U9QX 3W30A 1F2BA 4PADA 4OW0A 4RKXA 1KHPA 2BTWA 1QXPA 3K8UA 3BCNA 2G8EA 1DKIA 3H89A 2HXZA 3N4CA 1EWPA 3C9EA 1GLOA 3KW9A 1U9WA 3OVXA 4BOQA 4ZUXU 1EWMA 2FE8A 1KXRA 3N3KA 2FRQA 4I07A 7PCKA 3MHSA 1TL9A 4BOPA 1ATKA 3S3RA 2FT2A 4I04A 1MEGA 4A5UA 3TRKA 2Y5BA 2GHUA 5K16A 2NQDB 2P0RA 5EZSA 3PNRA 3IEJA 4R3DA 3OQCA 1TLOA 2AYNA 2PBHA 3KWZA 3TMPA 3OISA 2G6DA 3RVWA 2DZZA 2BDLA 4BQVA 1AIMA 1EWOA 2OZ2A 2AUXA 1QDQA 4BOUA 2YJ9A 1EWLA 4Q8GA 3P5VA 3KFQA 4RY2A 2XU3A 2AYOA 1FH0A 1U9VA 1YALA 4CZWA 3M99A 1BY8A 1YK7A 4PT5A 2XU5A 3KSEA 2B1MA 2G8JA 4OEMA 3BOWA 2DCBA 1F29A 5CHTA 2YJBA 2R9NA 3BPMA 4HXDB 2JQFR 3QT4A 1AYWA 4BOZA 2HD5A 3RVVA 4OVZB 1AECA 4P6EA 3O65A 1CTEA 2FO5A 2ARYA 1MHWA 1QMYA 3C0RA 1CS8A 3TNXA 3PHXA 4P6GA 4XUIA 4K7CA 4MZSA 5F02A 4YYVA 2XU1A 3PDFA 4HWYA 1CB5A 2HH5A 2PNSA 3B21A 4YYRA 3HHAA 1MIRA 1CSBB 1UKFA 2DJFB 3IOQA 3V6CA 4CDEB 4PP1A 2JTCA 2R9FA 1F2CA 2O6XA 2DCCA 4X6JA 1CV8A 4PI3A 2R9MA 4MM3B 2C0YA 1PPOA 1PCIA 1STFE 2FUDA 2OP3A 3K24A 3LXSA 3S3QA 3H7DA 3BC3A 2XU4A 2AVWA 1U5IA 2J7QC 2AU1A 5CVMA 3RNVA 5A24A 3PT2A 4QBBA 3CH2X 3PW3A 2DC9A 1S4VA 2FTDA 3F75A 4FK5A 1VSNA 3GCBA 3USVA 1F2AA 1PE6A 2AGAA 2YJCA 3P5UA 2F7DA 4RF1A 3BWKA 4GUAA 1MDWA 2VHFA 2R9CA 3I3TA 1THEA 4RNAA 5JZEA 2H7JA 1PBHA 1HUCB 1AU2A 4MZOA 1BGOA 4QRVA 3NHEA 3E1ZB 3MTVA 1KHQA 1PPPA 1ME3A 2DC6A 3K9MA 3IHPA 2WBFX 4ZTBA 4YVAA 1ZIVA 2FRAA 3PHUA 4X6HA 3O1GA 2VHSA 2E02A 4FIPA 2ACTA 3P5XA 5KO3A 4DMXA 2DCAA 4I05A 3IFUA 1K3BB 5E6JA 3PBHA 2CB5A 2NQGA 1SNKA 1SP4B 3W31A 3BY4A 3RVXA 2YJ2A 4YYSA 4WURA 2OULA 3V6EA 1MEMA 8PCHA 4N4ZA 4AXLA 5JH3A 4N8WA 3CBJA 5CVNB 4BS6A 2JQGR 1XKGA 4YYWA 2NQIA 4CDFB 4CDCB 3KWBX 3BBAA 1JQPA 1CJLA 1X9YA 2PREA 2E01A 1BQIA 2YJ8A 2DCDA 1DEUA 4W5CA 5J94A 4FJCA 3P5WA 1M6DA 4OELA 4W4UA 3H8BA 3CH3X 4D8EA 2DC8A 2IBIA 4REZA 5PADA 3HHIA 3MHHA 3ZNHA 4MI7A 3MP2A 5EZQA 6PADA 3OVZA 1KFUL 4PP2E 2B1NA 3HD3A 1EF7A 4X6IA 3WXFA 2AS8A 1IWDA 3DF0A 3N3GA 4XR7A 1GCBA 2ATOA 3I06A 1QOLA 3BPFA 2E03A 1Y4HA 2DZYA 2Y6EA 4M0WA 4QRGA 3AI8A 1NQCA 3PHWA 2J7QA 5CVOB
chains in the Genus database with same CATH topology
4BSQA 1CQDA 1CVZA 1NLJA 4QRXA 1POPA 2P86A 2F1GA 3U8EA 3D6SA 3H8CA 3QJ3A 2CIOA 1NB5A 5JA7A 1A6RA 2GFOA 5CHVA 1PPDA 4MSXA 1TU6A 4G54A 4Q8HA 4W5BA 4N79A 3H6SA 2IPPB 1U9XA 1YT7A 3IUTA 1Q6KA 4QH6A 2NQAA 4DMYA 4YYQA 1GECE 2BDZA 9PAPA 2FYEA 2VFCA 3WXGA 5EGWA 1O0EA 1YK8A 2R6NA 4NV7A 3KX1A 1E2TA 2BSZA 1Y08A 2PADA 1AU3A 4CDDB 2R9OA 1NL6A 1ICFA 5FPWA 4BPVA 1AYVA 1YVBA 2HHNA 4AXMA 1ZCMA 3QSDA 4B55A 3IV2A 2G7YA 4BS5A 1PPNA 3WXEA 1DF0A 1PADA 1KFXL 2E00A 3B79A 3KKUA 3ERVA 1MS6A 1AU4A 2DC7A 2P7UA 3OF8A 3HWNA 4KLBA 2AUZA 3MORA 2AIMA 1CPJA 1W4TA 1AYUA 3LFYA 1ME4A 1GMYA 3O0UA 4WA6A 1BP4A 3CBKA 3OF9A 2DJGB 3ZUAA 1PIPA 3IMAA 5EF4A 1NB3A 1PXVA 2FQ9A 1NPZA 1VJVA 4YV8A 3MTNA 3F5VA 1AU0A 1ITOA 4YYUA 1U9QX 1F2BA 4PADA 1KHPA 1QXPA 3K8UA 3BCNA 2G8EA 3H89A 2HXZA 3N4CA 1EWPA 3C9EA 1GLOA 3KW9A 1W6FA 1U9WA 3OVXA 4ZUXU 1EWMA 1KXRA 3N3KA 2FRQA 4I07A 7PCKA 3MHSA 1TL9A 1ATKA 3S3RA 2FT2A 4I04A 1MEGA 2Y5BA 2GHUA 5K16A 2NQDB 2P0RA 3PNRA 3IEJA 1TLOA 2AYNA 2PBHA 3KWZA 3LTWA 3OISA 2G6DA 3RVWA 2DZZA 2BDLA 4BQVA 1AIMA 1EWOA 2OZ2A 2AUXA 1QDQA 2YJ9A 1EWLA 4Q8GA 3P5VA 3KFQA 4RY2A 2XU3A 2AYOA 1FH0A 1U9VA 1YALA 4CZWA 3M99A 1BY8A 1YK7A 2XU5A 3KSEA 2B1MA 2G8JA 4OEMA 3BOWA 2DCBA 1F29A 5CHTA 2YJBA 2R9NA 3BPMA 2JQFR 3QT4A 1AYWA 2HD5A 3RVVA 1AECA 4P6EA 1CTEA 2FO5A 2ARYA 1MHWA 1QMYA 1CS8A 3TNXA 4P6GA 4XUIA 4K7CA 4MZSA 5F02A 4YYVA 2XU1A 3PDFA 4HWYA 1CB5A 2HH5A 2PNSA 4YYRA 3HHAA 1MIRA 1CSBB 2DJFB 3IOQA 3V6CA 4CDEB 4PP1A 2R9FA 1F2CA 2O6XA 2DCCA 4X6JA 1CV8A 4PI3A 2R9MA 2C0YA 1PPOA 1PCIA 2VFBA 1STFE 2FUDA 2OP3A 3K24A 3LXSA 3S3QA 3H7DA 3BC3A 2XU4A 2AVWA 1U5IA 2AU1A 5CVMA 5A24A 4QBBA 3CH2X 3PW3A 2DC9A 1S4VA 2FTDA 3F75A 4FK5A 1VSNA 3GCBA 3USVA 1F2AA 4C5PA 1PE6A 2YJCA 3P5UA 2F7DA 3BWKA 1MDWA 2VHFA 2R9CA 3I3TA 1THEA 2H7JA 1PBHA 1HUCB 1AU2A 4MZOA 1BGOA 4QRVA 3NHEA 3E1ZB 1KHQA 1PPPA 1ME3A 2DC6A 4BGFA 3K9MA 3IHPA 2WBFX 4YVAA 1ZIVA 2FRAA 4X6HA 3O1GA 2VHSA 2E02A 3D9WA 2ACTA 3P5XA 4FIPA 4DMXA 2DCAA 4I05A 1K3BB 3PBHA 4NV8A 2CB5A 1GX3A 2NQGA 1SNKA 1SP4B 3RVXA 2YJ2A 4YYSA 2OULA 3V6EA 1MEMA 8PCHA 4N4ZA 4AXLA 5JH3A 4N8WA 3CBJA 5CVNB 4BS6A 2JQGR 1XKGA 4YYWA 2NQIA 4CDFB 4CDCB 3KWBX 1JQPA 1CJLA 1X9YA 2PREA 2E01A 1BQIA 2YJ8A 2DCDA 1DEUA 4W5CA 5J94A 4FJCA 3P5WA 1M6DA 4OELA 4W4UA 3H8BA 3CH3X 2DC8A 2IBIA 5PADA 3HHIA 1W5RA 3MHHA 6PADA 3OVZA 1KFUL 4PP2E 4GUZA 2B1NA 3HD3A 1EF7A 4X6IA 3WXFA 2AS8A 1IWDA 3DF0A 3N3GA 4XR7A 1GCBA 2ATOA 3I06A 1QOLA 3BPFA 2E03A 1Y4HA 2DZYA 2Y6EA 4QRGA 3AI8A 1NQCA 5CVOB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BSQ A;  1CQD A;  1CVZ A;  1NLJ A;  4QRX A;  1POP A;  2P86 A;  2F1G A;  3U8E A;  3D6S A;  3H8C A;  3QJ3 A;  2CIO A;  1NB5 A;  5JA7 A;  1A6R A;  2GFO A;  5CHV A;  1PPD A;  4MSX A;  1TU6 A;  4G54 A;  4Q8H A;  4W5B A;  4N79 A;  3H6S A;  2IPP B;  1U9X A;  1YT7 A;  3IUT A;  1Q6K A;  4QH6 A;  2NQA A;  4DMY A;  4YYQ A;  1GEC E;  2BDZ A;  9PAP A;  2FYE A;  3WXG A;  5EGW A;  1O0E A;  1YK8 A;  2R6N A;  3KX1 A;  2PAD A;  1Y08 A;  1AU3 A;  4CDD B;  2R9O A;  1NL6 A;  1ICF A;  5FPW A;  4BPV A;  1AYV A;  1YVB A;  2HHN A;  4AXM A;  1ZCM A;  3QSD A;  3IV2 A;  2G7Y A;  4BS5 A;  1PPN A;  3WXE A;  1DF0 A;  1PAD A;  1KFX L;  2E00 A;  3B79 A;  3KKU A;  3ERV A;  1MS6 A;  1AU4 A;  2DC7 A;  2P7U A;  3OF8 A;  3HWN A;  4KLB A;  2AUZ A;  3MOR A;  2AIM A;  1CPJ A;  1AYU A;  3LFY A;  1ME4 A;  1GMY A;  3O0U A;  4WA6 A;  1BP4 A;  3CBK A;  3OF9 A;  2DJG B;  3ZUA A;  1PIP A;  3IMA A;  5EF4 A;  1NB3 A;  1PXV A;  2FQ9 A;  1NPZ A;  1VJV A;  4YV8 A;  3MTN A;  3F5V A;  1AU0 A;  1ITO A;  4YYU A;  1U9Q X;  1F2B A;  4PAD A;  1KHP A;  1QXP A;  3K8U A;  3BCN A;  2G8E A;  3H89 A;  2HXZ A;  3N4C A;  1EWP A;  3C9E A;  1GLO A;  3KW9 A;  1U9W A;  3OVX A;  4ZUX U;  1EWM A;  1KXR A;  3N3K A;  2FRQ A;  4I07 A;  7PCK A;  3MHS A;  1TL9 A;  1ATK A;  3S3R A;  2FT2 A;  4I04 A;  1MEG A;  2Y5B A;  2GHU A;  5K16 A;  2NQD B;  2P0R A;  3PNR A;  3IEJ A;  1TLO A;  2AYN A;  2PBH A;  3KWZ A;  3OIS A;  2G6D A;  3RVW A;  2DZZ A;  2BDL A;  4BQV A;  1AIM A;  1EWO A;  2OZ2 A;  2AUX A;  1QDQ A;  2YJ9 A;  1EWL A;  4Q8G A;  3P5V A;  3KFQ A;  4RY2 A;  2XU3 A;  2AYO A;  1FH0 A;  1U9V A;  1YAL A;  4CZW A;  3M99 A;  1BY8 A;  1YK7 A;  2XU5 A;  3KSE A;  2B1M A;  2G8J A;  4OEM A;  3BOW A;  2DCB A;  1F29 A;  5CHT A;  2YJB A;  2R9N A;  3BPM A;  2JQF R;  3QT4 A;  1AYW A;  2HD5 A;  3RVV A;  1AEC A;  4P6E A;  1CTE A;  2FO5 A;  2ARY A;  1MHW A;  1QMY A;  1CS8 A;  3TNX A;  4P6G A;  4XUI A;  4K7C A;  4MZS A;  5F02 A;  4YYV A;  2XU1 A;  3PDF A;  4HWY A;  1CB5 A;  2HH5 A;  2PNS A;  4YYR A;  3HHA A;  1MIR A;  1CSB B;  2DJF B;  3IOQ A;  3V6C A;  4CDE B;  4PP1 A;  2R9F A;  1F2C A;  2O6X A;  2DCC A;  4X6J A;  1CV8 A;  4PI3 A;  2R9M A;  2C0Y A;  1PPO A;  1PCI A;  1STF E;  2FUD A;  2OP3 A;  3K24 A;  3LXS A;  3S3Q A;  3H7D A;  3BC3 A;  2XU4 A;  2AVW A;  1U5I A;  2AU1 A;  5CVM A;  5A24 A;  4QBB A;  3CH2 X;  3PW3 A;  2DC9 A;  1S4V A;  2FTD A;  3F75 A;  4FK5 A;  1VSN A;  3GCB A;  3USV A;  1F2A A;  1PE6 A;  2YJC A;  3P5U A;  2F7D A;  3BWK A;  1MDW A;  2VHF A;  2R9C A;  3I3T A;  1THE A;  2H7J A;  1PBH A;  1HUC B;  1AU2 A;  4MZO A;  1BGO A;  4QRV A;  3NHE A;  3E1Z B;  1KHQ A;  1PPP A;  1ME3 A;  2DC6 A;  3K9M A;  3IHP A;  2WBF X;  4YVA A;  1ZIV A;  2FRA A;  4X6H A;  3O1G A;  2VHS A;  2E02 A;  4FIP A;  2ACT A;  3P5X A;  4DMX A;  2DCA A;  4I05 A;  1K3B B;  3PBH A;  2CB5 A;  2NQG A;  1SNK A;  1SP4 B;  3RVX A;  2YJ2 A;  4YYS A;  2OUL A;  3V6E A;  1MEM A;  8PCH A;  4N4Z A;  4AXL A;  5JH3 A;  4N8W A;  3CBJ A;  5CVN B;  4BS6 A;  2JQG R;  1XKG A;  4YYW A;  2NQI A;  4CDF B;  4CDC B;  3KWB X;  1JQP A;  1CJL A;  1X9Y A;  2PRE A;  2E01 A;  1BQI A;  2YJ8 A;  2DCD A;  1DEU A;  4W5C A;  5J94 A;  4FJC A;  3P5W A;  1M6D A;  4OEL A;  4W4U A;  3H8B A;  3CH3 X;  2DC8 A;  2IBI A;  5PAD A;  3HHI A;  3MHH A;  6PAD A;  3OVZ A;  1KFU L;  4PP2 E;  2B1N A;  3HD3 A;  1EF7 A;  4X6I A;  3WXF A;  2AS8 A;  1IWD A;  3DF0 A;  3N3G A;  4XR7 A;  1GCB A;  2ATO A;  3I06 A;  1QOL A;  3BPF A;  2E03 A;  1Y4H A;  2DZY A;  2Y6E A;  4QRG A;  3AI8 A;  1NQC A;  5CVO B; 
#chains in the Genus database with same CATH topology
 4BSQ A;  1CQD A;  1CVZ A;  1NLJ A;  4QRX A;  1POP A;  2P86 A;  2F1G A;  3U8E A;  3D6S A;  3H8C A;  3QJ3 A;  2DOS A;  2CIO A;  3BB7 A;  1NB5 A;  5JA7 A;  1A6R A;  2GFO A;  5CHV A;  1PPD A;  4MSX A;  1YZB A;  1TU6 A;  4G54 A;  4Q8H A;  4W5B A;  2HWK A;  4N79 A;  3H6S A;  4IUM A;  2IPP B;  3PRM A;  1U9X A;  1YT7 A;  3IUT A;  1Q6K A;  4QH6 A;  2NQA A;  4DMY A;  4YYQ A;  1GEC E;  2BDZ A;  9PAP A;  2FYE A;  3WXG A;  5EGW A;  1O0E A;  1YK8 A;  2R6N A;  4IP3 A;  3KX1 A;  2PAD A;  1Y08 A;  1AU3 A;  3E9S A;  2UZJ A;  2Z84 A;  4CDD B;  4XZX A;  2R9O A;  1NL6 A;  1ICF A;  4BOS A;  5FPW A;  4BPV A;  1AYV A;  1YVB A;  2HHN A;  4AXM A;  1ZCM A;  3QSD A;  3IV2 A;  3PSE A;  2G7Y A;  4BS5 A;  1PPN A;  3WXE A;  1DF0 A;  1PAD A;  1KFX L;  2E00 A;  3B79 A;  3KKU A;  3ERV A;  4P16 A;  4D8B A;  4D8I A;  1MS6 A;  1AU4 A;  2DC7 A;  2P7U A;  3OF8 A;  3HWN A;  4KLB A;  1PVJ A;  2AUZ A;  3MOR A;  2AIM A;  1CPJ A;  2BTW B;  1AYU A;  3LFY A;  1ME4 A;  2JRI A;  1GMY A;  3O0U A;  4WA6 A;  1BP4 A;  3CBK A;  3PRP A;  3OF9 A;  2DJG B;  3ZUA A;  1PIP A;  4RF0 A;  3IMA A;  5EF4 A;  1NB3 A;  1PXV A;  2FQ9 A;  1NPZ A;  1VJV A;  4YV8 A;  2BU3 A;  4OVZ A;  3MJ5 A;  3MTN A;  3F5V A;  1AU0 A;  1ITO A;  4YYU A;  1U9Q X;  3W30 A;  1F2B A;  4PAD A;  4OW0 A;  4RKX A;  1KHP A;  2BTW A;  1QXP A;  3K8U A;  3BCN A;  2G8E A;  1DKI A;  3H89 A;  2HXZ A;  3N4C A;  1EWP A;  3C9E A;  1GLO A;  3KW9 A;  1U9W A;  3OVX A;  4BOQ A;  4ZUX U;  1EWM A;  2FE8 A;  1KXR A;  3N3K A;  2FRQ A;  4I07 A;  7PCK A;  3MHS A;  1TL9 A;  4BOP A;  1ATK A;  3S3R A;  2FT2 A;  4I04 A;  1MEG A;  4A5U A;  3TRK A;  2Y5B A;  2GHU A;  5K16 A;  2NQD B;  2P0R A;  5EZS A;  3PNR A;  3IEJ A;  4R3D A;  3OQC A;  1TLO A;  2AYN A;  2PBH A;  3KWZ A;  3TMP A;  3OIS A;  2G6D A;  3RVW A;  2DZZ A;  2BDL A;  4BQV A;  1AIM A;  1EWO A;  2OZ2 A;  2AUX A;  1QDQ A;  4BOU A;  2YJ9 A;  1EWL A;  4Q8G A;  3P5V A;  3KFQ A;  4RY2 A;  2XU3 A;  2AYO A;  1FH0 A;  1U9V A;  1YAL A;  4CZW A;  3M99 A;  1BY8 A;  1YK7 A;  4PT5 A;  2XU5 A;  3KSE A;  2B1M A;  2G8J A;  4OEM A;  3BOW A;  2DCB A;  1F29 A;  5CHT A;  2YJB A;  2R9N A;  3BPM A;  4HXD B;  2JQF R;  3QT4 A;  1AYW A;  4BOZ A;  2HD5 A;  3RVV A;  4OVZ B;  1AEC A;  4P6E A;  3O65 A;  1CTE A;  2FO5 A;  2ARY A;  1MHW A;  1QMY A;  3C0R A;  1CS8 A;  3TNX A;  3PHX A;  4P6G A;  4XUI A;  4K7C A;  4MZS A;  5F02 A;  4YYV A;  2XU1 A;  3PDF A;  4HWY A;  1CB5 A;  2HH5 A;  2PNS A;  3B21 A;  4YYR A;  3HHA A;  1MIR A;  1CSB B;  1UKF A;  2DJF B;  3IOQ A;  3V6C A;  4CDE B;  4PP1 A;  2JTC A;  2R9F A;  1F2C A;  2O6X A;  2DCC A;  4X6J A;  1CV8 A;  4PI3 A;  2R9M A;  4MM3 B;  2C0Y A;  1PPO A;  1PCI A;  1STF E;  2FUD A;  2OP3 A;  3K24 A;  3LXS A;  3S3Q A;  3H7D A;  3BC3 A;  2XU4 A;  2AVW A;  1U5I A;  2J7Q C;  2AU1 A;  5CVM A;  3RNV A;  5A24 A;  3PT2 A;  4QBB A;  3CH2 X;  3PW3 A;  2DC9 A;  1S4V A;  2FTD A;  3F75 A;  4FK5 A;  1VSN A;  3GCB A;  3USV A;  1F2A A;  1PE6 A;  2AGA A;  2YJC A;  3P5U A;  2F7D A;  4RF1 A;  3BWK A;  4GUA A;  1MDW A;  2VHF A;  2R9C A;  3I3T A;  1THE A;  4RNA A;  5JZE A;  2H7J A;  1PBH A;  1HUC B;  1AU2 A;  4MZO A;  1BGO A;  4QRV A;  3NHE A;  3E1Z B;  3MTV A;  1KHQ A;  1PPP A;  1ME3 A;  2DC6 A;  3K9M A;  3IHP A;  2WBF X;  4ZTB A;  4YVA A;  1ZIV A;  2FRA A;  3PHU A;  4X6H A;  3O1G A;  2VHS A;  2E02 A;  4FIP A;  2ACT A;  3P5X A;  5KO3 A;  4DMX A;  2DCA A;  4I05 A;  3IFU A;  1K3B B;  5E6J A;  3PBH A;  2CB5 A;  2NQG A;  1SNK A;  1SP4 B;  3W31 A;  3BY4 A;  3RVX A;  2YJ2 A;  4YYS A;  4WUR A;  2OUL A;  3V6E A;  1MEM A;  8PCH A;  4N4Z A;  4AXL A;  5JH3 A;  4N8W A;  3CBJ A;  5CVN B;  4BS6 A;  2JQG R;  1XKG A;  4YYW A;  2NQI A;  4CDF B;  4CDC B;  3KWB X;  3BBA A;  1JQP A;  1CJL A;  1X9Y A;  2PRE A;  2E01 A;  1BQI A;  2YJ8 A;  2DCD A;  1DEU A;  4W5C A;  5J94 A;  4FJC A;  3P5W A;  1M6D A;  4OEL A;  4W4U A;  3H8B A;  3CH3 X;  4D8E A;  2DC8 A;  2IBI A;  4REZ A;  5PAD A;  3HHI A;  3MHH A;  3ZNH A;  4MI7 A;  3MP2 A;  5EZQ A;  6PAD A;  3OVZ A;  1KFU L;  4PP2 E;  2B1N A;  3HD3 A;  1EF7 A;  4X6I A;  3WXF A;  2AS8 A;  1IWD A;  3DF0 A;  3N3G A;  4XR7 A;  1GCB A;  2ATO A;  3I06 A;  1QOL A;  3BPF A;  2E03 A;  1Y4H A;  2DZY A;  2Y6E A;  4M0W A;  4QRG A;  3AI8 A;  1NQC A;  3PHW A;  2J7Q A;  5CVO B; 
#chains in the Genus database with same CATH homology
 4BSQ A;  1CQD A;  1CVZ A;  1NLJ A;  4QRX A;  1POP A;  2P86 A;  2F1G A;  3U8E A;  3D6S A;  3H8C A;  3QJ3 A;  2CIO A;  1NB5 A;  5JA7 A;  1A6R A;  2GFO A;  5CHV A;  1PPD A;  4MSX A;  1TU6 A;  4G54 A;  4Q8H A;  4W5B A;  4N79 A;  3H6S A;  2IPP B;  1U9X A;  1YT7 A;  3IUT A;  1Q6K A;  4QH6 A;  2NQA A;  4DMY A;  4YYQ A;  1GEC E;  2BDZ A;  9PAP A;  2FYE A;  2VFC A;  3WXG A;  5EGW A;  1O0E A;  1YK8 A;  2R6N A;  4NV7 A;  3KX1 A;  1E2T A;  2BSZ A;  1Y08 A;  2PAD A;  1AU3 A;  4CDD B;  2R9O A;  1NL6 A;  1ICF A;  5FPW A;  4BPV A;  1AYV A;  1YVB A;  2HHN A;  4AXM A;  1ZCM A;  3QSD A;  4B55 A;  3IV2 A;  2G7Y A;  4BS5 A;  1PPN A;  3WXE A;  1DF0 A;  1PAD A;  1KFX L;  2E00 A;  3B79 A;  3KKU A;  3ERV A;  1MS6 A;  1AU4 A;  2DC7 A;  2P7U A;  3OF8 A;  3HWN A;  4KLB A;  2AUZ A;  3MOR A;  2AIM A;  1CPJ A;  1W4T A;  1AYU A;  3LFY A;  1ME4 A;  1GMY A;  3O0U A;  4WA6 A;  1BP4 A;  3CBK A;  3OF9 A;  2DJG B;  3ZUA A;  1PIP A;  3IMA A;  5EF4 A;  1NB3 A;  1PXV A;  2FQ9 A;  1NPZ A;  1VJV A;  4YV8 A;  3MTN A;  3F5V A;  1AU0 A;  1ITO A;  4YYU A;  1U9Q X;  1F2B A;  4PAD A;  1KHP A;  1QXP A;  3K8U A;  3BCN A;  2G8E A;  3H89 A;  2HXZ A;  3N4C A;  1EWP A;  3C9E A;  1GLO A;  3KW9 A;  1W6F A;  1U9W A;  3OVX A;  4ZUX U;  1EWM A;  1KXR A;  3N3K A;  2FRQ A;  4I07 A;  7PCK A;  3MHS A;  1TL9 A;  1ATK A;  3S3R A;  2FT2 A;  4I04 A;  1MEG A;  2Y5B A;  2GHU A;  5K16 A;  2NQD B;  2P0R A;  3PNR A;  3IEJ A;  1TLO A;  2AYN A;  2PBH A;  3KWZ A;  3LTW A;  3OIS A;  2G6D A;  3RVW A;  2DZZ A;  2BDL A;  4BQV A;  1AIM A;  1EWO A;  2OZ2 A;  2AUX A;  1QDQ A;  2YJ9 A;  1EWL A;  4Q8G A;  3P5V A;  3KFQ A;  4RY2 A;  2XU3 A;  2AYO A;  1FH0 A;  1U9V A;  1YAL A;  4CZW A;  3M99 A;  1BY8 A;  1YK7 A;  2XU5 A;  3KSE A;  2B1M A;  2G8J A;  4OEM A;  3BOW A;  2DCB A;  1F29 A;  5CHT A;  2YJB A;  2R9N A;  3BPM A;  2JQF R;  3QT4 A;  1AYW A;  2HD5 A;  3RVV A;  1AEC A;  4P6E A;  1CTE A;  2FO5 A;  2ARY A;  1MHW A;  1QMY A;  1CS8 A;  3TNX A;  4P6G A;  4XUI A;  4K7C A;  4MZS A;  5F02 A;  4YYV A;  2XU1 A;  3PDF A;  4HWY A;  1CB5 A;  2HH5 A;  2PNS A;  4YYR A;  3HHA A;  1MIR A;  1CSB B;  2DJF B;  3IOQ A;  3V6C A;  4CDE B;  4PP1 A;  2R9F A;  1F2C A;  2O6X A;  2DCC A;  4X6J A;  1CV8 A;  4PI3 A;  2R9M A;  2C0Y A;  1PPO A;  1PCI A;  2VFB A;  1STF E;  2FUD A;  2OP3 A;  3K24 A;  3LXS A;  3S3Q A;  3H7D A;  3BC3 A;  2XU4 A;  2AVW A;  1U5I A;  2AU1 A;  5CVM A;  5A24 A;  4QBB A;  3CH2 X;  3PW3 A;  2DC9 A;  1S4V A;  2FTD A;  3F75 A;  4FK5 A;  1VSN A;  3GCB A;  3USV A;  1F2A A;  4C5P A;  1PE6 A;  2YJC A;  3P5U A;  2F7D A;  3BWK A;  1MDW A;  2VHF A;  2R9C A;  3I3T A;  1THE A;  2H7J A;  1PBH A;  1HUC B;  1AU2 A;  4MZO A;  1BGO A;  4QRV A;  3NHE A;  3E1Z B;  1KHQ A;  1PPP A;  1ME3 A;  2DC6 A;  4BGF A;  3K9M A;  3IHP A;  2WBF X;  4YVA A;  1ZIV A;  2FRA A;  4X6H A;  3O1G A;  2VHS A;  2E02 A;  3D9W A;  2ACT A;  3P5X A;  4FIP A;  4DMX A;  2DCA A;  4I05 A;  1K3B B;  3PBH A;  4NV8 A;  2CB5 A;  1GX3 A;  2NQG A;  1SNK A;  1SP4 B;  3RVX A;  2YJ2 A;  4YYS A;  2OUL A;  3V6E A;  1MEM A;  8PCH A;  4N4Z A;  4AXL A;  5JH3 A;  4N8W A;  3CBJ A;  5CVN B;  4BS6 A;  2JQG R;  1XKG A;  4YYW A;  2NQI A;  4CDF B;  4CDC B;  3KWB X;  1JQP A;  1CJL A;  1X9Y A;  2PRE A;  2E01 A;  1BQI A;  2YJ8 A;  2DCD A;  1DEU A;  4W5C A;  5J94 A;  4FJC A;  3P5W A;  1M6D A;  4OEL A;  4W4U A;  3H8B A;  3CH3 X;  2DC8 A;  2IBI A;  5PAD A;  3HHI A;  1W5R A;  3MHH A;  6PAD A;  3OVZ A;  1KFU L;  4PP2 E;  4GUZ A;  2B1N A;  3HD3 A;  1EF7 A;  4X6I A;  3WXF A;  2AS8 A;  1IWD A;  3DF0 A;  3N3G A;  4XR7 A;  1GCB A;  2ATO A;  3I06 A;  1QOL A;  3BPF A;  2E03 A;  1Y4H A;  2DZY A;  2Y6E A;  4QRG A;  3AI8 A;  1NQC A;  5CVO B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...