3QT4A

Structure of digestive procathepsin l 3 of tenebrio molitor larval midgut
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
310
structure length
304
Chain Sequence
KSLFQEQWSQFKLTHKKSYSSPIEEIRRQLIFKDNVAKIAEHNAKFEKGEVTYSKAMNQFGDMSKEEFLAYVNRGKAQNLRMPYVSSKKPLAASVDWRSNAVSEVKDQGQCGSSWSFSTTGAVEGQLALQRGRLTSLSEQNLIDCSSSYGNAGCDGGWMDSAFSYIHDYGIMSESAYPYEAQGDYCRFDSSQSVTTLSGYYDLPSGDENSLADAVGQAGPVAVAIDATDELQFYSGGLFYDQTCNQSDLNHGVLVVGYGSDNGQDYWILKNSWGSGWGESGYWRQVRNYGNNCGIATAASYPAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Cathepsin-L-like midgut cysteine proteinase
publication title The 3D structure and function of digestive cathepsin L-like proteinases of Tenebrio molitor larval midgut.
pubmed doi rcsb
source organism Tenebrio molitor
total genus 113
structure length 304
sequence length 310
ec nomenclature ec 3.4.22.15: Cathepsin L.
pdb deposition date 2011-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
A PF08246 Inhibitor_I29 Cathepsin propeptide inhibitor domain (I29)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3qt4A00
2PADA 1BP4A 4MZSA 2R9CA 2XU5A 3HWNA 2DJGB 3IUTA 4FJCA 2FRQA 4AXMA 2AUXA 5CHVA 2G8JA 4I05A 1PBHA 1PPPA 1TU6A 3PW3A 1BY8A 3P5UA 4K7CA 4HWYA 3QJ3A 3BOWA 1PE6A 1MDWA 1X9YA 1ITOA 4QRXA 1PPDA 4BPVA 4MZOA 1EWLA 3O0UA 3MHSA 1F2BA 1CTEA 1Y08A 1JQPA 3K8UA 1BQIA 1S4VA 4XUIA 3H6SA 2R9NA 3F5VA 3KW9A 2VHFA 1STFE 5JH3A 1F2CA 4W5BA 1NPZA 4QH6A 2YJCA 4CDEB 4N8WA 4FIPA 4CZWA 2NQAA 2G6DA 2PBHA 1CPJA 5FPWA 5JA7A 2E03A 2FTDA 1U9XA 3ERVA 4I07A 1AYUA 1MEMA 2R9OA 1KHPA 1ZCMA 2OULA 4X6JA 4CDFB 1Y4HA 4PI3A 5A24A 2FUDA 4DMXA 1VSNA 3CBJA 3H7DA 1NL6A 1AYWA 1PPNA 2F1GA 3GCBA 3PBHA 1SNKA 9PAPA 1AU0A 4PP1A 4PP2E 2IBIA 4OEMA 2R9MA 3V6CA 1GECE 4CDDB 6PADA 4I04A 2WBFX 3RVWA 2E01A 4X6IA 5PADA 4CDCB 2H7JA 4AXLA 2GHUA 5F02A 4X6HA 5CVOB 2BDLA 3IEJA 1YALA 3MHHA 4W4UA 5EGWA 3KSEA 2VHSA 3CBKA 2CIOA 3I3TA 3D6SA 2FYEA 2XU1A 3N3KA 1K3BB 4OELA 1QDQA 2Y5BA 1PADA 1PPOA 1CB5A 4N79A 3F75A 1F29A 1CV8A 2YJ8A 1U9WA 2HD5A 2DJFB 1Q6KA 3PNRA 1PCIA 1KFXL 2DCBA 3S3QA 4QRGA 4G54A 3LXSA 3OF9A 1VJVA 1KFUL 1U5IA 2BDZA 4BQVA 1AU4A 3P5VA 2FT2A 3OISA 3RVXA 3OVZA 2PREA 2B1NA 2XU3A 3LFYA 2HH5A 1U9VA 3BPFA 2F7DA 3IV2A 4YVAA 3HHIA 1PXVA 1NB3A 1ME3A 1TL9A 3O1GA 1AIMA 3I06A 3AI8A 4Q8HA 2XU4A 2NQDB 2E02A 1PIPA 1CSBB 2Y6EA 4ZUXU 4YV8A 1A6RA 1MS6A 2AVWA 5K16A 4BSQA 4QRVA 2P7UA 3P5WA 2AS8A 1QOLA 4DMYA 4N4ZA 1THEA 3P5XA 2ARYA 3K9MA 1ATKA 3H89A 2DCAA 1YVBA 3K24A 5CVMA 2GFOA 3U8EA 3BC3A 2FQ9A 2OZ2A 3DF0A 1GLOA 1NLJA 2AYOA 2P86A 2NQIA 4W5CA 1U9QX 1DEUA 1HUCB 1AECA 1M6DA 1NQCA 3MTNA 2G8EA 1QXPA 2R9FA 2P0RA 3BPMA 2ATOA 5CHTA 2AYNA 3USVA 4YYQA 1AU2A 1YK8A 4YYUA 3NHEA 3CH3X 5CVNB 3E1ZB 1ME4A 4QBBA 3IOQA 3MORA 8PCHA 1CVZA 3WXEA 2B1MA 1KHQA 1YK7A 1EWPA 4KLBA 3M99A 1XKGA 3N4CA 2HXZA 1EWOA 1EWMA 3TNXA 2YJ2A 2AU1A 3CH2X 3S3RA 2YJ9A 2DZZA 3IHPA 2AUZA 3WXFA 3BCNA 3N3GA 1QMYA 2R6NA 2DCDA 2OP3A 2JQFR 3OVXA 3B79A 3PDFA 3V6EA 2FO5A 2JQGR 2NQGA 1KXRA 1GCBA 1MHWA 2DC8A 3KFQA 1SP4B 4BS5A 3KKUA 1CS8A 2O6XA 4BS6A 1CJLA 2AIMA 1BGOA 1AYVA 4Q8GA 1MEGA 3HD3A 3QT4A 3QSDA 4PADA 2E00A 1ZIVA 4RY2A 4P6GA 1DF0A 1FH0A 1TLOA 4XR7A 1MIRA 2DC6A 1POPA 1CQDA 3KX1A 3C9EA 3H8CA 1NB5A 3BWKA 1F2AA 3ZUAA 2DZYA 2PNSA 1IWDA 2CB5A 5J94A 4YYVA 1O0EA 1EF7A 1YT7A 4YYRA 2DCCA 3IMAA 2FRAA 4P6EA 1AU3A 5EF4A 7PCKA 2G7YA 4YYWA 3KWBX 4FK5A 4YYSA 2DC7A 2ACTA 4MSXA 3HHAA 2IPPB 1GMYA 2C0YA 2DC9A 3KWZA 2HHNA 1ICFA 3H8BA 3WXGA 4WA6A 3OF8A 3RVVA 2YJBA
chains in the Genus database with same CATH superfamily
2PADA 1BP4A 4MZSA 2R9CA 2XU5A 3HWNA 4GUAA 2DJGB 3IUTA 4FJCA 2FRQA 4AXMA 2AUXA 5CHVA 2G8JA 4I05A 1PBHA 1PPPA 1TU6A 3PW3A 1BY8A 5EZSA 3P5UA 4K7CA 4HWYA 3QJ3A 3BOWA 3PHXA 1PE6A 1MDWA 1X9YA 1ITOA 4QRXA 1PPDA 4BPVA 4MZOA 1EWLA 3O0UA 3MHSA 1F2BA 1CTEA 4D8IA 1Y08A 1JQPA 3K8UA 1BQIA 1S4VA 4XUIA 3H6SA 2R9NA 3F5VA 3KW9A 2VHFA 1STFE 5JH3A 1F2CA 4W5BA 1NPZA 4QH6A 2YJCA 4CDEB 4N8WA 4FIPA 4CZWA 2NQAA 2G6DA 2PBHA 1CPJA 5FPWA 5JA7A 2E03A 2FTDA 1U9XA 3ERVA 4I07A 5E6JA 3PT2A 2BTWB 1AYUA 1MEMA 2R9OA 4IUMA 1KHPA 1ZCMA 2OULA 4X6JA 3BB7A 4CDFB 1Y4HA 4PI3A 5A24A 2FUDA 2J7QC 4DMXA 1VSNA 3CBJA 3H7DA 1NL6A 1AYWA 1PPNA 2F1GA 3GCBA 3PBHA 1SNKA 9PAPA 4HXDB 1AU0A 3OQCA 4PP1A 3PHUA 4PP2E 2IBIA 4OEMA 2R9MA 3V6CA 1GECE 3BBAA 4CDDB 6PADA 4I04A 2WBFX 3RVWA 2E01A 4X6IA 5PADA 4A5UA 4CDCB 2H7JA 4AXLA 2GHUA 5F02A 4X6HA 5CVOB 3RNVA 2BDLA 3IEJA 1YALA 3MHHA 4W4UA 5EGWA 3KSEA 2VHSA 3CBKA 4BOUA 2CIOA 3I3TA 3D6SA 2FYEA 2XU1A 3N3KA 1K3BB 4OELA 1QDQA 2Y5BA 1PADA 1PPOA 1CB5A 4N79A 3F75A 1F29A 1CV8A 2YJ8A 1U9WA 2HD5A 2DJFB 1Q6KA 4IP3A 3PNRA 4REZA 1PCIA 1KFXL 2DOSA 2DCBA 2HWKA 3S3QA 4QRGA 4G54A 4BOZA 3LXSA 3OF9A 3PRPA 1VJVA 1KFUL 1U5IA 2BDZA 3PSEA 4BQVA 1AU4A 3P5VA 5JZEA 2FT2A 3OISA 3RVXA 3OVZA 2PREA 2B1NA 3E9SA 2XU3A 3LFYA 2HH5A 1U9VA 3BPFA 2F7DA 3IV2A 4YVAA 1UKFA 3HHIA 1PXVA 1NB3A 4ZTBA 1ME3A 1TL9A 3O1GA 1AIMA 3I06A 4BOPA 3AI8A 4Q8HA 2XU4A 2NQDB 2E02A 1DKIA 1PIPA 1CSBB 2Y6EA 4ZUXU 3TRKA 3MJ5A 4YV8A 3C0RA 1A6RA 3B21A 2J7QA 1MS6A 2AVWA 5K16A 4M0WA 4BSQA 4QRVA 4MI7A 2P7UA 3P5WA 2AS8A 1QOLA 4DMYA 4N4ZA 1THEA 2AGAA 3P5XA 2ARYA 1YZBA 1PVJA 3K9MA 1ATKA 2BU3A 3H89A 2DCAA 1YVBA 3K24A 5CVMA 2GFOA 3PHWA 3MP2A 3U8EA 3BC3A 2FQ9A 2OZ2A 3DF0A 1GLOA 1NLJA 2AYOA 2P86A 2NQIA 4W5CA 1U9QX 1DEUA 1HUCB 1AECA 1M6DA 5KO3A 1NQCA 3MTNA 3PRMA 4MM3B 2G8EA 1QXPA 2R9FA 2P0RA 3BPMA 2ATOA 4OW0A 5CHTA 2AYNA 3USVA 4YYQA 2JTCA 1AU2A 1YK8A 4YYUA 3NHEA 3CH3X 5CVNB 3E1ZB 1ME4A 4QBBA 3IOQA 3MORA 8PCHA 1CVZA 3WXEA 2B1MA 1KHQA 1YK7A 4R3DA 1EWPA 4KLBA 3M99A 1XKGA 3N4CA 2HXZA 1EWOA 1EWMA 3TNXA 2YJ2A 2AU1A 3CH2X 3S3RA 2YJ9A 2DZZA 3IHPA 2AUZA 3WXFA 4BOSA 3BCNA 3N3GA 4D8BA 1QMYA 4OVZA 2R6NA 2DCDA 4RKXA 3ZNHA 2OP3A 2FE8A 4D8EA 2JQFR 4RNAA 3OVXA 3B79A 3PDFA 3V6EA 2FO5A 2JQGR 3W30A 2NQGA 1KXRA 1GCBA 1MHWA 2DC8A 3KFQA 1SP4B 4BS5A 3KKUA 1CS8A 2O6XA 4BS6A 1CJLA 2AIMA 1BGOA 4RF1A 1AYVA 4Q8GA 1MEGA 4P16A 3HD3A 2JRIA 3QT4A 3QSDA 3MTVA 4PADA 2E00A 1ZIVA 4RY2A 4P6GA 1DF0A 4RF0A 1FH0A 1TLOA 3BY4A 4XR7A 1MIRA 2DC6A 1POPA 1CQDA 3KX1A 3C9EA 3H8CA 4XZXA 1NB5A 3BWKA 1F2AA 3ZUAA 2DZYA 2PNSA 1IWDA 2CB5A 5J94A 4BOQA 4YYVA 1O0EA 2UZJA 2Z84A 1EF7A 1YT7A 4YYRA 2DCCA 3IMAA 2FRAA 4P6EA 4PT5A 1AU3A 3TMPA 5EF4A 7PCKA 2BTWA 2G7YA 4YYWA 3KWBX 4FK5A 4YYSA 2DC7A 5EZQA 2ACTA 3W31A 4MSXA 3HHAA 2IPPB 1GMYA 2C0YA 4OVZB 2DC9A 4WURA 3KWZA 3IFUA 3O65A 2HHNA 1ICFA 3H8BA 3WXGA 4WA6A 3OF8A 3RVVA 2YJBA
chains in the Genus database with same CATH topology
2PADA 1BP4A 4MZSA 2R9CA 2XU5A 3HWNA 2DJGB 3IUTA 4FJCA 2FRQA 4AXMA 2AUXA 5CHVA 2G8JA 4I05A 1PBHA 1PPPA 1TU6A 3PW3A 1BY8A 3P5UA 4K7CA 4HWYA 3QJ3A 3BOWA 1PE6A 1MDWA 4GUZA 1X9YA 1ITOA 4QRXA 1PPDA 4BPVA 4MZOA 1EWLA 3O0UA 3MHSA 1F2BA 1CTEA 1Y08A 1JQPA 3K8UA 1BQIA 1S4VA 4XUIA 3H6SA 2R9NA 3F5VA 3KW9A 2VHFA 1STFE 5JH3A 1F2CA 4W5BA 1NPZA 4QH6A 2YJCA 4CDEB 4N8WA 4FIPA 4CZWA 2NQAA 2G6DA 2PBHA 1CPJA 5FPWA 5JA7A 2E03A 2FTDA 1U9XA 3ERVA 4I07A 1AYUA 1MEMA 2R9OA 1KHPA 1ZCMA 2OULA 4X6JA 1W6FA 4CDFB 1Y4HA 4PI3A 5A24A 2FUDA 4DMXA 1VSNA 3CBJA 3H7DA 1NL6A 1AYWA 1PPNA 2F1GA 3GCBA 3PBHA 1SNKA 9PAPA 1AU0A 4PP1A 4PP2E 2IBIA 4OEMA 2R9MA 3V6CA 1GECE 4CDDB 6PADA 4I04A 2WBFX 2BSZA 3RVWA 2E01A 4X6IA 5PADA 4CDCB 2H7JA 4AXLA 2GHUA 5F02A 4X6HA 5CVOB 2BDLA 3IEJA 1YALA 3MHHA 4W4UA 5EGWA 3KSEA 2VHSA 3CBKA 2CIOA 3I3TA 3D6SA 2FYEA 2XU1A 3N3KA 1K3BB 4OELA 1QDQA 2Y5BA 1PADA 1PPOA 1CB5A 4N79A 3F75A 1F29A 1CV8A 2YJ8A 1U9WA 2HD5A 3D9WA 1Q6KA 2DJFB 3PNRA 1PCIA 1KFXL 2DCBA 3S3QA 4QRGA 4G54A 3LXSA 3OF9A 1VJVA 1KFUL 1U5IA 2BDZA 4BQVA 1AU4A 3P5VA 2FT2A 3OISA 3RVXA 3OVZA 2PREA 2B1NA 2XU3A 3LFYA 2HH5A 1U9VA 3BPFA 2F7DA 3IV2A 4YVAA 3HHIA 1PXVA 1NB3A 1ME3A 1TL9A 3O1GA 1AIMA 3I06A 3AI8A 4Q8HA 2XU4A 2NQDB 2E02A 1PIPA 1CSBB 2Y6EA 4ZUXU 4YV8A 1A6RA 1MS6A 2AVWA 5K16A 4BSQA 4QRVA 4B55A 2P7UA 3P5WA 2AS8A 1QOLA 4DMYA 1GX3A 4N4ZA 1THEA 3P5XA 2ARYA 3K9MA 1ATKA 3H89A 2DCAA 1YVBA 3K24A 5CVMA 2GFOA 3U8EA 1W5RA 3BC3A 2FQ9A 2OZ2A 3DF0A 1GLOA 1NLJA 2AYOA 2P86A 2NQIA 4W5CA 1U9QX 1DEUA 1HUCB 1AECA 1M6DA 1NQCA 3MTNA 2G8EA 1QXPA 2R9FA 2P0RA 3BPMA 2ATOA 5CHTA 2AYNA 3USVA 4YYQA 4NV7A 1AU2A 1YK8A 4YYUA 3NHEA 3CH3X 5CVNB 3E1ZB 1ME4A 4QBBA 3IOQA 3MORA 8PCHA 1CVZA 3WXEA 2B1MA 1KHQA 1YK7A 1EWPA 4KLBA 3M99A 1XKGA 3N4CA 2HXZA 1EWOA 1EWMA 1W4TA 3TNXA 2YJ2A 2AU1A 3CH2X 3S3RA 2YJ9A 2DZZA 3IHPA 2AUZA 3WXFA 3BCNA 3N3GA 1QMYA 2R6NA 2DCDA 2OP3A 2JQFR 3OVXA 3B79A 3PDFA 3V6EA 2FO5A 2JQGR 2NQGA 1KXRA 1GCBA 1MHWA 2DC8A 3KFQA 1SP4B 4BS5A 3KKUA 1CS8A 2O6XA 4BS6A 1CJLA 2AIMA 1BGOA 1AYVA 4Q8GA 1MEGA 4BGFA 3HD3A 3QT4A 3QSDA 4PADA 2E00A 1ZIVA 4RY2A 4P6GA 1DF0A 4C5PA 1FH0A 1TLOA 4XR7A 1MIRA 2DC6A 2VFBA 4NV8A 1POPA 1CQDA 3KX1A 3C9EA 3H8CA 1NB5A 3BWKA 1F2AA 3ZUAA 2DZYA 2PNSA 1IWDA 2CB5A 5J94A 4YYVA 1O0EA 1EF7A 1YT7A 3LTWA 4YYRA 2DCCA 3IMAA 2FRAA 1E2TA 4P6EA 1AU3A 5EF4A 7PCKA 2G7YA 4YYWA 3KWBX 4FK5A 4YYSA 2VFCA 2DC7A 2ACTA 4MSXA 3HHAA 2IPPB 1GMYA 2C0YA 2DC9A 3KWZA 2HHNA 1ICFA 3H8BA 3WXGA 4WA6A 3OF8A 3RVVA 2YJBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PAD A;  1BP4 A;  4MZS A;  2R9C A;  2XU5 A;  3HWN A;  2DJG B;  3IUT A;  4FJC A;  2FRQ A;  4AXM A;  2AUX A;  5CHV A;  2G8J A;  4I05 A;  1PBH A;  1PPP A;  1TU6 A;  3PW3 A;  1BY8 A;  3P5U A;  4K7C A;  4HWY A;  3QJ3 A;  3BOW A;  1PE6 A;  1MDW A;  1X9Y A;  1ITO A;  4QRX A;  1PPD A;  4BPV A;  4MZO A;  1EWL A;  3O0U A;  3MHS A;  1F2B A;  1CTE A;  1Y08 A;  1JQP A;  3K8U A;  1BQI A;  1S4V A;  4XUI A;  3H6S A;  2R9N A;  3F5V A;  3KW9 A;  2VHF A;  1STF E;  5JH3 A;  1F2C A;  4W5B A;  1NPZ A;  4QH6 A;  2YJC A;  4CDE B;  4N8W A;  4FIP A;  4CZW A;  2NQA A;  2G6D A;  2PBH A;  1CPJ A;  5FPW A;  5JA7 A;  2E03 A;  2FTD A;  1U9X A;  3ERV A;  4I07 A;  1AYU A;  1MEM A;  2R9O A;  1KHP A;  1ZCM A;  2OUL A;  4X6J A;  4CDF B;  1Y4H A;  4PI3 A;  5A24 A;  2FUD A;  4DMX A;  1VSN A;  3CBJ A;  3H7D A;  1NL6 A;  1AYW A;  1PPN A;  2F1G A;  3GCB A;  3PBH A;  1SNK A;  9PAP A;  1AU0 A;  4PP1 A;  4PP2 E;  2IBI A;  4OEM A;  2R9M A;  3V6C A;  1GEC E;  4CDD B;  6PAD A;  4I04 A;  2WBF X;  3RVW A;  2E01 A;  4X6I A;  5PAD A;  4CDC B;  2H7J A;  4AXL A;  2GHU A;  5F02 A;  4X6H A;  5CVO B;  2BDL A;  3IEJ A;  1YAL A;  3MHH A;  4W4U A;  5EGW A;  3KSE A;  2VHS A;  3CBK A;  2CIO A;  3I3T A;  3D6S A;  2FYE A;  2XU1 A;  3N3K A;  1K3B B;  4OEL A;  1QDQ A;  2Y5B A;  1PAD A;  1PPO A;  1CB5 A;  4N79 A;  3F75 A;  1F29 A;  1CV8 A;  2YJ8 A;  1U9W A;  2HD5 A;  2DJF B;  1Q6K A;  3PNR A;  1PCI A;  1KFX L;  2DCB A;  3S3Q A;  4QRG A;  4G54 A;  3LXS A;  3OF9 A;  1VJV A;  1KFU L;  1U5I A;  2BDZ A;  4BQV A;  1AU4 A;  3P5V A;  2FT2 A;  3OIS A;  3RVX A;  3OVZ A;  2PRE A;  2B1N A;  2XU3 A;  3LFY A;  2HH5 A;  1U9V A;  3BPF A;  2F7D A;  3IV2 A;  4YVA A;  3HHI A;  1PXV A;  1NB3 A;  1ME3 A;  1TL9 A;  3O1G A;  1AIM A;  3I06 A;  3AI8 A;  4Q8H A;  2XU4 A;  2NQD B;  2E02 A;  1PIP A;  1CSB B;  2Y6E A;  4ZUX U;  4YV8 A;  1A6R A;  1MS6 A;  2AVW A;  5K16 A;  4BSQ A;  4QRV A;  2P7U A;  3P5W A;  2AS8 A;  1QOL A;  4DMY A;  4N4Z A;  1THE A;  3P5X A;  2ARY A;  3K9M A;  1ATK A;  3H89 A;  2DCA A;  1YVB A;  3K24 A;  5CVM A;  2GFO A;  3U8E A;  3BC3 A;  2FQ9 A;  2OZ2 A;  3DF0 A;  1GLO A;  1NLJ A;  2AYO A;  2P86 A;  2NQI A;  4W5C A;  1U9Q X;  1DEU A;  1HUC B;  1AEC A;  1M6D A;  1NQC A;  3MTN A;  2G8E A;  1QXP A;  2R9F A;  2P0R A;  3BPM A;  2ATO A;  5CHT A;  2AYN A;  3USV A;  4YYQ A;  1AU2 A;  1YK8 A;  4YYU A;  3NHE A;  3CH3 X;  5CVN B;  3E1Z B;  1ME4 A;  4QBB A;  3IOQ A;  3MOR A;  8PCH A;  1CVZ A;  3WXE A;  2B1M A;  1KHQ A;  1YK7 A;  1EWP A;  4KLB A;  3M99 A;  1XKG A;  3N4C A;  2HXZ A;  1EWO A;  1EWM A;  3TNX A;  2YJ2 A;  2AU1 A;  3CH2 X;  3S3R A;  2YJ9 A;  2DZZ A;  3IHP A;  2AUZ A;  3WXF A;  3BCN A;  3N3G A;  1QMY A;  2R6N A;  2DCD A;  2OP3 A;  2JQF R;  3OVX A;  3B79 A;  3PDF A;  3V6E A;  2FO5 A;  2JQG R;  2NQG A;  1KXR A;  1GCB A;  1MHW A;  2DC8 A;  3KFQ A;  1SP4 B;  4BS5 A;  3KKU A;  1CS8 A;  2O6X A;  4BS6 A;  1CJL A;  2AIM A;  1BGO A;  1AYV A;  4Q8G A;  1MEG A;  3HD3 A;  3QT4 A;  3QSD A;  4PAD A;  2E00 A;  1ZIV A;  4RY2 A;  4P6G A;  1DF0 A;  1FH0 A;  1TLO A;  4XR7 A;  1MIR A;  2DC6 A;  1POP A;  1CQD A;  3KX1 A;  3C9E A;  3H8C A;  1NB5 A;  3BWK A;  1F2A A;  3ZUA A;  2DZY A;  2PNS A;  1IWD A;  2CB5 A;  5J94 A;  4YYV A;  1O0E A;  1EF7 A;  1YT7 A;  4YYR A;  2DCC A;  3IMA A;  2FRA A;  4P6E A;  1AU3 A;  5EF4 A;  7PCK A;  2G7Y A;  4YYW A;  3KWB X;  4FK5 A;  4YYS A;  2DC7 A;  2ACT A;  4MSX A;  3HHA A;  2IPP B;  1GMY A;  2C0Y A;  2DC9 A;  3KWZ A;  2HHN A;  1ICF A;  3H8B A;  3WXG A;  4WA6 A;  3OF8 A;  3RVV A;  2YJB A; 
#chains in the Genus database with same CATH topology
 2PAD A;  1BP4 A;  4MZS A;  2R9C A;  2XU5 A;  3HWN A;  4GUA A;  2DJG B;  3IUT A;  4FJC A;  2FRQ A;  4AXM A;  2AUX A;  5CHV A;  2G8J A;  4I05 A;  1PBH A;  1PPP A;  1TU6 A;  3PW3 A;  1BY8 A;  5EZS A;  3P5U A;  4K7C A;  4HWY A;  3QJ3 A;  3BOW A;  3PHX A;  1PE6 A;  1MDW A;  1X9Y A;  1ITO A;  4QRX A;  1PPD A;  4BPV A;  4MZO A;  1EWL A;  3O0U A;  3MHS A;  1F2B A;  1CTE A;  4D8I A;  1Y08 A;  1JQP A;  3K8U A;  1BQI A;  1S4V A;  4XUI A;  3H6S A;  2R9N A;  3F5V A;  3KW9 A;  2VHF A;  1STF E;  5JH3 A;  1F2C A;  4W5B A;  1NPZ A;  4QH6 A;  2YJC A;  4CDE B;  4N8W A;  4FIP A;  4CZW A;  2NQA A;  2G6D A;  2PBH A;  1CPJ A;  5FPW A;  5JA7 A;  2E03 A;  2FTD A;  1U9X A;  3ERV A;  4I07 A;  5E6J A;  3PT2 A;  2BTW B;  1AYU A;  1MEM A;  2R9O A;  4IUM A;  1KHP A;  1ZCM A;  2OUL A;  4X6J A;  3BB7 A;  4CDF B;  1Y4H A;  4PI3 A;  5A24 A;  2FUD A;  2J7Q C;  4DMX A;  1VSN A;  3CBJ A;  3H7D A;  1NL6 A;  1AYW A;  1PPN A;  2F1G A;  3GCB A;  3PBH A;  1SNK A;  9PAP A;  4HXD B;  1AU0 A;  3OQC A;  4PP1 A;  3PHU A;  4PP2 E;  2IBI A;  4OEM A;  2R9M A;  3V6C A;  1GEC E;  3BBA A;  4CDD B;  6PAD A;  4I04 A;  2WBF X;  3RVW A;  2E01 A;  4X6I A;  5PAD A;  4A5U A;  4CDC B;  2H7J A;  4AXL A;  2GHU A;  5F02 A;  4X6H A;  5CVO B;  3RNV A;  2BDL A;  3IEJ A;  1YAL A;  3MHH A;  4W4U A;  5EGW A;  3KSE A;  2VHS A;  3CBK A;  4BOU A;  2CIO A;  3I3T A;  3D6S A;  2FYE A;  2XU1 A;  3N3K A;  1K3B B;  4OEL A;  1QDQ A;  2Y5B A;  1PAD A;  1PPO A;  1CB5 A;  4N79 A;  3F75 A;  1F29 A;  1CV8 A;  2YJ8 A;  1U9W A;  2HD5 A;  2DJF B;  1Q6K A;  4IP3 A;  3PNR A;  4REZ A;  1PCI A;  1KFX L;  2DOS A;  2DCB A;  2HWK A;  3S3Q A;  4QRG A;  4G54 A;  4BOZ A;  3LXS A;  3OF9 A;  3PRP A;  1VJV A;  1KFU L;  1U5I A;  2BDZ A;  3PSE A;  4BQV A;  1AU4 A;  3P5V A;  5JZE A;  2FT2 A;  3OIS A;  3RVX A;  3OVZ A;  2PRE A;  2B1N A;  3E9S A;  2XU3 A;  3LFY A;  2HH5 A;  1U9V A;  3BPF A;  2F7D A;  3IV2 A;  4YVA A;  1UKF A;  3HHI A;  1PXV A;  1NB3 A;  4ZTB A;  1ME3 A;  1TL9 A;  3O1G A;  1AIM A;  3I06 A;  4BOP A;  3AI8 A;  4Q8H A;  2XU4 A;  2NQD B;  2E02 A;  1DKI A;  1PIP A;  1CSB B;  2Y6E A;  4ZUX U;  3TRK A;  3MJ5 A;  4YV8 A;  3C0R A;  1A6R A;  3B21 A;  2J7Q A;  1MS6 A;  2AVW A;  5K16 A;  4M0W A;  4BSQ A;  4QRV A;  4MI7 A;  2P7U A;  3P5W A;  2AS8 A;  1QOL A;  4DMY A;  4N4Z A;  1THE A;  2AGA A;  3P5X A;  2ARY A;  1YZB A;  1PVJ A;  3K9M A;  1ATK A;  2BU3 A;  3H89 A;  2DCA A;  1YVB A;  3K24 A;  5CVM A;  2GFO A;  3PHW A;  3MP2 A;  3U8E A;  3BC3 A;  2FQ9 A;  2OZ2 A;  3DF0 A;  1GLO A;  1NLJ A;  2AYO A;  2P86 A;  2NQI A;  4W5C A;  1U9Q X;  1DEU A;  1HUC B;  1AEC A;  1M6D A;  5KO3 A;  1NQC A;  3MTN A;  3PRM A;  4MM3 B;  2G8E A;  1QXP A;  2R9F A;  2P0R A;  3BPM A;  2ATO A;  4OW0 A;  5CHT A;  2AYN A;  3USV A;  4YYQ A;  2JTC A;  1AU2 A;  1YK8 A;  4YYU A;  3NHE A;  3CH3 X;  5CVN B;  3E1Z B;  1ME4 A;  4QBB A;  3IOQ A;  3MOR A;  8PCH A;  1CVZ A;  3WXE A;  2B1M A;  1KHQ A;  1YK7 A;  4R3D A;  1EWP A;  4KLB A;  3M99 A;  1XKG A;  3N4C A;  2HXZ A;  1EWO A;  1EWM A;  3TNX A;  2YJ2 A;  2AU1 A;  3CH2 X;  3S3R A;  2YJ9 A;  2DZZ A;  3IHP A;  2AUZ A;  3WXF A;  4BOS A;  3BCN A;  3N3G A;  4D8B A;  1QMY A;  4OVZ A;  2R6N A;  2DCD A;  4RKX A;  3ZNH A;  2OP3 A;  2FE8 A;  4D8E A;  2JQF R;  4RNA A;  3OVX A;  3B79 A;  3PDF A;  3V6E A;  2FO5 A;  2JQG R;  3W30 A;  2NQG A;  1KXR A;  1GCB A;  1MHW A;  2DC8 A;  3KFQ A;  1SP4 B;  4BS5 A;  3KKU A;  1CS8 A;  2O6X A;  4BS6 A;  1CJL A;  2AIM A;  1BGO A;  4RF1 A;  1AYV A;  4Q8G A;  1MEG A;  4P16 A;  3HD3 A;  2JRI A;  3QT4 A;  3QSD A;  3MTV A;  4PAD A;  2E00 A;  1ZIV A;  4RY2 A;  4P6G A;  1DF0 A;  4RF0 A;  1FH0 A;  1TLO A;  3BY4 A;  4XR7 A;  1MIR A;  2DC6 A;  1POP A;  1CQD A;  3KX1 A;  3C9E A;  3H8C A;  4XZX A;  1NB5 A;  3BWK A;  1F2A A;  3ZUA A;  2DZY A;  2PNS A;  1IWD A;  2CB5 A;  5J94 A;  4BOQ A;  4YYV A;  1O0E A;  2UZJ A;  2Z84 A;  1EF7 A;  1YT7 A;  4YYR A;  2DCC A;  3IMA A;  2FRA A;  4P6E A;  4PT5 A;  1AU3 A;  3TMP A;  5EF4 A;  7PCK A;  2BTW A;  2G7Y A;  4YYW A;  3KWB X;  4FK5 A;  4YYS A;  2DC7 A;  5EZQ A;  2ACT A;  3W31 A;  4MSX A;  3HHA A;  2IPP B;  1GMY A;  2C0Y A;  4OVZ B;  2DC9 A;  4WUR A;  3KWZ A;  3IFU A;  3O65 A;  2HHN A;  1ICF A;  3H8B A;  3WXG A;  4WA6 A;  3OF8 A;  3RVV A;  2YJB A; 
#chains in the Genus database with same CATH homology
 2PAD A;  1BP4 A;  4MZS A;  2R9C A;  2XU5 A;  3HWN A;  2DJG B;  3IUT A;  4FJC A;  2FRQ A;  4AXM A;  2AUX A;  5CHV A;  2G8J A;  4I05 A;  1PBH A;  1PPP A;  1TU6 A;  3PW3 A;  1BY8 A;  3P5U A;  4K7C A;  4HWY A;  3QJ3 A;  3BOW A;  1PE6 A;  1MDW A;  4GUZ A;  1X9Y A;  1ITO A;  4QRX A;  1PPD A;  4BPV A;  4MZO A;  1EWL A;  3O0U A;  3MHS A;  1F2B A;  1CTE A;  1Y08 A;  1JQP A;  3K8U A;  1BQI A;  1S4V A;  4XUI A;  3H6S A;  2R9N A;  3F5V A;  3KW9 A;  2VHF A;  1STF E;  5JH3 A;  1F2C A;  4W5B A;  1NPZ A;  4QH6 A;  2YJC A;  4CDE B;  4N8W A;  4FIP A;  4CZW A;  2NQA A;  2G6D A;  2PBH A;  1CPJ A;  5FPW A;  5JA7 A;  2E03 A;  2FTD A;  1U9X A;  3ERV A;  4I07 A;  1AYU A;  1MEM A;  2R9O A;  1KHP A;  1ZCM A;  2OUL A;  4X6J A;  1W6F A;  4CDF B;  1Y4H A;  4PI3 A;  5A24 A;  2FUD A;  4DMX A;  1VSN A;  3CBJ A;  3H7D A;  1NL6 A;  1AYW A;  1PPN A;  2F1G A;  3GCB A;  3PBH A;  1SNK A;  9PAP A;  1AU0 A;  4PP1 A;  4PP2 E;  2IBI A;  4OEM A;  2R9M A;  3V6C A;  1GEC E;  4CDD B;  6PAD A;  4I04 A;  2WBF X;  2BSZ A;  3RVW A;  2E01 A;  4X6I A;  5PAD A;  4CDC B;  2H7J A;  4AXL A;  2GHU A;  5F02 A;  4X6H A;  5CVO B;  2BDL A;  3IEJ A;  1YAL A;  3MHH A;  4W4U A;  5EGW A;  3KSE A;  2VHS A;  3CBK A;  2CIO A;  3I3T A;  3D6S A;  2FYE A;  2XU1 A;  3N3K A;  1K3B B;  4OEL A;  1QDQ A;  2Y5B A;  1PAD A;  1PPO A;  1CB5 A;  4N79 A;  3F75 A;  1F29 A;  1CV8 A;  2YJ8 A;  1U9W A;  2HD5 A;  3D9W A;  1Q6K A;  2DJF B;  3PNR A;  1PCI A;  1KFX L;  2DCB A;  3S3Q A;  4QRG A;  4G54 A;  3LXS A;  3OF9 A;  1VJV A;  1KFU L;  1U5I A;  2BDZ A;  4BQV A;  1AU4 A;  3P5V A;  2FT2 A;  3OIS A;  3RVX A;  3OVZ A;  2PRE A;  2B1N A;  2XU3 A;  3LFY A;  2HH5 A;  1U9V A;  3BPF A;  2F7D A;  3IV2 A;  4YVA A;  3HHI A;  1PXV A;  1NB3 A;  1ME3 A;  1TL9 A;  3O1G A;  1AIM A;  3I06 A;  3AI8 A;  4Q8H A;  2XU4 A;  2NQD B;  2E02 A;  1PIP A;  1CSB B;  2Y6E A;  4ZUX U;  4YV8 A;  1A6R A;  1MS6 A;  2AVW A;  5K16 A;  4BSQ A;  4QRV A;  4B55 A;  2P7U A;  3P5W A;  2AS8 A;  1QOL A;  4DMY A;  1GX3 A;  4N4Z A;  1THE A;  3P5X A;  2ARY A;  3K9M A;  1ATK A;  3H89 A;  2DCA A;  1YVB A;  3K24 A;  5CVM A;  2GFO A;  3U8E A;  1W5R A;  3BC3 A;  2FQ9 A;  2OZ2 A;  3DF0 A;  1GLO A;  1NLJ A;  2AYO A;  2P86 A;  2NQI A;  4W5C A;  1U9Q X;  1DEU A;  1HUC B;  1AEC A;  1M6D A;  1NQC A;  3MTN A;  2G8E A;  1QXP A;  2R9F A;  2P0R A;  3BPM A;  2ATO A;  5CHT A;  2AYN A;  3USV A;  4YYQ A;  4NV7 A;  1AU2 A;  1YK8 A;  4YYU A;  3NHE A;  3CH3 X;  5CVN B;  3E1Z B;  1ME4 A;  4QBB A;  3IOQ A;  3MOR A;  8PCH A;  1CVZ A;  3WXE A;  2B1M A;  1KHQ A;  1YK7 A;  1EWP A;  4KLB A;  3M99 A;  1XKG A;  3N4C A;  2HXZ A;  1EWO A;  1EWM A;  1W4T A;  3TNX A;  2YJ2 A;  2AU1 A;  3CH2 X;  3S3R A;  2YJ9 A;  2DZZ A;  3IHP A;  2AUZ A;  3WXF A;  3BCN A;  3N3G A;  1QMY A;  2R6N A;  2DCD A;  2OP3 A;  2JQF R;  3OVX A;  3B79 A;  3PDF A;  3V6E A;  2FO5 A;  2JQG R;  2NQG A;  1KXR A;  1GCB A;  1MHW A;  2DC8 A;  3KFQ A;  1SP4 B;  4BS5 A;  3KKU A;  1CS8 A;  2O6X A;  4BS6 A;  1CJL A;  2AIM A;  1BGO A;  1AYV A;  4Q8G A;  1MEG A;  4BGF A;  3HD3 A;  3QT4 A;  3QSD A;  4PAD A;  2E00 A;  1ZIV A;  4RY2 A;  4P6G A;  1DF0 A;  4C5P A;  1FH0 A;  1TLO A;  4XR7 A;  1MIR A;  2DC6 A;  2VFB A;  4NV8 A;  1POP A;  1CQD A;  3KX1 A;  3C9E A;  3H8C A;  1NB5 A;  3BWK A;  1F2A A;  3ZUA A;  2DZY A;  2PNS A;  1IWD A;  2CB5 A;  5J94 A;  4YYV A;  1O0E A;  1EF7 A;  1YT7 A;  3LTW A;  4YYR A;  2DCC A;  3IMA A;  2FRA A;  1E2T A;  4P6E A;  1AU3 A;  5EF4 A;  7PCK A;  2G7Y A;  4YYW A;  3KWB X;  4FK5 A;  4YYS A;  2VFC A;  2DC7 A;  2ACT A;  4MSX A;  3HHA A;  2IPP B;  1GMY A;  2C0Y A;  2DC9 A;  3KWZ A;  2HHN A;  1ICF A;  3H8B A;  3WXG A;  4WA6 A;  3OF8 A;  3RVV A;  2YJB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...