1THEA

Crystal structures of recombinant rat cathepsin b and a cathepsin b-inhibitor complex: implications for structure-based inhibitor design
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
253
structure length
253
Chain Sequence
LPESFDAREQWSNCPTIAQIRDQGSCGSCWAFGAVEAMSDRICIHTNGRVNVEVSAEDLLTCCGIQCGDGCNGGYPSGAWNFWTRKGLVSGGVYNSHIGCLPYTIPPCEHHVNGARPPCTGEGDTPKCNKMCEAGYSTSYKEDKHYGYTSYSVSDSEKEIMAEIYKNGPVEGAFTVFSDFLTYKSGVYKHEAGDVMGGHAIRILGWGIENGVPYWLVANSWNADWGDNGFFKILRGENHCGIESEIVAGIPRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cathepsin B
publication title Crystal structures of recombinant rat cathepsin B and a cathepsin B-inhibitor complex. Implications for structure-based inhibitor design.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase/hydrolase inhibitor
total genus 75
structure length 253
sequence length 253
chains with identical sequence B
ec nomenclature ec 3.4.22.1: Cathepsin B.
pdb deposition date 1995-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1theA00
2DJFB 3BC3A 2Y5BA 1U9QX 2OP3A 3ERVA 3P5UA 2AUZA 2DC8A 2FUDA 2IPPB 3OF9A 1ME3A 1PPNA 1SP4B 4YYWA 3KWZA 3HD3A 2G7YA 3KKUA 3P5XA 3CBJA 4PP2E 1QMYA 3KW9A 3K24A 3PDFA 3KWBX 4FIPA 1EWLA 3PW3A 1PIPA 5JH3A 2R9NA 1ITOA 2DC6A 3N4CA 2XU3A 3BWKA 1ZCMA 2E02A 3PNRA 3H6SA 2F7DA 2PREA 3MHSA 4PP1A 2G8JA 3E1ZB 2HXZA 3OVXA 1A6RA 1AU4A 2AUXA 3WXFA 3KSEA 1PPPA 4YYUA 4OEMA 1NQCA 2AU1A 3IV2A 1AU3A 3KX1A 2XU5A 1VJVA 2IBIA 5CHVA 1QXPA 4CDDB 4I07A 2R9CA 1S4VA 1PBHA 1STFE 3RVVA 1CB5A 2YJ9A 1VSNA 1QDQA 4AXMA 4CZWA 1O0EA 3IMAA 4K7CA 2DCCA 3V6CA 1DF0A 3OVZA 1AECA 4YVAA 1NB5A 1TU6A 2HH5A 5J94A 2ACTA 1CJLA 3M99A 4I04A 3TNXA 4X6JA 1YK7A 2E03A 1AU2A 3D6SA 1POPA 2AS8A 4YV8A 1U9XA 1AYVA 3OISA 3F75A 4X6IA 2XU1A 4DMYA 2HD5A 2HHNA 5CVOB 4QH6A 2JQFR 4I05A 2DC9A 7PCKA 3BOWA 2AYOA 2FQ9A 3MORA 4W5CA 2R9OA 3HHAA 3N3GA 4RY2A 4WA6A 2WBFX 4QRXA 1AYUA 2ARYA 1AIMA 8PCHA 2VHSA 5PADA 1X9YA 3F5VA 4BQVA 1GMYA 1KFXL 4PADA 2H7JA 3IHPA 2P86A 2C0YA 3CH3X 4X6HA 1EWPA 1PPOA 2FT2A 4P6GA 4CDEB 2BDLA 3NHEA 1XKGA 3K9MA 3B79A 1F2CA 6PADA 1F29A 4DMXA 1HUCB 1F2BA 4W5BA 2OULA 3S3RA 4XR7A 1BP4A 2R9MA 4G54A 4P6EA 2JQGR 5CVMA 1K3BB 3IUTA 2CIOA 3RVWA 2FYEA 5A24A 2E01A 2DJGB 2Y6EA 1GECE 3H8BA 1YVBA 1QOLA 1PCIA 3P5WA 1F2AA 3PBHA 2NQDB 2GHUA 2P7UA 2FO5A 3N3KA 1BGOA 4N4ZA 1EWOA 1CTEA 2YJ2A 2YJ8A 1YALA 4MZSA 1AYWA 2FRQA 4PI3A 1Y08A 4QRGA 1MEMA 4HWYA 2E00A 1KHPA 3I3TA 2OZ2A 4YYSA 5EGWA 1IWDA 3AI8A 2DCDA 3O0UA 2FTDA 4ZUXU 3DF0A 2ATOA 3QJ3A 1BY8A 2AYNA 4MZOA 1TLOA 4N79A 2F1GA 3OF8A 1EWMA 1PE6A 2O6XA 3HWNA 5K16A 1ICFA 4BS5A 4XUIA 4AXLA 1KFUL 2G8EA 2NQIA 2R9FA 3LXSA 5CHTA 2AVWA 3USVA 1U5IA 1SNKA 2DZYA 3H89A 2PADA 2NQGA 5F02A 3IEJA 4Q8HA 3H8CA 4BSQA 1AU0A 4W4UA 1YK8A 2GFOA 1PPDA 1PXVA 2YJCA 3C9EA 3MTNA 4BPVA 1NPZA 3U8EA 3CH2X 1YT7A 1GLOA 2BDZA 3LFYA 3ZUAA 1NLJA 5CVNB 1ZIVA 2B1NA 1CS8A 1BQIA 4CDCB 3KFQA 2DCBA 3GCBA 5JA7A 3HHIA 4CDFB 4YYRA 2DCAA 1MS6A 4MSXA 3CBKA 1MIRA 3IOQA 4OELA 1U9VA 2YJBA 3MHHA 3RVXA 4QBBA 3P5VA 2PNSA 2FRAA 1TL9A 3S3QA 4FK5A 2AIMA 3WXEA 1NL6A 1Y4HA 2CB5A 1FH0A 1CQDA 9PAPA 2R6NA 1KXRA 3BPMA 1PADA 2XU4A 1ATKA 1JQPA 3O1GA 2B1MA 2NQAA 2DZZA 3BPFA 1M6DA 4N8WA 1NB3A 1KHQA 1Q6KA 1EF7A 4BS6A 4YYQA 3QSDA 1CSBB 2G6DA 3I06A 2PBHA 4Q8GA 3H7DA 2DC7A 2VHFA 1MEGA 1THEA 2P0RA 1CPJA 4QRVA 1CV8A 5EF4A 1MDWA 1DEUA 3V6EA 4KLBA 4FJCA 3K8UA 3BCNA 3QT4A 3WXGA 1ME4A 1GCBA 1CVZA 1U9WA 4YYVA 1MHWA 5FPWA
chains in the Genus database with same CATH superfamily
2DJFB 2HWKA 3BC3A 2Y5BA 1U9QX 2OP3A 3ERVA 3IFUA 3P5UA 2AUZA 2DC8A 2FUDA 2IPPB 4BOZA 3OF9A 1ME3A 1PPNA 1SP4B 4YYWA 3KWZA 3HD3A 2G7YA 3KKUA 3P5XA 3CBJA 4PP2E 3ZNHA 1QMYA 3KW9A 3K24A 3PDFA 3KWBX 2UZJA 4FIPA 1EWLA 3PW3A 1PIPA 5JH3A 2R9NA 1ITOA 2DC6A 3N4CA 2XU3A 3BWKA 3E9SA 1ZCMA 2E02A 3PNRA 3H6SA 2F7DA 2PREA 4D8BA 3MHSA 4PP1A 2G8JA 3E1ZB 2HXZA 3OVXA 1A6RA 1AU4A 2AUXA 3WXFA 3KSEA 1PPPA 5KO3A 4YYUA 4OEMA 1NQCA 2AU1A 3IV2A 1AU3A 3KX1A 2XU5A 3MP2A 1VJVA 2IBIA 5CHVA 1QXPA 4RF1A 3O65A 4CDDB 4I07A 2R9CA 1S4VA 1PBHA 1STFE 3RVVA 4XZXA 1CB5A 2YJ9A 1VSNA 1QDQA 4AXMA 4CZWA 1O0EA 3IMAA 4BOQA 4K7CA 2DCCA 3V6CA 1DF0A 3OVZA 1AECA 4YVAA 3BB7A 1NB5A 1TU6A 2HH5A 5J94A 2BTWA 2ACTA 1CJLA 3M99A 4I04A 3TNXA 4X6JA 4BOSA 1YK7A 2E03A 1AU2A 3D6SA 1POPA 2AS8A 4YV8A 1U9XA 1AYVA 3OISA 3F75A 3PHWA 4X6IA 3OQCA 4D8IA 2XU1A 4DMYA 2HD5A 2HHNA 5CVOB 4QH6A 2JQFR 4I05A 2DC9A 7PCKA 4REZA 3BOWA 2AYOA 2FQ9A 3MORA 4W5CA 2R9OA 3HHAA 3N3GA 3W31A 4RY2A 4WA6A 2WBFX 2Z84A 4QRXA 1AYUA 2ARYA 1AIMA 8PCHA 2VHSA 3PRMA 5PADA 1X9YA 3F5VA 4BQVA 1GMYA 1KFXL 4PADA 1PVJA 2H7JA 2J7QC 3IHPA 3PT2A 2P86A 2C0YA 3CH3X 4M0WA 4X6HA 1EWPA 1PPOA 2FT2A 4R3DA 4P6GA 4MI7A 2FE8A 4CDEB 3PHXA 2BDLA 3NHEA 1XKGA 3K9MA 3B79A 3BBAA 4OVZB 1F2CA 6PADA 1F29A 4DMXA 1HUCB 1F2BA 4W5BA 2OULA 3S3RA 4XR7A 1BP4A 2R9MA 4G54A 4P6EA 2JQGR 5CVMA 1K3BB 3IUTA 2CIOA 3RVWA 2FYEA 5A24A 2E01A 2DJGB 2Y6EA 3PHUA 4PT5A 5EZQA 1GECE 3H8BA 1YVBA 1QOLA 4ZTBA 1PCIA 2DOSA 4RKXA 3P5WA 1F2AA 3PBHA 2NQDB 2GHUA 3C0RA 1UKFA 5EZSA 2P7UA 3RNVA 4P16A 2FO5A 3N3KA 1BGOA 4N4ZA 1EWOA 1CTEA 2YJ2A 2YJ8A 1YALA 4MZSA 1AYWA 2FRQA 4PI3A 1Y08A 4HXDB 4QRGA 1MEMA 4HWYA 2E00A 1KHPA 3I3TA 2OZ2A 4YYSA 5EGWA 4GUAA 2JTCA 1IWDA 3AI8A 5JZEA 2DCDA 3O0UA 2BU3A 4WURA 2FTDA 4ZUXU 3DF0A 2ATOA 3QJ3A 1BY8A 2AYNA 4MZOA 1TLOA 4N79A 2F1GA 3OF8A 4OW0A 4A5UA 1EWMA 1PE6A 2O6XA 3HWNA 5K16A 1YZBA 2J7QA 1ICFA 4BS5A 4XUIA 4AXLA 1KFUL 2G8EA 2NQIA 2R9FA 3LXSA 5CHTA 5E6JA 3BY4A 2AVWA 3USVA 1U5IA 1SNKA 2DZYA 3H89A 2PADA 2NQGA 5F02A 4BOPA 3TMPA 3IEJA 4MM3B 4Q8HA 4IP3A 3H8CA 4BSQA 1AU0A 3MJ5A 4W4UA 1YK8A 1DKIA 2GFOA 1PPDA 1PXVA 2YJCA 3C9EA 3MTNA 2AGAA 4BPVA 1NPZA 3U8EA 3CH2X 1YT7A 1GLOA 2BDZA 3LFYA 3ZUAA 1NLJA 5CVNB 1ZIVA 4RF0A 2B1NA 1CS8A 1BQIA 4CDCB 3KFQA 2DCBA 3GCBA 5JA7A 3HHIA 4CDFB 4YYRA 2DCAA 1MS6A 4MSXA 3CBKA 1MIRA 3IOQA 4OELA 1U9VA 2YJBA 3TRKA 3MHHA 3RVXA 4OVZA 4QBBA 2JRIA 3P5VA 2PNSA 2FRAA 4RNAA 1TL9A 2BTWB 3S3QA 4FK5A 2AIMA 3WXEA 1NL6A 3W30A 4IUMA 1Y4HA 2CB5A 1FH0A 1CQDA 9PAPA 2R6NA 1KXRA 3BPMA 1PADA 2XU4A 1ATKA 1JQPA 3O1GA 2B1MA 2NQAA 2DZZA 3PRPA 3BPFA 1M6DA 4N8WA 1NB3A 1KHQA 1Q6KA 1EF7A 4BS6A 4YYQA 3QSDA 4BOUA 1CSBB 2G6DA 3I06A 2PBHA 4Q8GA 3H7DA 2DC7A 4D8EA 2VHFA 3B21A 1MEGA 3MTVA 1THEA 2P0RA 1CPJA 4QRVA 3PSEA 1CV8A 5EF4A 1MDWA 1DEUA 3V6EA 4KLBA 4FJCA 3K8UA 3BCNA 3QT4A 3WXGA 1ME4A 1GCBA 1CVZA 1U9WA 4YYVA 1MHWA 5FPWA
chains in the Genus database with same CATH topology
2DJFB 3BC3A 2Y5BA 1U9QX 2OP3A 3ERVA 3P5UA 2AUZA 2DC8A 2FUDA 2IPPB 3OF9A 1ME3A 1PPNA 1SP4B 4YYWA 3KWZA 3HD3A 2G7YA 3KKUA 1W6FA 3P5XA 3CBJA 4PP2E 1QMYA 3KW9A 3K24A 3PDFA 3KWBX 4FIPA 1EWLA 3PW3A 1PIPA 5JH3A 2R9NA 1ITOA 2DC6A 3N4CA 2XU3A 3BWKA 1ZCMA 2E02A 3PNRA 3H6SA 2F7DA 2PREA 3MHSA 4PP1A 2G8JA 3E1ZB 2HXZA 3OVXA 2VFCA 1A6RA 1AU4A 2AUXA 3WXFA 3KSEA 1PPPA 4YYUA 4OEMA 1NQCA 2AU1A 3IV2A 1AU3A 3KX1A 2XU5A 1VJVA 2BSZA 3D9WA 2IBIA 5CHVA 1QXPA 4CDDB 4I07A 2R9CA 1S4VA 1PBHA 1STFE 3RVVA 1CB5A 2YJ9A 1VSNA 1QDQA 4AXMA 4CZWA 1O0EA 3IMAA 4K7CA 2DCCA 3V6CA 1DF0A 3OVZA 1AECA 4YVAA 1NB5A 1TU6A 2HH5A 5J94A 2ACTA 1CJLA 3M99A 4I04A 3TNXA 4X6JA 1YK7A 2E03A 1AU2A 3D6SA 1POPA 2AS8A 4YV8A 1U9XA 1AYVA 3OISA 3F75A 4X6IA 2XU1A 4DMYA 2HD5A 2HHNA 5CVOB 4QH6A 2JQFR 4I05A 2DC9A 7PCKA 3BOWA 2AYOA 2FQ9A 3MORA 4W5CA 2R9OA 3HHAA 3N3GA 4RY2A 4WA6A 2WBFX 4QRXA 1AYUA 2ARYA 1AIMA 8PCHA 2VHSA 5PADA 1X9YA 3F5VA 4BQVA 4B55A 2VFBA 1GMYA 1KFXL 4PADA 2H7JA 3IHPA 2P86A 2C0YA 3CH3X 4X6HA 1EWPA 1PPOA 2FT2A 4P6GA 4CDEB 2BDLA 3NHEA 1XKGA 3K9MA 3B79A 1F2CA 6PADA 1F29A 4DMXA 1HUCB 1F2BA 4W5BA 2OULA 3S3RA 4XR7A 1BP4A 2R9MA 4G54A 4P6EA 2JQGR 5CVMA 1K3BB 3IUTA 2CIOA 3RVWA 2FYEA 5A24A 2E01A 2DJGB 2Y6EA 1GECE 3H8BA 1YVBA 1QOLA 1PCIA 3P5WA 1F2AA 3PBHA 2NQDB 2GHUA 2P7UA 2FO5A 3N3KA 1BGOA 4N4ZA 1EWOA 1CTEA 2YJ2A 2YJ8A 1YALA 4MZSA 1AYWA 2FRQA 4PI3A 1Y08A 4QRGA 1MEMA 4HWYA 2E00A 1KHPA 3I3TA 2OZ2A 4YYSA 5EGWA 1IWDA 3AI8A 2DCDA 3O0UA 2FTDA 4ZUXU 3DF0A 2ATOA 3QJ3A 1BY8A 2AYNA 1E2TA 4MZOA 1TLOA 4N79A 2F1GA 3OF8A 1EWMA 1PE6A 4BGFA 2O6XA 3HWNA 5K16A 4C5PA 1ICFA 4BS5A 4XUIA 4AXLA 1KFUL 2G8EA 2NQIA 2R9FA 3LXSA 5CHTA 2AVWA 3USVA 1U5IA 1SNKA 2DZYA 3H89A 2PADA 2NQGA 5F02A 3IEJA 4Q8HA 4GUZA 3H8CA 1W5RA 4BSQA 1AU0A 4W4UA 1YK8A 2GFOA 1PPDA 4NV8A 1PXVA 2YJCA 3C9EA 3LTWA 3MTNA 4BPVA 1NPZA 3U8EA 1GX3A 3CH2X 1YT7A 1GLOA 2BDZA 3LFYA 3ZUAA 1NLJA 5CVNB 1ZIVA 2B1NA 1CS8A 1BQIA 4CDCB 3KFQA 2DCBA 3GCBA 5JA7A 3HHIA 4CDFB 4YYRA 2DCAA 1MS6A 4MSXA 3CBKA 1MIRA 3IOQA 4OELA 1U9VA 2YJBA 3MHHA 3RVXA 4QBBA 3P5VA 2PNSA 2FRAA 1TL9A 3S3QA 4FK5A 2AIMA 3WXEA 1NL6A 1Y4HA 2CB5A 1FH0A 1CQDA 9PAPA 2R6NA 1KXRA 3BPMA 1PADA 2XU4A 1ATKA 1JQPA 3O1GA 2B1MA 2NQAA 2DZZA 1W4TA 1M6DA 3BPFA 4N8WA 1NB3A 1KHQA 1Q6KA 1EF7A 4BS6A 4YYQA 3QSDA 1CSBB 2G6DA 3I06A 2PBHA 4Q8GA 3H7DA 2DC7A 2VHFA 1MEGA 1THEA 2P0RA 1CPJA 4QRVA 1CV8A 5EF4A 1MDWA 1DEUA 3V6EA 4KLBA 4FJCA 3K8UA 3BCNA 3QT4A 3WXGA 1ME4A 1GCBA 1CVZA 1U9WA 4YYVA 1MHWA 4NV7A 5FPWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DJF B;  3BC3 A;  2Y5B A;  1U9Q X;  2OP3 A;  3ERV A;  3P5U A;  2AUZ A;  2DC8 A;  2FUD A;  2IPP B;  3OF9 A;  1ME3 A;  1PPN A;  1SP4 B;  4YYW A;  3KWZ A;  3HD3 A;  2G7Y A;  3KKU A;  3P5X A;  3CBJ A;  4PP2 E;  1QMY A;  3KW9 A;  3K24 A;  3PDF A;  3KWB X;  4FIP A;  1EWL A;  3PW3 A;  1PIP A;  5JH3 A;  2R9N A;  1ITO A;  2DC6 A;  3N4C A;  2XU3 A;  3BWK A;  1ZCM A;  2E02 A;  3PNR A;  3H6S A;  2F7D A;  2PRE A;  3MHS A;  4PP1 A;  2G8J A;  3E1Z B;  2HXZ A;  3OVX A;  1A6R A;  1AU4 A;  2AUX A;  3WXF A;  3KSE A;  1PPP A;  4YYU A;  4OEM A;  1NQC A;  2AU1 A;  3IV2 A;  1AU3 A;  3KX1 A;  2XU5 A;  1VJV A;  2IBI A;  5CHV A;  1QXP A;  4CDD B;  4I07 A;  2R9C A;  1S4V A;  1PBH A;  1STF E;  3RVV A;  1CB5 A;  2YJ9 A;  1VSN A;  1QDQ A;  4AXM A;  4CZW A;  1O0E A;  3IMA A;  4K7C A;  2DCC A;  3V6C A;  1DF0 A;  3OVZ A;  1AEC A;  4YVA A;  1NB5 A;  1TU6 A;  2HH5 A;  5J94 A;  2ACT A;  1CJL A;  3M99 A;  4I04 A;  3TNX A;  4X6J A;  1YK7 A;  2E03 A;  1AU2 A;  3D6S A;  1POP A;  2AS8 A;  4YV8 A;  1U9X A;  1AYV A;  3OIS A;  3F75 A;  4X6I A;  2XU1 A;  4DMY A;  2HD5 A;  2HHN A;  5CVO B;  4QH6 A;  2JQF R;  4I05 A;  2DC9 A;  7PCK A;  3BOW A;  2AYO A;  2FQ9 A;  3MOR A;  4W5C A;  2R9O A;  3HHA A;  3N3G A;  4RY2 A;  4WA6 A;  2WBF X;  4QRX A;  1AYU A;  2ARY A;  1AIM A;  8PCH A;  2VHS A;  5PAD A;  1X9Y A;  3F5V A;  4BQV A;  1GMY A;  1KFX L;  4PAD A;  2H7J A;  3IHP A;  2P86 A;  2C0Y A;  3CH3 X;  4X6H A;  1EWP A;  1PPO A;  2FT2 A;  4P6G A;  4CDE B;  2BDL A;  3NHE A;  1XKG A;  3K9M A;  3B79 A;  1F2C A;  6PAD A;  1F29 A;  4DMX A;  1HUC B;  1F2B A;  4W5B A;  2OUL A;  3S3R A;  4XR7 A;  1BP4 A;  2R9M A;  4G54 A;  4P6E A;  2JQG R;  5CVM A;  1K3B B;  3IUT A;  2CIO A;  3RVW A;  2FYE A;  5A24 A;  2E01 A;  2DJG B;  2Y6E A;  1GEC E;  3H8B A;  1YVB A;  1QOL A;  1PCI A;  3P5W A;  1F2A A;  3PBH A;  2NQD B;  2GHU A;  2P7U A;  2FO5 A;  3N3K A;  1BGO A;  4N4Z A;  1EWO A;  1CTE A;  2YJ2 A;  2YJ8 A;  1YAL A;  4MZS A;  1AYW A;  2FRQ A;  4PI3 A;  1Y08 A;  4QRG A;  1MEM A;  4HWY A;  2E00 A;  1KHP A;  3I3T A;  2OZ2 A;  4YYS A;  5EGW A;  1IWD A;  3AI8 A;  2DCD A;  3O0U A;  2FTD A;  4ZUX U;  3DF0 A;  2ATO A;  3QJ3 A;  1BY8 A;  2AYN A;  4MZO A;  1TLO A;  4N79 A;  2F1G A;  3OF8 A;  1EWM A;  1PE6 A;  2O6X A;  3HWN A;  5K16 A;  1ICF A;  4BS5 A;  4XUI A;  4AXL A;  1KFU L;  2G8E A;  2NQI A;  2R9F A;  3LXS A;  5CHT A;  2AVW A;  3USV A;  1U5I A;  1SNK A;  2DZY A;  3H89 A;  2PAD A;  2NQG A;  5F02 A;  3IEJ A;  4Q8H A;  3H8C A;  4BSQ A;  1AU0 A;  4W4U A;  1YK8 A;  2GFO A;  1PPD A;  1PXV A;  2YJC A;  3C9E A;  3MTN A;  4BPV A;  1NPZ A;  3U8E A;  3CH2 X;  1YT7 A;  1GLO A;  2BDZ A;  3LFY A;  3ZUA A;  1NLJ A;  5CVN B;  1ZIV A;  2B1N A;  1CS8 A;  1BQI A;  4CDC B;  3KFQ A;  2DCB A;  3GCB A;  5JA7 A;  3HHI A;  4CDF B;  4YYR A;  2DCA A;  1MS6 A;  4MSX A;  3CBK A;  1MIR A;  3IOQ A;  4OEL A;  1U9V A;  2YJB A;  3MHH A;  3RVX A;  4QBB A;  3P5V A;  2PNS A;  2FRA A;  1TL9 A;  3S3Q A;  4FK5 A;  2AIM A;  3WXE A;  1NL6 A;  1Y4H A;  2CB5 A;  1FH0 A;  1CQD A;  9PAP A;  2R6N A;  1KXR A;  3BPM A;  1PAD A;  2XU4 A;  1ATK A;  1JQP A;  3O1G A;  2B1M A;  2NQA A;  2DZZ A;  3BPF A;  1M6D A;  4N8W A;  1NB3 A;  1KHQ A;  1Q6K A;  1EF7 A;  4BS6 A;  4YYQ A;  3QSD A;  1CSB B;  2G6D A;  3I06 A;  2PBH A;  4Q8G A;  3H7D A;  2DC7 A;  2VHF A;  1MEG A;  1THE A;  2P0R A;  1CPJ A;  4QRV A;  1CV8 A;  5EF4 A;  1MDW A;  1DEU A;  3V6E A;  4KLB A;  4FJC A;  3K8U A;  3BCN A;  3QT4 A;  3WXG A;  1ME4 A;  1GCB A;  1CVZ A;  1U9W A;  4YYV A;  1MHW A;  5FPW A; 
#chains in the Genus database with same CATH topology
 2DJF B;  2HWK A;  3BC3 A;  2Y5B A;  1U9Q X;  2OP3 A;  3ERV A;  3IFU A;  3P5U A;  2AUZ A;  2DC8 A;  2FUD A;  2IPP B;  4BOZ A;  3OF9 A;  1ME3 A;  1PPN A;  1SP4 B;  4YYW A;  3KWZ A;  3HD3 A;  2G7Y A;  3KKU A;  3P5X A;  3CBJ A;  4PP2 E;  3ZNH A;  1QMY A;  3KW9 A;  3K24 A;  3PDF A;  3KWB X;  2UZJ A;  4FIP A;  1EWL A;  3PW3 A;  1PIP A;  5JH3 A;  2R9N A;  1ITO A;  2DC6 A;  3N4C A;  2XU3 A;  3BWK A;  3E9S A;  1ZCM A;  2E02 A;  3PNR A;  3H6S A;  2F7D A;  2PRE A;  4D8B A;  3MHS A;  4PP1 A;  2G8J A;  3E1Z B;  2HXZ A;  3OVX A;  1A6R A;  1AU4 A;  2AUX A;  3WXF A;  3KSE A;  1PPP A;  5KO3 A;  4YYU A;  4OEM A;  1NQC A;  2AU1 A;  3IV2 A;  1AU3 A;  3KX1 A;  2XU5 A;  3MP2 A;  1VJV A;  2IBI A;  5CHV A;  1QXP A;  4RF1 A;  3O65 A;  4CDD B;  4I07 A;  2R9C A;  1S4V A;  1PBH A;  1STF E;  3RVV A;  4XZX A;  1CB5 A;  2YJ9 A;  1VSN A;  1QDQ A;  4AXM A;  4CZW A;  1O0E A;  3IMA A;  4BOQ A;  4K7C A;  2DCC A;  3V6C A;  1DF0 A;  3OVZ A;  1AEC A;  4YVA A;  3BB7 A;  1NB5 A;  1TU6 A;  2HH5 A;  5J94 A;  2BTW A;  2ACT A;  1CJL A;  3M99 A;  4I04 A;  3TNX A;  4X6J A;  4BOS A;  1YK7 A;  2E03 A;  1AU2 A;  3D6S A;  1POP A;  2AS8 A;  4YV8 A;  1U9X A;  1AYV A;  3OIS A;  3F75 A;  3PHW A;  4X6I A;  3OQC A;  4D8I A;  2XU1 A;  4DMY A;  2HD5 A;  2HHN A;  5CVO B;  4QH6 A;  2JQF R;  4I05 A;  2DC9 A;  7PCK A;  4REZ A;  3BOW A;  2AYO A;  2FQ9 A;  3MOR A;  4W5C A;  2R9O A;  3HHA A;  3N3G A;  3W31 A;  4RY2 A;  4WA6 A;  2WBF X;  2Z84 A;  4QRX A;  1AYU A;  2ARY A;  1AIM A;  8PCH A;  2VHS A;  3PRM A;  5PAD A;  1X9Y A;  3F5V A;  4BQV A;  1GMY A;  1KFX L;  4PAD A;  1PVJ A;  2H7J A;  2J7Q C;  3IHP A;  3PT2 A;  2P86 A;  2C0Y A;  3CH3 X;  4M0W A;  4X6H A;  1EWP A;  1PPO A;  2FT2 A;  4R3D A;  4P6G A;  4MI7 A;  2FE8 A;  4CDE B;  3PHX A;  2BDL A;  3NHE A;  1XKG A;  3K9M A;  3B79 A;  3BBA A;  4OVZ B;  1F2C A;  6PAD A;  1F29 A;  4DMX A;  1HUC B;  1F2B A;  4W5B A;  2OUL A;  3S3R A;  4XR7 A;  1BP4 A;  2R9M A;  4G54 A;  4P6E A;  2JQG R;  5CVM A;  1K3B B;  3IUT A;  2CIO A;  3RVW A;  2FYE A;  5A24 A;  2E01 A;  2DJG B;  2Y6E A;  3PHU A;  4PT5 A;  5EZQ A;  1GEC E;  3H8B A;  1YVB A;  1QOL A;  4ZTB A;  1PCI A;  2DOS A;  4RKX A;  3P5W A;  1F2A A;  3PBH A;  2NQD B;  2GHU A;  3C0R A;  1UKF A;  5EZS A;  2P7U A;  3RNV A;  4P16 A;  2FO5 A;  3N3K A;  1BGO A;  4N4Z A;  1EWO A;  1CTE A;  2YJ2 A;  2YJ8 A;  1YAL A;  4MZS A;  1AYW A;  2FRQ A;  4PI3 A;  1Y08 A;  4HXD B;  4QRG A;  1MEM A;  4HWY A;  2E00 A;  1KHP A;  3I3T A;  2OZ2 A;  4YYS A;  5EGW A;  4GUA A;  2JTC A;  1IWD A;  3AI8 A;  5JZE A;  2DCD A;  3O0U A;  2BU3 A;  4WUR A;  2FTD A;  4ZUX U;  3DF0 A;  2ATO A;  3QJ3 A;  1BY8 A;  2AYN A;  4MZO A;  1TLO A;  4N79 A;  2F1G A;  3OF8 A;  4OW0 A;  4A5U A;  1EWM A;  1PE6 A;  2O6X A;  3HWN A;  5K16 A;  1YZB A;  2J7Q A;  1ICF A;  4BS5 A;  4XUI A;  4AXL A;  1KFU L;  2G8E A;  2NQI A;  2R9F A;  3LXS A;  5CHT A;  5E6J A;  3BY4 A;  2AVW A;  3USV A;  1U5I A;  1SNK A;  2DZY A;  3H89 A;  2PAD A;  2NQG A;  5F02 A;  4BOP A;  3TMP A;  3IEJ A;  4MM3 B;  4Q8H A;  4IP3 A;  3H8C A;  4BSQ A;  1AU0 A;  3MJ5 A;  4W4U A;  1YK8 A;  1DKI A;  2GFO A;  1PPD A;  1PXV A;  2YJC A;  3C9E A;  3MTN A;  2AGA A;  4BPV A;  1NPZ A;  3U8E A;  3CH2 X;  1YT7 A;  1GLO A;  2BDZ A;  3LFY A;  3ZUA A;  1NLJ A;  5CVN B;  1ZIV A;  4RF0 A;  2B1N A;  1CS8 A;  1BQI A;  4CDC B;  3KFQ A;  2DCB A;  3GCB A;  5JA7 A;  3HHI A;  4CDF B;  4YYR A;  2DCA A;  1MS6 A;  4MSX A;  3CBK A;  1MIR A;  3IOQ A;  4OEL A;  1U9V A;  2YJB A;  3TRK A;  3MHH A;  3RVX A;  4OVZ A;  4QBB A;  2JRI A;  3P5V A;  2PNS A;  2FRA A;  4RNA A;  1TL9 A;  2BTW B;  3S3Q A;  4FK5 A;  2AIM A;  3WXE A;  1NL6 A;  3W30 A;  4IUM A;  1Y4H A;  2CB5 A;  1FH0 A;  1CQD A;  9PAP A;  2R6N A;  1KXR A;  3BPM A;  1PAD A;  2XU4 A;  1ATK A;  1JQP A;  3O1G A;  2B1M A;  2NQA A;  2DZZ A;  3PRP A;  3BPF A;  1M6D A;  4N8W A;  1NB3 A;  1KHQ A;  1Q6K A;  1EF7 A;  4BS6 A;  4YYQ A;  3QSD A;  4BOU A;  1CSB B;  2G6D A;  3I06 A;  2PBH A;  4Q8G A;  3H7D A;  2DC7 A;  4D8E A;  2VHF A;  3B21 A;  1MEG A;  3MTV A;  1THE A;  2P0R A;  1CPJ A;  4QRV A;  3PSE A;  1CV8 A;  5EF4 A;  1MDW A;  1DEU A;  3V6E A;  4KLB A;  4FJC A;  3K8U A;  3BCN A;  3QT4 A;  3WXG A;  1ME4 A;  1GCB A;  1CVZ A;  1U9W A;  4YYV A;  1MHW A;  5FPW A; 
#chains in the Genus database with same CATH homology
 2DJF B;  3BC3 A;  2Y5B A;  1U9Q X;  2OP3 A;  3ERV A;  3P5U A;  2AUZ A;  2DC8 A;  2FUD A;  2IPP B;  3OF9 A;  1ME3 A;  1PPN A;  1SP4 B;  4YYW A;  3KWZ A;  3HD3 A;  2G7Y A;  3KKU A;  1W6F A;  3P5X A;  3CBJ A;  4PP2 E;  1QMY A;  3KW9 A;  3K24 A;  3PDF A;  3KWB X;  4FIP A;  1EWL A;  3PW3 A;  1PIP A;  5JH3 A;  2R9N A;  1ITO A;  2DC6 A;  3N4C A;  2XU3 A;  3BWK A;  1ZCM A;  2E02 A;  3PNR A;  3H6S A;  2F7D A;  2PRE A;  3MHS A;  4PP1 A;  2G8J A;  3E1Z B;  2HXZ A;  3OVX A;  2VFC A;  1A6R A;  1AU4 A;  2AUX A;  3WXF A;  3KSE A;  1PPP A;  4YYU A;  4OEM A;  1NQC A;  2AU1 A;  3IV2 A;  1AU3 A;  3KX1 A;  2XU5 A;  1VJV A;  2BSZ A;  3D9W A;  2IBI A;  5CHV A;  1QXP A;  4CDD B;  4I07 A;  2R9C A;  1S4V A;  1PBH A;  1STF E;  3RVV A;  1CB5 A;  2YJ9 A;  1VSN A;  1QDQ A;  4AXM A;  4CZW A;  1O0E A;  3IMA A;  4K7C A;  2DCC A;  3V6C A;  1DF0 A;  3OVZ A;  1AEC A;  4YVA A;  1NB5 A;  1TU6 A;  2HH5 A;  5J94 A;  2ACT A;  1CJL A;  3M99 A;  4I04 A;  3TNX A;  4X6J A;  1YK7 A;  2E03 A;  1AU2 A;  3D6S A;  1POP A;  2AS8 A;  4YV8 A;  1U9X A;  1AYV A;  3OIS A;  3F75 A;  4X6I A;  2XU1 A;  4DMY A;  2HD5 A;  2HHN A;  5CVO B;  4QH6 A;  2JQF R;  4I05 A;  2DC9 A;  7PCK A;  3BOW A;  2AYO A;  2FQ9 A;  3MOR A;  4W5C A;  2R9O A;  3HHA A;  3N3G A;  4RY2 A;  4WA6 A;  2WBF X;  4QRX A;  1AYU A;  2ARY A;  1AIM A;  8PCH A;  2VHS A;  5PAD A;  1X9Y A;  3F5V A;  4BQV A;  4B55 A;  2VFB A;  1GMY A;  1KFX L;  4PAD A;  2H7J A;  3IHP A;  2P86 A;  2C0Y A;  3CH3 X;  4X6H A;  1EWP A;  1PPO A;  2FT2 A;  4P6G A;  4CDE B;  2BDL A;  3NHE A;  1XKG A;  3K9M A;  3B79 A;  1F2C A;  6PAD A;  1F29 A;  4DMX A;  1HUC B;  1F2B A;  4W5B A;  2OUL A;  3S3R A;  4XR7 A;  1BP4 A;  2R9M A;  4G54 A;  4P6E A;  2JQG R;  5CVM A;  1K3B B;  3IUT A;  2CIO A;  3RVW A;  2FYE A;  5A24 A;  2E01 A;  2DJG B;  2Y6E A;  1GEC E;  3H8B A;  1YVB A;  1QOL A;  1PCI A;  3P5W A;  1F2A A;  3PBH A;  2NQD B;  2GHU A;  2P7U A;  2FO5 A;  3N3K A;  1BGO A;  4N4Z A;  1EWO A;  1CTE A;  2YJ2 A;  2YJ8 A;  1YAL A;  4MZS A;  1AYW A;  2FRQ A;  4PI3 A;  1Y08 A;  4QRG A;  1MEM A;  4HWY A;  2E00 A;  1KHP A;  3I3T A;  2OZ2 A;  4YYS A;  5EGW A;  1IWD A;  3AI8 A;  2DCD A;  3O0U A;  2FTD A;  4ZUX U;  3DF0 A;  2ATO A;  3QJ3 A;  1BY8 A;  2AYN A;  1E2T A;  4MZO A;  1TLO A;  4N79 A;  2F1G A;  3OF8 A;  1EWM A;  1PE6 A;  4BGF A;  2O6X A;  3HWN A;  5K16 A;  4C5P A;  1ICF A;  4BS5 A;  4XUI A;  4AXL A;  1KFU L;  2G8E A;  2NQI A;  2R9F A;  3LXS A;  5CHT A;  2AVW A;  3USV A;  1U5I A;  1SNK A;  2DZY A;  3H89 A;  2PAD A;  2NQG A;  5F02 A;  3IEJ A;  4Q8H A;  4GUZ A;  3H8C A;  1W5R A;  4BSQ A;  1AU0 A;  4W4U A;  1YK8 A;  2GFO A;  1PPD A;  4NV8 A;  1PXV A;  2YJC A;  3C9E A;  3LTW A;  3MTN A;  4BPV A;  1NPZ A;  3U8E A;  1GX3 A;  3CH2 X;  1YT7 A;  1GLO A;  2BDZ A;  3LFY A;  3ZUA A;  1NLJ A;  5CVN B;  1ZIV A;  2B1N A;  1CS8 A;  1BQI A;  4CDC B;  3KFQ A;  2DCB A;  3GCB A;  5JA7 A;  3HHI A;  4CDF B;  4YYR A;  2DCA A;  1MS6 A;  4MSX A;  3CBK A;  1MIR A;  3IOQ A;  4OEL A;  1U9V A;  2YJB A;  3MHH A;  3RVX A;  4QBB A;  3P5V A;  2PNS A;  2FRA A;  1TL9 A;  3S3Q A;  4FK5 A;  2AIM A;  3WXE A;  1NL6 A;  1Y4H A;  2CB5 A;  1FH0 A;  1CQD A;  9PAP A;  2R6N A;  1KXR A;  3BPM A;  1PAD A;  2XU4 A;  1ATK A;  1JQP A;  3O1G A;  2B1M A;  2NQA A;  2DZZ A;  1W4T A;  1M6D A;  3BPF A;  4N8W A;  1NB3 A;  1KHQ A;  1Q6K A;  1EF7 A;  4BS6 A;  4YYQ A;  3QSD A;  1CSB B;  2G6D A;  3I06 A;  2PBH A;  4Q8G A;  3H7D A;  2DC7 A;  2VHF A;  1MEG A;  1THE A;  2P0R A;  1CPJ A;  4QRV A;  1CV8 A;  5EF4 A;  1MDW A;  1DEU A;  3V6E A;  4KLB A;  4FJC A;  3K8U A;  3BCN A;  3QT4 A;  3WXG A;  1ME4 A;  1GCB A;  1CVZ A;  1U9W A;  4YYV A;  1MHW A;  4NV7 A;  5FPW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...