3CH3X

Crystal structure analysis of sera5e from plasmodium falciparum
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
265
structure length
256
Chain Sequence
NMFCNKEYCNRLKDENNCISNLQVEDQGNCDTSWIFASKYHLETIRCMKGYEPTKISALYVANCYKGEHKDRCDEGSSPMEFLQIIEDYGFLPAESNYPYNYVKVGEQCPKVEDHWMNLWDNGKILHGKGYTAYESERFHDNMDAFVKIIKTEVMNKGSVIAYIKAENVMGYEFSGKKVQNLCGDDTADHAVNIVGYGNYVNSEGEKKSYWIVRNSWGPYWGDEGYFKVDMYGPTHCHFNFIHSVVIFNVDLPMNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Serine-repeat antigen protein
publication title Structural Insights into the Protease-like Antigen Plasmodium falciparum SERA5 and Its Noncanonical Active-Site Serine
pubmed doi rcsb
source organism Plasmodium falciparum
total genus 72
structure length 256
sequence length 265
ec nomenclature
pdb deposition date 2008-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3ch3X00
2AVWA 2O6XA 1QMYA 4BSQA 1CV8A 1MEMA 3MHSA 4QRVA 1TL9A 2OZ2A 5F02A 2OULA 3QSDA 4P6EA 3P5UA 4AXLA 4BS6A 1POPA 2PADA 3BC3A 3K9MA 2B1NA 1KFXL 1AU4A 4YYUA 2B1MA 3S3RA 4CDCB 4I04A 1AU0A 4MZSA 2FO5A 1Q6KA 4CDFB 1MHWA 2R9CA 3K24A 4QRXA 3PBHA 2IPPB 4RY2A 4YV8A 1MS6A 3OISA 4I05A 1CVZA 1AYVA 3V6CA 4XR7A 1DF0A 3HWNA 2AS8A 4HWYA 2Y6EA 3TNXA 3P5VA 1ZCMA 4OELA 2P0RA 3E1ZB 4DMYA 2FQ9A 3H8BA 3N3KA 3QT4A 3PW3A 3KWBX 4MZOA 2E00A 2ACTA 1ITOA 3IUTA 4YVAA 3H7DA 3WXGA 1ICFA 2DCCA 3H89A 5EGWA 1XKGA 2AYNA 5JA7A 3OVZA 2YJ8A 9PAPA 1SNKA 2HH5A 1NB5A 2PBHA 1HUCB 3DF0A 1JQPA 4PP2E 2XU3A 2FTDA 4X6JA 4X6IA 2F7DA 4QRGA 3IOQA 3BOWA 2R9NA 1QXPA 2E02A 4BPVA 4PI3A 2ARYA 3ZUAA 1DEUA 3KWZA 2HD5A 1AIMA 3S3QA 1CPJA 4ZUXU 4N4ZA 2G8EA 2AYOA 4P6GA 5CVMA 1PADA 3GCBA 3USVA 4N8WA 3NHEA 2AUZA 1FH0A 1EWPA 5EF4A 4W5CA 4W4UA 1KFUL 2Y5BA 2R9FA 2NQAA 3BCNA 3KX1A 1CJLA 1ME3A 1SP4B 2DZZA 3LXSA 3HD3A 1X9YA 4BS5A 1KHQA 2E01A 2FRQA 3MHHA 3N3GA 1ME4A 3I06A 2FT2A 3V6EA 3KFQA 4YYRA 4Q8HA 1GLOA 1F29A 3HHIA 1AU3A 3D6SA 6PADA 3CH2X 2OP3A 4YYSA 2DCDA 2HHNA 2WBFX 2XU1A 1MEGA 2FYEA 1YALA 3BPMA 2DC9A 1K3BB 3PNRA 3LFYA 3N4CA 5CHTA 1YT7A 2R9OA 1PPOA 1NB3A 3MORA 4N79A 1F2BA 5JH3A 2CIOA 4YYWA 3BPFA 3BWKA 2BDZA 2NQDB 3KSEA 1F2CA 1EWMA 2NQIA 4K7CA 2FRAA 1STFE 3RVWA 2HXZA 1U9QX 1PPNA 1F2AA 2H7JA 4OEMA 4FIPA 1PIPA 1NL6A 3F75A 3MTNA 3QJ3A 4YYVA 1CTEA 1U9VA 2YJ9A 2ATOA 3M99A 1CB5A 4BQVA 2DJFB 3IV2A 3O1GA 4KLBA 3PDFA 3H8CA 1AECA 2R6NA 1QOLA 3ERVA 4WA6A 7PCKA 1NLJA 1IWDA 3CBKA 4W5BA 2AUXA 2PNSA 2DC8A 5A24A 4I07A 1MIRA 1PE6A 1GECE 1ZIVA 3I3TA 1YVBA 3IEJA 1QDQA 1NPZA 1AU2A 2IBIA 2XU5A 1A6RA 1MDWA 4XUIA 2XU4A 4MSXA 4CDEB 2E03A 2JQFR 3P5XA 3P5WA 1U9WA 1Y4HA 3WXEA 1KHPA 1GCBA 5J94A 3RVVA 1BGOA 1ATKA 2VHFA 4DMXA 4CDDB 1PBHA 1PXVA 3K8UA 5PADA 1BQIA 3OF9A 3KKUA 5CVOB 3AI8A 4PP1A 1CS8A 3OVXA 2G8JA 3CBJA 8PCHA 2FUDA 4PADA 2AIMA 4QBBA 1BY8A 3O0UA 1U5IA 2F1GA 4G54A 4Q8GA 5CHVA 3RVXA 2G6DA 1S4VA 1CSBB 1NQCA 1TU6A 1THEA 2BDLA 2DJGB 2R9MA 1U9XA 4AXMA 2DZYA 1PCIA 1VSNA 3IMAA 3U8EA 2DCAA 2GHUA 2JQGR 2DC7A 3HHAA 1BP4A 4FJCA 4YYQA 2DC6A 2GFOA 3OF8A 1EWLA 1PPDA 1TLOA 2YJBA 2NQGA 2YJCA 1M6DA 1VJVA 1Y08A 2G7YA 3B79A 1AYUA 4QH6A 3F5VA 2DCBA 4X6HA 2AU1A 1EWOA 2P86A 1AYWA 1O0EA 1GMYA 1KXRA 3CH3X 3WXFA 4FK5A 5FPWA 2P7UA 2C0YA 2CB5A 1PPPA 4CZWA 2VHSA 5CVNB 2PREA 3IHPA 2YJ2A 3C9EA 3H6SA 1CQDA 5K16A 1EF7A 3KW9A 1YK7A 1YK8A
chains in the Genus database with same CATH superfamily
2AVWA 2O6XA 1QMYA 3MJ5A 4BSQA 1CV8A 1MEMA 3MHSA 4PT5A 4QRVA 1TL9A 2OZ2A 5F02A 4WURA 2OULA 3QSDA 4P6EA 3P5UA 4AXLA 4BS6A 1POPA 2PADA 3BC3A 3K9MA 2B1NA 1KFXL 1AU4A 4YYUA 2B1MA 3S3RA 4CDCB 3PHXA 4I04A 2J7QC 1AU0A 4BOSA 2AGAA 4MZSA 2FO5A 1Q6KA 4CDFB 1MHWA 5JZEA 2R9CA 3K24A 4QRXA 3PBHA 3PHUA 1YZBA 3C0RA 2IPPB 4RY2A 4YV8A 1MS6A 3OISA 4I05A 1CVZA 1AYVA 4OVZA 3V6CA 4XR7A 1DF0A 4D8IA 3HWNA 2AS8A 4HWYA 4MM3B 2Y6EA 2UZJA 3TNXA 3MP2A 3P5VA 1ZCMA 4OELA 2P0RA 3E1ZB 2JTCA 4DMYA 2FQ9A 3H8BA 3N3KA 3QT4A 3PW3A 3KWBX 4MZOA 2E00A 2ACTA 1ITOA 3IUTA 4YVAA 3RNVA 4ZTBA 3H7DA 3WXGA 1ICFA 2DCCA 1UKFA 3H89A 5EGWA 1XKGA 2AYNA 5JA7A 3OVZA 2YJ8A 9PAPA 1PVJA 3PSEA 1SNKA 2HH5A 1NB5A 3TRKA 2PBHA 1HUCB 3DF0A 1JQPA 4PP2E 3W31A 2XU3A 2FTDA 4X6JA 4X6IA 2F7DA 4QRGA 3IOQA 3BOWA 2R9NA 1QXPA 2E02A 4BPVA 4PI3A 2ARYA 3ZUAA 1DEUA 3KWZA 2HD5A 3BB7A 1AIMA 3S3QA 1CPJA 4ZUXU 4R3DA 2FE8A 4N4ZA 2G8EA 2AYOA 4P6GA 5CVMA 1PADA 3GCBA 3PRMA 3USVA 4N8WA 3NHEA 2AUZA 1FH0A 2DOSA 1EWPA 5EF4A 4OVZB 4W5CA 4W4UA 1KFUL 2Y5BA 2R9FA 2NQAA 3BCNA 4A5UA 3KX1A 1CJLA 1ME3A 1SP4B 2DZZA 3LXSA 3HD3A 1X9YA 4BS5A 1KHQA 2E01A 2FRQA 3MHHA 4MI7A 3N3GA 1ME4A 3I06A 2Z84A 2FT2A 3V6EA 3KFQA 4YYRA 4Q8HA 1GLOA 4M0WA 3B21A 3BBAA 3PHWA 1F29A 3HHIA 1AU3A 3D6SA 6PADA 3CH2X 2OP3A 4YYSA 2DCDA 2HHNA 2WBFX 4REZA 2XU1A 1MEGA 2FYEA 1YALA 3BPMA 3W30A 4RNAA 4P16A 2DC9A 1K3BB 3PNRA 3LFYA 3N4CA 5CHTA 1YT7A 2R9OA 4RF1A 1PPOA 1NB3A 5KO3A 3MORA 1F2BA 4N79A 5JH3A 2CIOA 4YYWA 3BPFA 3BWKA 2BDZA 2NQDB 3KSEA 1F2CA 1EWMA 2BTWB 2NQIA 4K7CA 2FRAA 1STFE 4OW0A 3RVWA 2HXZA 1U9QX 2J7QA 1PPNA 1F2AA 2H7JA 4OEMA 4FIPA 1PIPA 1NL6A 3F75A 3MTNA 3QJ3A 4YYVA 1CTEA 1U9VA 5EZQA 2YJ9A 2ATOA 4D8BA 3M99A 1CB5A 3MTVA 4BQVA 2DJFB 3IV2A 3TMPA 3O1GA 4KLBA 3PDFA 3H8CA 1AECA 2R6NA 4IP3A 1QOLA 3ERVA 3PT2A 4WA6A 7PCKA 1NLJA 1IWDA 3CBKA 4W5BA 2AUXA 2PNSA 2DC8A 5A24A 4I07A 1MIRA 1PE6A 1GECE 1ZIVA 3I3TA 1YVBA 1DKIA 3IEJA 1QDQA 1NPZA 1AU2A 2IBIA 2XU5A 1A6RA 1MDWA 4XUIA 2XU4A 2JRIA 4MSXA 4CDEB 2E03A 2JQFR 3P5XA 3P5WA 1U9WA 1Y4HA 3WXEA 1KHPA 1GCBA 5J94A 3RVVA 1BGOA 1ATKA 2VHFA 4DMXA 4CDDB 1PBHA 1PXVA 4BOZA 3K8UA 5PADA 1BQIA 3OF9A 3KKUA 5CVOB 3AI8A 4PP1A 1CS8A 3E9SA 3OQCA 3OVXA 2G8JA 3CBJA 8PCHA 2FUDA 4PADA 2AIMA 4QBBA 1BY8A 3O0UA 1U5IA 2F1GA 4G54A 4Q8GA 4GUAA 5CHVA 3PRPA 3RVXA 2G6DA 1S4VA 1CSBB 4D8EA 1NQCA 1TU6A 1THEA 2BDLA 2DJGB 2R9MA 1U9XA 4AXMA 2DZYA 3IFUA 1PCIA 3ZNHA 1VSNA 3IMAA 3U8EA 2DCAA 2GHUA 2JQGR 3O65A 2DC7A 3HHAA 1BP4A 4FJCA 4YYQA 2DC6A 2GFOA 4BOPA 3OF8A 4IUMA 1EWLA 1PPDA 1TLOA 4BOQA 2YJBA 2NQGA 2YJCA 1M6DA 1VJVA 1Y08A 2G7YA 3B79A 1AYUA 4QH6A 3F5VA 2DCBA 4X6HA 2AU1A 1EWOA 2P86A 1AYWA 1O0EA 3BY4A 1GMYA 5E6JA 1KXRA 4HXDB 4RF0A 3CH3X 3WXFA 4FK5A 5FPWA 2P7UA 2C0YA 2CB5A 1PPPA 5EZSA 4CZWA 2VHSA 5CVNB 2PREA 4XZXA 2HWKA 3IHPA 2YJ2A 3C9EA 3H6SA 2BTWA 1CQDA 2BU3A 4BOUA 5K16A 1EF7A 3KW9A 1YK7A 4RKXA 1YK8A
chains in the Genus database with same CATH topology
2AVWA 2O6XA 1QMYA 4BSQA 1CV8A 1MEMA 3MHSA 4QRVA 1TL9A 2OZ2A 5F02A 2OULA 3QSDA 4P6EA 3P5UA 4AXLA 4BS6A 1POPA 2PADA 3BC3A 3K9MA 2B1NA 1KFXL 1AU4A 4YYUA 2B1MA 3S3RA 4CDCB 4I04A 1AU0A 4MZSA 2FO5A 1Q6KA 4CDFB 1MHWA 2R9CA 3K24A 4QRXA 3PBHA 4C5PA 2IPPB 4RY2A 4YV8A 1MS6A 3OISA 4I05A 1CVZA 1AYVA 3V6CA 4XR7A 1DF0A 3HWNA 2AS8A 4HWYA 2Y6EA 3TNXA 3P5VA 1ZCMA 4OELA 2P0RA 3E1ZB 4DMYA 2FQ9A 3H8BA 3N3KA 3QT4A 3PW3A 3KWBX 4MZOA 2E00A 2ACTA 1ITOA 3IUTA 4YVAA 4GUZA 3H7DA 3WXGA 1ICFA 2DCCA 3H89A 5EGWA 1XKGA 2AYNA 5JA7A 3OVZA 2YJ8A 9PAPA 1SNKA 2HH5A 1NB5A 2PBHA 1HUCB 3DF0A 1JQPA 4PP2E 2XU3A 1W4TA 2FTDA 3D9WA 4X6JA 4X6IA 1GX3A 2F7DA 4QRGA 3IOQA 3BOWA 2R9NA 1QXPA 2E02A 4BPVA 4PI3A 2ARYA 3ZUAA 1DEUA 3KWZA 2HD5A 1W6FA 1AIMA 3S3QA 1CPJA 4ZUXU 4N4ZA 2G8EA 2AYOA 4P6GA 4BGFA 5CVMA 1PADA 3GCBA 3USVA 4N8WA 3NHEA 2AUZA 1FH0A 1EWPA 5EF4A 4W5CA 4W4UA 1KFUL 2Y5BA 2R9FA 2NQAA 3BCNA 3KX1A 1CJLA 1ME3A 1SP4B 2DZZA 3LXSA 3HD3A 1X9YA 4BS5A 1KHQA 2E01A 2FRQA 3MHHA 3N3GA 1ME4A 3I06A 2FT2A 3V6EA 3KFQA 4YYRA 4Q8HA 1GLOA 1F29A 3HHIA 4NV8A 1AU3A 3D6SA 6PADA 3CH2X 2VFBA 2OP3A 4YYSA 2DCDA 2HHNA 2WBFX 2XU1A 1MEGA 2FYEA 1YALA 3BPMA 2DC9A 1K3BB 3PNRA 3LFYA 3N4CA 5CHTA 1YT7A 2R9OA 1PPOA 1NB3A 3MORA 4N79A 1F2BA 5JH3A 2CIOA 4YYWA 3BPFA 3BWKA 2BDZA 2NQDB 3KSEA 1F2CA 1EWMA 2NQIA 4K7CA 2FRAA 1STFE 3RVWA 2HXZA 1U9QX 1PPNA 1F2AA 2H7JA 4OEMA 4FIPA 1PIPA 1NL6A 3F75A 3MTNA 3QJ3A 4YYVA 1CTEA 1U9VA 2YJ9A 2ATOA 3M99A 1CB5A 4BQVA 2DJFB 3IV2A 3O1GA 4KLBA 3PDFA 3H8CA 1AECA 2R6NA 1QOLA 3ERVA 4WA6A 7PCKA 1NLJA 1IWDA 3CBKA 4W5BA 2AUXA 2PNSA 2DC8A 5A24A 1E2TA 4I07A 1MIRA 3LTWA 1PE6A 1GECE 1ZIVA 3I3TA 1YVBA 3IEJA 1QDQA 1NPZA 1AU2A 2IBIA 2XU5A 1A6RA 1MDWA 4XUIA 2XU4A 4MSXA 4CDEB 2E03A 2JQFR 3P5XA 3P5WA 1U9WA 1Y4HA 3WXEA 1KHPA 1GCBA 5J94A 3RVVA 1BGOA 1W5RA 1ATKA 2VHFA 4DMXA 4CDDB 1PBHA 1PXVA 3K8UA 5PADA 1BQIA 3OF9A 3KKUA 5CVOB 3AI8A 4PP1A 1CS8A 3OVXA 2G8JA 3CBJA 8PCHA 2FUDA 4PADA 2AIMA 4QBBA 1BY8A 3O0UA 1U5IA 2F1GA 4G54A 4Q8GA 5CHVA 3RVXA 2G6DA 1S4VA 1CSBB 2BSZA 4NV7A 1NQCA 1TU6A 1THEA 2BDLA 2DJGB 2R9MA 1U9XA 4AXMA 2DZYA 1PCIA 1VSNA 3IMAA 3U8EA 2DCAA 2GHUA 2JQGR 2DC7A 3HHAA 1BP4A 4FJCA 4YYQA 2DC6A 2GFOA 3OF8A 1EWLA 1PPDA 1TLOA 2YJBA 2NQGA 2YJCA 1M6DA 1VJVA 4B55A 1Y08A 2G7YA 3B79A 1AYUA 4QH6A 3F5VA 2DCBA 4X6HA 2AU1A 1EWOA 2P86A 1AYWA 1O0EA 2VFCA 1GMYA 1KXRA 3CH3X 3WXFA 4FK5A 5FPWA 2P7UA 2C0YA 2CB5A 1PPPA 4CZWA 2VHSA 5CVNB 2PREA 3IHPA 2YJ2A 3C9EA 3H6SA 1CQDA 5K16A 1EF7A 3KW9A 1YK7A 1YK8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AVW A;  2O6X A;  1QMY A;  4BSQ A;  1CV8 A;  1MEM A;  3MHS A;  4QRV A;  1TL9 A;  2OZ2 A;  5F02 A;  2OUL A;  3QSD A;  4P6E A;  3P5U A;  4AXL A;  4BS6 A;  1POP A;  2PAD A;  3BC3 A;  3K9M A;  2B1N A;  1KFX L;  1AU4 A;  4YYU A;  2B1M A;  3S3R A;  4CDC B;  4I04 A;  1AU0 A;  4MZS A;  2FO5 A;  1Q6K A;  4CDF B;  1MHW A;  2R9C A;  3K24 A;  4QRX A;  3PBH A;  2IPP B;  4RY2 A;  4YV8 A;  1MS6 A;  3OIS A;  4I05 A;  1CVZ A;  1AYV A;  3V6C A;  4XR7 A;  1DF0 A;  3HWN A;  2AS8 A;  4HWY A;  2Y6E A;  3TNX A;  3P5V A;  1ZCM A;  4OEL A;  2P0R A;  3E1Z B;  4DMY A;  2FQ9 A;  3H8B A;  3N3K A;  3QT4 A;  3PW3 A;  3KWB X;  4MZO A;  2E00 A;  2ACT A;  1ITO A;  3IUT A;  4YVA A;  3H7D A;  3WXG A;  1ICF A;  2DCC A;  3H89 A;  5EGW A;  1XKG A;  2AYN A;  5JA7 A;  3OVZ A;  2YJ8 A;  9PAP A;  1SNK A;  2HH5 A;  1NB5 A;  2PBH A;  1HUC B;  3DF0 A;  1JQP A;  4PP2 E;  2XU3 A;  2FTD A;  4X6J A;  4X6I A;  2F7D A;  4QRG A;  3IOQ A;  3BOW A;  2R9N A;  1QXP A;  2E02 A;  4BPV A;  4PI3 A;  2ARY A;  3ZUA A;  1DEU A;  3KWZ A;  2HD5 A;  1AIM A;  3S3Q A;  1CPJ A;  4ZUX U;  4N4Z A;  2G8E A;  2AYO A;  4P6G A;  5CVM A;  1PAD A;  3GCB A;  3USV A;  4N8W A;  3NHE A;  2AUZ A;  1FH0 A;  1EWP A;  5EF4 A;  4W5C A;  4W4U A;  1KFU L;  2Y5B A;  2R9F A;  2NQA A;  3BCN A;  3KX1 A;  1CJL A;  1ME3 A;  1SP4 B;  2DZZ A;  3LXS A;  3HD3 A;  1X9Y A;  4BS5 A;  1KHQ A;  2E01 A;  2FRQ A;  3MHH A;  3N3G A;  1ME4 A;  3I06 A;  2FT2 A;  3V6E A;  3KFQ A;  4YYR A;  4Q8H A;  1GLO A;  1F29 A;  3HHI A;  1AU3 A;  3D6S A;  6PAD A;  3CH2 X;  2OP3 A;  4YYS A;  2DCD A;  2HHN A;  2WBF X;  2XU1 A;  1MEG A;  2FYE A;  1YAL A;  3BPM A;  2DC9 A;  1K3B B;  3PNR A;  3LFY A;  3N4C A;  5CHT A;  1YT7 A;  2R9O A;  1PPO A;  1NB3 A;  3MOR A;  4N79 A;  1F2B A;  5JH3 A;  2CIO A;  4YYW A;  3BPF A;  3BWK A;  2BDZ A;  2NQD B;  3KSE A;  1F2C A;  1EWM A;  2NQI A;  4K7C A;  2FRA A;  1STF E;  3RVW A;  2HXZ A;  1U9Q X;  1PPN A;  1F2A A;  2H7J A;  4OEM A;  4FIP A;  1PIP A;  1NL6 A;  3F75 A;  3MTN A;  3QJ3 A;  4YYV A;  1CTE A;  1U9V A;  2YJ9 A;  2ATO A;  3M99 A;  1CB5 A;  4BQV A;  2DJF B;  3IV2 A;  3O1G A;  4KLB A;  3PDF A;  3H8C A;  1AEC A;  2R6N A;  1QOL A;  3ERV A;  4WA6 A;  7PCK A;  1NLJ A;  1IWD A;  3CBK A;  4W5B A;  2AUX A;  2PNS A;  2DC8 A;  5A24 A;  4I07 A;  1MIR A;  1PE6 A;  1GEC E;  1ZIV A;  3I3T A;  1YVB A;  3IEJ A;  1QDQ A;  1NPZ A;  1AU2 A;  2IBI A;  2XU5 A;  1A6R A;  1MDW A;  4XUI A;  2XU4 A;  4MSX A;  4CDE B;  2E03 A;  2JQF R;  3P5X A;  3P5W A;  1U9W A;  1Y4H A;  3WXE A;  1KHP A;  1GCB A;  5J94 A;  3RVV A;  1BGO A;  1ATK A;  2VHF A;  4DMX A;  4CDD B;  1PBH A;  1PXV A;  3K8U A;  5PAD A;  1BQI A;  3OF9 A;  3KKU A;  5CVO B;  3AI8 A;  4PP1 A;  1CS8 A;  3OVX A;  2G8J A;  3CBJ A;  8PCH A;  2FUD A;  4PAD A;  2AIM A;  4QBB A;  1BY8 A;  3O0U A;  1U5I A;  2F1G A;  4G54 A;  4Q8G A;  5CHV A;  3RVX A;  2G6D A;  1S4V A;  1CSB B;  1NQC A;  1TU6 A;  1THE A;  2BDL A;  2DJG B;  2R9M A;  1U9X A;  4AXM A;  2DZY A;  1PCI A;  1VSN A;  3IMA A;  3U8E A;  2DCA A;  2GHU A;  2JQG R;  2DC7 A;  3HHA A;  1BP4 A;  4FJC A;  4YYQ A;  2DC6 A;  2GFO A;  3OF8 A;  1EWL A;  1PPD A;  1TLO A;  2YJB A;  2NQG A;  2YJC A;  1M6D A;  1VJV A;  1Y08 A;  2G7Y A;  3B79 A;  1AYU A;  4QH6 A;  3F5V A;  2DCB A;  4X6H A;  2AU1 A;  1EWO A;  2P86 A;  1AYW A;  1O0E A;  1GMY A;  1KXR A;  3CH3 X;  3WXF A;  4FK5 A;  5FPW A;  2P7U A;  2C0Y A;  2CB5 A;  1PPP A;  4CZW A;  2VHS A;  5CVN B;  2PRE A;  3IHP A;  2YJ2 A;  3C9E A;  3H6S A;  1CQD A;  5K16 A;  1EF7 A;  3KW9 A;  1YK7 A;  1YK8 A; 
#chains in the Genus database with same CATH topology
 2AVW A;  2O6X A;  1QMY A;  3MJ5 A;  4BSQ A;  1CV8 A;  1MEM A;  3MHS A;  4PT5 A;  4QRV A;  1TL9 A;  2OZ2 A;  5F02 A;  4WUR A;  2OUL A;  3QSD A;  4P6E A;  3P5U A;  4AXL A;  4BS6 A;  1POP A;  2PAD A;  3BC3 A;  3K9M A;  2B1N A;  1KFX L;  1AU4 A;  4YYU A;  2B1M A;  3S3R A;  4CDC B;  3PHX A;  4I04 A;  2J7Q C;  1AU0 A;  4BOS A;  2AGA A;  4MZS A;  2FO5 A;  1Q6K A;  4CDF B;  1MHW A;  5JZE A;  2R9C A;  3K24 A;  4QRX A;  3PBH A;  3PHU A;  1YZB A;  3C0R A;  2IPP B;  4RY2 A;  4YV8 A;  1MS6 A;  3OIS A;  4I05 A;  1CVZ A;  1AYV A;  4OVZ A;  3V6C A;  4XR7 A;  1DF0 A;  4D8I A;  3HWN A;  2AS8 A;  4HWY A;  4MM3 B;  2Y6E A;  2UZJ A;  3TNX A;  3MP2 A;  3P5V A;  1ZCM A;  4OEL A;  2P0R A;  3E1Z B;  2JTC A;  4DMY A;  2FQ9 A;  3H8B A;  3N3K A;  3QT4 A;  3PW3 A;  3KWB X;  4MZO A;  2E00 A;  2ACT A;  1ITO A;  3IUT A;  4YVA A;  3RNV A;  4ZTB A;  3H7D A;  3WXG A;  1ICF A;  2DCC A;  1UKF A;  3H89 A;  5EGW A;  1XKG A;  2AYN A;  5JA7 A;  3OVZ A;  2YJ8 A;  9PAP A;  1PVJ A;  3PSE A;  1SNK A;  2HH5 A;  1NB5 A;  3TRK A;  2PBH A;  1HUC B;  3DF0 A;  1JQP A;  4PP2 E;  3W31 A;  2XU3 A;  2FTD A;  4X6J A;  4X6I A;  2F7D A;  4QRG A;  3IOQ A;  3BOW A;  2R9N A;  1QXP A;  2E02 A;  4BPV A;  4PI3 A;  2ARY A;  3ZUA A;  1DEU A;  3KWZ A;  2HD5 A;  3BB7 A;  1AIM A;  3S3Q A;  1CPJ A;  4ZUX U;  4R3D A;  2FE8 A;  4N4Z A;  2G8E A;  2AYO A;  4P6G A;  5CVM A;  1PAD A;  3GCB A;  3PRM A;  3USV A;  4N8W A;  3NHE A;  2AUZ A;  1FH0 A;  2DOS A;  1EWP A;  5EF4 A;  4OVZ B;  4W5C A;  4W4U A;  1KFU L;  2Y5B A;  2R9F A;  2NQA A;  3BCN A;  4A5U A;  3KX1 A;  1CJL A;  1ME3 A;  1SP4 B;  2DZZ A;  3LXS A;  3HD3 A;  1X9Y A;  4BS5 A;  1KHQ A;  2E01 A;  2FRQ A;  3MHH A;  4MI7 A;  3N3G A;  1ME4 A;  3I06 A;  2Z84 A;  2FT2 A;  3V6E A;  3KFQ A;  4YYR A;  4Q8H A;  1GLO A;  4M0W A;  3B21 A;  3BBA A;  3PHW A;  1F29 A;  3HHI A;  1AU3 A;  3D6S A;  6PAD A;  3CH2 X;  2OP3 A;  4YYS A;  2DCD A;  2HHN A;  2WBF X;  4REZ A;  2XU1 A;  1MEG A;  2FYE A;  1YAL A;  3BPM A;  3W30 A;  4RNA A;  4P16 A;  2DC9 A;  1K3B B;  3PNR A;  3LFY A;  3N4C A;  5CHT A;  1YT7 A;  2R9O A;  4RF1 A;  1PPO A;  1NB3 A;  5KO3 A;  3MOR A;  1F2B A;  4N79 A;  5JH3 A;  2CIO A;  4YYW A;  3BPF A;  3BWK A;  2BDZ A;  2NQD B;  3KSE A;  1F2C A;  1EWM A;  2BTW B;  2NQI A;  4K7C A;  2FRA A;  1STF E;  4OW0 A;  3RVW A;  2HXZ A;  1U9Q X;  2J7Q A;  1PPN A;  1F2A A;  2H7J A;  4OEM A;  4FIP A;  1PIP A;  1NL6 A;  3F75 A;  3MTN A;  3QJ3 A;  4YYV A;  1CTE A;  1U9V A;  5EZQ A;  2YJ9 A;  2ATO A;  4D8B A;  3M99 A;  1CB5 A;  3MTV A;  4BQV A;  2DJF B;  3IV2 A;  3TMP A;  3O1G A;  4KLB A;  3PDF A;  3H8C A;  1AEC A;  2R6N A;  4IP3 A;  1QOL A;  3ERV A;  3PT2 A;  4WA6 A;  7PCK A;  1NLJ A;  1IWD A;  3CBK A;  4W5B A;  2AUX A;  2PNS A;  2DC8 A;  5A24 A;  4I07 A;  1MIR A;  1PE6 A;  1GEC E;  1ZIV A;  3I3T A;  1YVB A;  1DKI A;  3IEJ A;  1QDQ A;  1NPZ A;  1AU2 A;  2IBI A;  2XU5 A;  1A6R A;  1MDW A;  4XUI A;  2XU4 A;  2JRI A;  4MSX A;  4CDE B;  2E03 A;  2JQF R;  3P5X A;  3P5W A;  1U9W A;  1Y4H A;  3WXE A;  1KHP A;  1GCB A;  5J94 A;  3RVV A;  1BGO A;  1ATK A;  2VHF A;  4DMX A;  4CDD B;  1PBH A;  1PXV A;  4BOZ A;  3K8U A;  5PAD A;  1BQI A;  3OF9 A;  3KKU A;  5CVO B;  3AI8 A;  4PP1 A;  1CS8 A;  3E9S A;  3OQC A;  3OVX A;  2G8J A;  3CBJ A;  8PCH A;  2FUD A;  4PAD A;  2AIM A;  4QBB A;  1BY8 A;  3O0U A;  1U5I A;  2F1G A;  4G54 A;  4Q8G A;  4GUA A;  5CHV A;  3PRP A;  3RVX A;  2G6D A;  1S4V A;  1CSB B;  4D8E A;  1NQC A;  1TU6 A;  1THE A;  2BDL A;  2DJG B;  2R9M A;  1U9X A;  4AXM A;  2DZY A;  3IFU A;  1PCI A;  3ZNH A;  1VSN A;  3IMA A;  3U8E A;  2DCA A;  2GHU A;  2JQG R;  3O65 A;  2DC7 A;  3HHA A;  1BP4 A;  4FJC A;  4YYQ A;  2DC6 A;  2GFO A;  4BOP A;  3OF8 A;  4IUM A;  1EWL A;  1PPD A;  1TLO A;  4BOQ A;  2YJB A;  2NQG A;  2YJC A;  1M6D A;  1VJV A;  1Y08 A;  2G7Y A;  3B79 A;  1AYU A;  4QH6 A;  3F5V A;  2DCB A;  4X6H A;  2AU1 A;  1EWO A;  2P86 A;  1AYW A;  1O0E A;  3BY4 A;  1GMY A;  5E6J A;  1KXR A;  4HXD B;  4RF0 A;  3CH3 X;  3WXF A;  4FK5 A;  5FPW A;  2P7U A;  2C0Y A;  2CB5 A;  1PPP A;  5EZS A;  4CZW A;  2VHS A;  5CVN B;  2PRE A;  4XZX A;  2HWK A;  3IHP A;  2YJ2 A;  3C9E A;  3H6S A;  2BTW A;  1CQD A;  2BU3 A;  4BOU A;  5K16 A;  1EF7 A;  3KW9 A;  1YK7 A;  4RKX A;  1YK8 A; 
#chains in the Genus database with same CATH homology
 2AVW A;  2O6X A;  1QMY A;  4BSQ A;  1CV8 A;  1MEM A;  3MHS A;  4QRV A;  1TL9 A;  2OZ2 A;  5F02 A;  2OUL A;  3QSD A;  4P6E A;  3P5U A;  4AXL A;  4BS6 A;  1POP A;  2PAD A;  3BC3 A;  3K9M A;  2B1N A;  1KFX L;  1AU4 A;  4YYU A;  2B1M A;  3S3R A;  4CDC B;  4I04 A;  1AU0 A;  4MZS A;  2FO5 A;  1Q6K A;  4CDF B;  1MHW A;  2R9C A;  3K24 A;  4QRX A;  3PBH A;  4C5P A;  2IPP B;  4RY2 A;  4YV8 A;  1MS6 A;  3OIS A;  4I05 A;  1CVZ A;  1AYV A;  3V6C A;  4XR7 A;  1DF0 A;  3HWN A;  2AS8 A;  4HWY A;  2Y6E A;  3TNX A;  3P5V A;  1ZCM A;  4OEL A;  2P0R A;  3E1Z B;  4DMY A;  2FQ9 A;  3H8B A;  3N3K A;  3QT4 A;  3PW3 A;  3KWB X;  4MZO A;  2E00 A;  2ACT A;  1ITO A;  3IUT A;  4YVA A;  4GUZ A;  3H7D A;  3WXG A;  1ICF A;  2DCC A;  3H89 A;  5EGW A;  1XKG A;  2AYN A;  5JA7 A;  3OVZ A;  2YJ8 A;  9PAP A;  1SNK A;  2HH5 A;  1NB5 A;  2PBH A;  1HUC B;  3DF0 A;  1JQP A;  4PP2 E;  2XU3 A;  1W4T A;  2FTD A;  3D9W A;  4X6J A;  4X6I A;  1GX3 A;  2F7D A;  4QRG A;  3IOQ A;  3BOW A;  2R9N A;  1QXP A;  2E02 A;  4BPV A;  4PI3 A;  2ARY A;  3ZUA A;  1DEU A;  3KWZ A;  2HD5 A;  1W6F A;  1AIM A;  3S3Q A;  1CPJ A;  4ZUX U;  4N4Z A;  2G8E A;  2AYO A;  4P6G A;  4BGF A;  5CVM A;  1PAD A;  3GCB A;  3USV A;  4N8W A;  3NHE A;  2AUZ A;  1FH0 A;  1EWP A;  5EF4 A;  4W5C A;  4W4U A;  1KFU L;  2Y5B A;  2R9F A;  2NQA A;  3BCN A;  3KX1 A;  1CJL A;  1ME3 A;  1SP4 B;  2DZZ A;  3LXS A;  3HD3 A;  1X9Y A;  4BS5 A;  1KHQ A;  2E01 A;  2FRQ A;  3MHH A;  3N3G A;  1ME4 A;  3I06 A;  2FT2 A;  3V6E A;  3KFQ A;  4YYR A;  4Q8H A;  1GLO A;  1F29 A;  3HHI A;  4NV8 A;  1AU3 A;  3D6S A;  6PAD A;  3CH2 X;  2VFB A;  2OP3 A;  4YYS A;  2DCD A;  2HHN A;  2WBF X;  2XU1 A;  1MEG A;  2FYE A;  1YAL A;  3BPM A;  2DC9 A;  1K3B B;  3PNR A;  3LFY A;  3N4C A;  5CHT A;  1YT7 A;  2R9O A;  1PPO A;  1NB3 A;  3MOR A;  4N79 A;  1F2B A;  5JH3 A;  2CIO A;  4YYW A;  3BPF A;  3BWK A;  2BDZ A;  2NQD B;  3KSE A;  1F2C A;  1EWM A;  2NQI A;  4K7C A;  2FRA A;  1STF E;  3RVW A;  2HXZ A;  1U9Q X;  1PPN A;  1F2A A;  2H7J A;  4OEM A;  4FIP A;  1PIP A;  1NL6 A;  3F75 A;  3MTN A;  3QJ3 A;  4YYV A;  1CTE A;  1U9V A;  2YJ9 A;  2ATO A;  3M99 A;  1CB5 A;  4BQV A;  2DJF B;  3IV2 A;  3O1G A;  4KLB A;  3PDF A;  3H8C A;  1AEC A;  2R6N A;  1QOL A;  3ERV A;  4WA6 A;  7PCK A;  1NLJ A;  1IWD A;  3CBK A;  4W5B A;  2AUX A;  2PNS A;  2DC8 A;  5A24 A;  1E2T A;  4I07 A;  1MIR A;  3LTW A;  1PE6 A;  1GEC E;  1ZIV A;  3I3T A;  1YVB A;  3IEJ A;  1QDQ A;  1NPZ A;  1AU2 A;  2IBI A;  2XU5 A;  1A6R A;  1MDW A;  4XUI A;  2XU4 A;  4MSX A;  4CDE B;  2E03 A;  2JQF R;  3P5X A;  3P5W A;  1U9W A;  1Y4H A;  3WXE A;  1KHP A;  1GCB A;  5J94 A;  3RVV A;  1BGO A;  1W5R A;  1ATK A;  2VHF A;  4DMX A;  4CDD B;  1PBH A;  1PXV A;  3K8U A;  5PAD A;  1BQI A;  3OF9 A;  3KKU A;  5CVO B;  3AI8 A;  4PP1 A;  1CS8 A;  3OVX A;  2G8J A;  3CBJ A;  8PCH A;  2FUD A;  4PAD A;  2AIM A;  4QBB A;  1BY8 A;  3O0U A;  1U5I A;  2F1G A;  4G54 A;  4Q8G A;  5CHV A;  3RVX A;  2G6D A;  1S4V A;  1CSB B;  2BSZ A;  4NV7 A;  1NQC A;  1TU6 A;  1THE A;  2BDL A;  2DJG B;  2R9M A;  1U9X A;  4AXM A;  2DZY A;  1PCI A;  1VSN A;  3IMA A;  3U8E A;  2DCA A;  2GHU A;  2JQG R;  2DC7 A;  3HHA A;  1BP4 A;  4FJC A;  4YYQ A;  2DC6 A;  2GFO A;  3OF8 A;  1EWL A;  1PPD A;  1TLO A;  2YJB A;  2NQG A;  2YJC A;  1M6D A;  1VJV A;  4B55 A;  1Y08 A;  2G7Y A;  3B79 A;  1AYU A;  4QH6 A;  3F5V A;  2DCB A;  4X6H A;  2AU1 A;  1EWO A;  2P86 A;  1AYW A;  1O0E A;  2VFC A;  1GMY A;  1KXR A;  3CH3 X;  3WXF A;  4FK5 A;  5FPW A;  2P7U A;  2C0Y A;  2CB5 A;  1PPP A;  4CZW A;  2VHS A;  5CVN B;  2PRE A;  3IHP A;  2YJ2 A;  3C9E A;  3H6S A;  1CQD A;  5K16 A;  1EF7 A;  3KW9 A;  1YK7 A;  1YK8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...