3CH3X

Crystal structure analysis of sera5e from plasmodium falciparum
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
265
structure length
256
Chain Sequence
b'NMFCNKEYCNRLKDENNCISNLQVEDQGNCDTSWIFASKYHLETIRCMKGYEPTKISALYVANCYKGEHKDRCDEGSSPMEFLQIIEDYGFLPAESNYPYNYVKVGEQCPKVEDHWMNLWDNGKILHGKGYTAYESERFHDNMDAFVKIIKTEVMNKGSVIAYIKAENVMGYEFSGKKVQNLCGDDTADHAVNIVGYGNYVNSEGEKKSYWIVRNSWGPYWGDEGYFKVDMYGPTHCHFNFIHSVVIFNVDLPMNN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Serine-repeat antigen protein
publication title Structural Insights into the Protease-like Antigen Plasmodium falciparum SERA5 and Its Noncanonical Active-Site Serine
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Hydrolase
total genus 72
structure length 256
sequence length 265
ec nomenclature
pdb deposition date 2008-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3ch3X00
3RVVA 2YJ9A 3IEJA 5F02A 1KFUL 3P5VA 2H7JA 1YVBA 1IWDA 1QOLA 1Y4HA 3HHAA 1HUCB 1PCIA 4PP1A 4CDCB 1QMYA 3O0UA 3M99A 3RVXA 3N3GA 2DCCA 3BPFA 3MHSA 2DCAA 1M6DA 5J94A 1U9XA 1QXPA 2DC9A 1NB5A 1XKGA 2C0YA 5CVMA 2HD5A 1PE6A 3H6SA 1CJLA 3WXFA 1Y08A 2ACTA 4CDEB 1GCBA 4BQVA 4K7CA 1GLOA 3QJ3A 1AIMA 2NQIA 2HXZA 4P6GA 1KXRA 2FT2A 2IPPB 2DC8A 3OVXA 2ATOA 1BGOA 1GMYA 1NPZA 1SNKA 1CQDA 2R9CA 2E01A 2NQDB 2DZZA 2E02A 1ZCMA 2GHUA 2DC7A 3GCBA 3K8UA 3MHHA 3P5XA 3I3TA 2O6XA 2R9OA 2JQGR 1TL9A 1YK7A 1PPPA 9PAPA 2G8JA 2OULA 1CPJA 3K9MA 7PCKA 3QT4A 1YALA 4X6JA 1PBHA 3S3RA 1F29A 2F7DA 1MEMA 3D6SA 3E1ZB 4YYRA 2G6DA 3I06A 5PADA 2DC6A 3BPMA 4Q8GA 3H7DA 4PP2E 4YVAA 3U8EA 1CV8A 2NQAA 2DJGB 2GFOA 1MS6A 4YYQA 4N79A 1AYVA 2FYEA 1POPA 2FTDA 3V6CA 3IMAA 4BS6A 3KW9A 3KFQA 1U5IA 2XU3A 2XU4A 3IUTA 4YYWA 3N3KA 2E00A 4YYSA 2PADA 1CTEA 3PBHA 5CHVA 1KHQA 2NQGA 1ICFA 3P5WA 4W5CA 4YV8A 4X6HA 3KKUA 1DF0A 4I04A 1K3BB 4PADA 2PNSA 2JQFR 3F75A 1KHPA 2VHFA 3PDFA 2P7UA 1VSNA 2FUDA 4P6EA 3N4CA 2VHSA 1AYWA 1EWPA 1KFXL 1X9YA 1AECA 3K24A 2XU1A 2DZYA 2FRQA 2R6NA 4I07A 1CSBB 2AYOA 3BWKA 2DJFB 3V6EA 2XU5A 3BC3A 2P0RA 2CIOA 4W4UA 3HHIA 4RY2A 3KWBX 1NB3A 2E03A 1AU2A 2BDZA 2FQ9A 1U9QX 1F2AA 4QBBA 1U9WA 3CH3X 3CBJA 3BOWA 2HH5A 1ME3A 5A24A 1DEUA 1FH0A 2WBFX 3ERVA 2YJCA 3MTNA 3LXSA 2CB5A 1AU0A 1MDWA 1QDQA 2B1MA 1PPDA 3C9EA 5CHTA 3RVWA 1ATKA 6PADA 1JQPA 4BS5A 1U9VA 3WXEA 4MSXA 2AIMA 5CVOB 3O1GA 3KSEA 3OF8A 4AXLA 4G54A 2AU1A 3TNXA 2FRAA 1CS8A 1BY8A 1PPNA 2ARYA 2G7YA 3H89A 1NL6A 2OP3A 2B1NA 3MORA 4BPVA 5FPWA 1CB5A 2G8EA 1EWOA 1ME4A 1STFE 2AUZA 1NLJA 4YYVA 1PADA 3P5UA 2YJBA 4X6IA 4XR7A 4CDDB 2IBIA 4WA6A 2YJ2A 3KX1A 1PXVA 4W5BA 1ITOA 4QH6A 1AU4A 2R9MA 5K16A 3CH2X 3IOQA 4DMXA 2AUXA 2R9FA 4BSQA 1VJVA 3KWZA 2P86A 5JA7A 3NHEA 1TLOA 4FK5A 1AYUA 4ZUXU 3WXGA 1MEGA 3CBKA 3ZUAA 4AXMA 1PIPA 1F2CA 4Q8HA 2FO5A 2PREA 1MHWA 4MZOA 1TU6A 2Y6EA 2Y5BA 3HD3A 3IHPA 2YJ8A 2HHNA 3B79A 2F1GA 3AI8A 4N8WA 3IV2A 4CDFB 1S4VA 4I05A 3LFYA 1O0EA 3USVA 4OEMA 3OVZA 2BDLA 4QRGA 8PCHA 4MZSA 2DCDA 5JH3A 2AS8A 3DF0A 1Q6KA 2DCBA 3OF9A 4FIPA 1THEA 3H8BA 1AU3A 3BCNA 4OELA 1CVZA 1ZIVA 3HWNA 3QSDA 2R9NA 4KLBA 5EF4A 5CVNB 2OZ2A 4HWYA 1EWMA 1SP4B 4N4ZA 4CZWA 1BQIA 2PBHA 4QRXA 3S3QA 4PI3A 1PPOA 1A6RA 1F2BA 4DMYA 1EWLA 1MIRA 1NQCA 4FJCA 5EGWA 1YT7A 2AVWA 3F5VA 3OISA 2AYNA 3PNRA 1EF7A 4QRVA 3PW3A 4YYUA 3H8CA 1GECE 4XUIA 1BP4A 1YK8A
chains in the Genus database with same CATH superfamily
3RVVA 2YJ9A 3IEJA 5F02A 1KFUL 3P5VA 5KO3A 2H7JA 1YVBA 3BB7A 1IWDA 1QOLA 1Y4HA 3HHAA 4GUAA 4RF1A 1HUCB 1PCIA 4PP1A 4CDCB 1QMYA 3PRPA 3O0UA 3M99A 3RVXA 3N3GA 4D8EA 2DCCA 3BPFA 3MHSA 2DCAA 1M6DA 5J94A 4D8BA 1U9XA 1QXPA 2DC9A 4M0WA 1NB5A 2BU3A 1UKFA 1XKGA 2C0YA 5CVMA 2HD5A 3B21A 1PE6A 3H6SA 1CJLA 3WXFA 1Y08A 2ACTA 4CDEB 1GCBA 4BQVA 4K7CA 1GLOA 3QJ3A 1AIMA 2NQIA 2HXZA 5EZSA 4P6GA 1PVJA 1KXRA 3W30A 2FT2A 2IPPB 2DC8A 3OVXA 2ATOA 1BGOA 1GMYA 1NPZA 1SNKA 1CQDA 2R9CA 2E01A 2NQDB 2DZZA 2E02A 1ZCMA 2GHUA 2DC7A 3GCBA 3K8UA 5JZEA 3MHHA 3P5XA 3I3TA 2O6XA 3BY4A 2R9OA 2JQGR 1TL9A 1YK7A 1PPPA 9PAPA 2G8JA 2OULA 1CPJA 3K9MA 7PCKA 3QT4A 1YALA 4X6JA 1PBHA 3S3RA 1F29A 2F7DA 1MEMA 3D6SA 3E1ZB 4YYRA 2G6DA 3I06A 5PADA 2DC6A 3BPMA 4Q8GA 3H7DA 4PP2E 4WURA 4YVAA 3U8EA 1CV8A 2NQAA 2DJGB 2GFOA 1MS6A 4YYQA 4N79A 4P16A 1AYVA 2FYEA 1POPA 2FTDA 3V6CA 3IMAA 5E6JA 4BS6A 3KW9A 3KFQA 1U5IA 1YZBA 4MM3B 2XU3A 2XU4A 3W31A 3IUTA 4YYWA 3N3KA 4PT5A 2E00A 4YYSA 2PADA 1CTEA 3PBHA 5CHVA 1KHQA 2J7QC 2NQGA 4R3DA 1ICFA 3P5WA 4BOUA 4W5CA 4YV8A 3PSEA 4X6HA 3KKUA 1DF0A 4I04A 1K3BB 2JTCA 4PADA 2PNSA 2JQFR 3F75A 1KHPA 2VHFA 3PDFA 2P7UA 1VSNA 2FUDA 4P6EA 4RKXA 3N4CA 2VHSA 2AGAA 4BOQA 4OW0A 1AYWA 1EWPA 2BTWB 1KFXL 1X9YA 1AECA 3K24A 3E9SA 2XU1A 2DZYA 2FRQA 2R6NA 4I07A 1CSBB 2AYOA 4REZA 3BWKA 2DJFB 3V6EA 2XU5A 3BC3A 2P0RA 2CIOA 4W4UA 2FE8A 3HHIA 4RY2A 3PRMA 3KWBX 1NB3A 2E03A 1AU2A 2BDZA 4XZXA 2FQ9A 1U9QX 1F2AA 2BTWA 4QBBA 1U9WA 3TRKA 3CH3X 3CBJA 3BOWA 3PHXA 2HH5A 4MI7A 1ME3A 2DOSA 5A24A 1DEUA 1FH0A 4OVZB 2WBFX 3ERVA 2YJCA 3O65A 3MTNA 3LXSA 2J7QA 2CB5A 1AU0A 1MDWA 1QDQA 2B1MA 1PPDA 3C9EA 3C0RA 4RF0A 3PT2A 5CHTA 3RVWA 3ZNHA 4OVZA 1ATKA 6PADA 1JQPA 4BS5A 1U9VA 3TMPA 3WXEA 4HXDB 3PHWA 2AIMA 4MSXA 5CVOB 3O1GA 3KSEA 3OF8A 4AXLA 4G54A 2AU1A 3TNXA 2FRAA 1CS8A 1BY8A 4IP3A 1PPNA 2ARYA 2G7YA 3H89A 1NL6A 2OP3A 2B1NA 3MJ5A 3MORA 4BPVA 5FPWA 4A5UA 4IUMA 1CB5A 2G8EA 3PHUA 1EWOA 1ME4A 1STFE 2AUZA 1NLJA 4YYVA 1PADA 3P5UA 2YJBA 4X6IA 4XR7A 4CDDB 2IBIA 4WA6A 2YJ2A 3KX1A 1PXVA 4W5BA 1ITOA 4QH6A 4RNAA 1AU4A 2R9MA 5K16A 3CH2X 3IOQA 4DMXA 2AUXA 2R9FA 4BSQA 1VJVA 3KWZA 2P86A 5JA7A 3NHEA 1TLOA 3MP2A 4FK5A 1AYUA 4ZUXU 3WXGA 1MEGA 3CBKA 3OQCA 3ZUAA 4AXMA 1PIPA 1F2CA 4Q8HA 2FO5A 2PREA 1MHWA 4MZOA 1TU6A 4BOSA 1DKIA 2Y6EA 2Y5BA 3HD3A 2HWKA 3IHPA 2YJ8A 2HHNA 3B79A 2F1GA 3AI8A 4N8WA 5EZQA 3IV2A 4CDFB 1S4VA 4I05A 3LFYA 1O0EA 3USVA 4OEMA 3OVZA 2BDLA 4QRGA 8PCHA 4MZSA 2DCDA 5JH3A 2Z84A 2AS8A 3DF0A 1Q6KA 2DCBA 3OF9A 4FIPA 1THEA 3H8BA 2UZJA 1AU3A 3BCNA 4OELA 1CVZA 1ZIVA 3HWNA 3QSDA 2R9NA 4D8IA 4KLBA 5EF4A 5CVNB 2OZ2A 4HWYA 1EWMA 1SP4B 4N4ZA 4CZWA 2JRIA 1BQIA 2PBHA 3BBAA 4QRXA 3S3QA 4PI3A 1PPOA 4ZTBA 1A6RA 1F2BA 3IFUA 4BOPA 4DMYA 1EWLA 1MIRA 3RNVA 1NQCA 4FJCA 5EGWA 1YT7A 2AVWA 3F5VA 3OISA 2AYNA 3PNRA 1EF7A 4QRVA 3PW3A 3MTVA 4YYUA 3H8CA 1GECE 4XUIA 1BP4A 4BOZA 1YK8A
chains in the Genus database with same CATH topology
3RVVA 2YJ9A 3IEJA 5F02A 1KFUL 3P5VA 2H7JA 1YVBA 1IWDA 1QOLA 1Y4HA 3HHAA 1HUCB 1PCIA 4PP1A 4CDCB 1QMYA 3O0UA 3M99A 3RVXA 3N3GA 2DCCA 1GX3A 3BPFA 3MHSA 2DCAA 1M6DA 5J94A 1U9XA 1QXPA 2DC9A 1NB5A 1XKGA 2C0YA 5CVMA 2HD5A 1PE6A 3H6SA 1CJLA 3WXFA 1Y08A 2ACTA 4CDEB 1GCBA 4BQVA 4K7CA 1GLOA 3QJ3A 1AIMA 2NQIA 2HXZA 4GUZA 4P6GA 1KXRA 2FT2A 2IPPB 2DC8A 3OVXA 2ATOA 1BGOA 1GMYA 1NPZA 1SNKA 1CQDA 2R9CA 2E01A 2NQDB 2DZZA 2E02A 1ZCMA 2GHUA 2DC7A 3GCBA 3K8UA 3MHHA 3P5XA 3I3TA 2O6XA 2R9OA 2JQGR 1TL9A 1YK7A 1PPPA 9PAPA 2G8JA 2OULA 1CPJA 3K9MA 7PCKA 3QT4A 1YALA 4X6JA 1PBHA 3S3RA 1F29A 2F7DA 1MEMA 3D6SA 3E1ZB 4YYRA 2G6DA 3I06A 5PADA 2DC6A 3BPMA 4Q8GA 3H7DA 4PP2E 4YVAA 3U8EA 1CV8A 2NQAA 2DJGB 2GFOA 1MS6A 4YYQA 4N79A 1AYVA 2FYEA 1POPA 2FTDA 3V6CA 3IMAA 4BS6A 3KW9A 3KFQA 1U5IA 2XU3A 2XU4A 4C5PA 3IUTA 4YYWA 3N3KA 2E00A 4YYSA 2BSZA 2PADA 1CTEA 3PBHA 5CHVA 1KHQA 2NQGA 1ICFA 3P5WA 4W5CA 4YV8A 4X6HA 3KKUA 1DF0A 4I04A 1K3BB 4PADA 2PNSA 2JQFR 3F75A 1KHPA 2VHFA 3PDFA 2P7UA 1VSNA 2FUDA 4P6EA 3N4CA 2VHSA 1AYWA 1EWPA 1KFXL 1X9YA 1AECA 3K24A 2XU1A 2DZYA 2FRQA 2R6NA 4I07A 1CSBB 2AYOA 3BWKA 2DJFB 3V6EA 2XU5A 3BC3A 2P0RA 2CIOA 4W4UA 3HHIA 4RY2A 1E2TA 3KWBX 1NB3A 2E03A 1AU2A 2BDZA 2FQ9A 1U9QX 1F2AA 4QBBA 1U9WA 3CH3X 3CBJA 3BOWA 2HH5A 2VFCA 1ME3A 4NV8A 5A24A 1DEUA 1FH0A 2WBFX 3ERVA 2YJCA 3MTNA 3LXSA 2CB5A 1AU0A 1MDWA 1QDQA 2B1MA 1PPDA 3C9EA 5CHTA 3RVWA 1ATKA 6PADA 1JQPA 4BS5A 1U9VA 3WXEA 4MSXA 2AIMA 5CVOB 3O1GA 3D9WA 3KSEA 4BGFA 3OF8A 4AXLA 4G54A 2AU1A 3TNXA 2FRAA 1CS8A 1BY8A 1PPNA 2ARYA 2G7YA 3H89A 1NL6A 2VFBA 2OP3A 2B1NA 3MORA 4BPVA 5FPWA 1W5RA 1CB5A 2G8EA 1EWOA 1ME4A 1STFE 2AUZA 1NLJA 4YYVA 1PADA 3P5UA 2YJBA 3LTWA 4X6IA 4B55A 4XR7A 4CDDB 2IBIA 4WA6A 2YJ2A 3KX1A 1PXVA 4W5BA 1ITOA 4QH6A 1AU4A 2R9MA 5K16A 3CH2X 3IOQA 4DMXA 2AUXA 2R9FA 4BSQA 1VJVA 3KWZA 2P86A 5JA7A 3NHEA 1TLOA 4FK5A 1AYUA 4ZUXU 3WXGA 1MEGA 3CBKA 3ZUAA 4AXMA 1PIPA 1F2CA 4Q8HA 2FO5A 2PREA 1MHWA 4MZOA 1TU6A 2Y6EA 2Y5BA 3HD3A 3IHPA 2YJ8A 2HHNA 4NV7A 3B79A 2F1GA 3AI8A 4N8WA 3IV2A 4CDFB 1S4VA 4I05A 3LFYA 1O0EA 3USVA 4OEMA 3OVZA 1W6FA 2BDLA 4QRGA 8PCHA 4MZSA 2DCDA 5JH3A 2AS8A 3DF0A 1Q6KA 2DCBA 3OF9A 4FIPA 1THEA 3H8BA 1AU3A 3BCNA 4OELA 1CVZA 1ZIVA 1W4TA 3HWNA 3QSDA 2R9NA 4KLBA 5EF4A 5CVNB 2OZ2A 4HWYA 1EWMA 1SP4B 4N4ZA 4CZWA 1BQIA 2PBHA 4QRXA 3S3QA 4PI3A 1PPOA 1A6RA 1F2BA 4DMYA 1EWLA 1MIRA 1NQCA 4FJCA 5EGWA 1YT7A 2AVWA 3OISA 3F5VA 2AYNA 3PNRA 1EF7A 4QRVA 3PW3A 4YYUA 3H8CA 1GECE 4XUIA 1BP4A 1YK8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RVV A;  2YJ9 A;  3IEJ A;  5F02 A;  1KFU L;  3P5V A;  2H7J A;  1YVB A;  1IWD A;  1QOL A;  1Y4H A;  3HHA A;  1HUC B;  1PCI A;  4PP1 A;  4CDC B;  1QMY A;  3O0U A;  3M99 A;  3RVX A;  3N3G A;  2DCC A;  3BPF A;  3MHS A;  2DCA A;  1M6D A;  5J94 A;  1U9X A;  1QXP A;  2DC9 A;  1NB5 A;  1XKG A;  2C0Y A;  5CVM A;  2HD5 A;  1PE6 A;  3H6S A;  1CJL A;  3WXF A;  1Y08 A;  2ACT A;  4CDE B;  1GCB A;  4BQV A;  4K7C A;  1GLO A;  3QJ3 A;  1AIM A;  2NQI A;  2HXZ A;  4P6G A;  1KXR A;  2FT2 A;  2IPP B;  2DC8 A;  3OVX A;  2ATO A;  1BGO A;  1GMY A;  1NPZ A;  1SNK A;  1CQD A;  2R9C A;  2E01 A;  2NQD B;  2DZZ A;  2E02 A;  1ZCM A;  2GHU A;  2DC7 A;  3GCB A;  3K8U A;  3MHH A;  3P5X A;  3I3T A;  2O6X A;  2R9O A;  2JQG R;  1TL9 A;  1YK7 A;  1PPP A;  9PAP A;  2G8J A;  2OUL A;  1CPJ A;  3K9M A;  7PCK A;  3QT4 A;  1YAL A;  4X6J A;  1PBH A;  3S3R A;  1F29 A;  2F7D A;  1MEM A;  3D6S A;  3E1Z B;  4YYR A;  2G6D A;  3I06 A;  5PAD A;  2DC6 A;  3BPM A;  4Q8G A;  3H7D A;  4PP2 E;  4YVA A;  3U8E A;  1CV8 A;  2NQA A;  2DJG B;  2GFO A;  1MS6 A;  4YYQ A;  4N79 A;  1AYV A;  2FYE A;  1POP A;  2FTD A;  3V6C A;  3IMA A;  4BS6 A;  3KW9 A;  3KFQ A;  1U5I A;  2XU3 A;  2XU4 A;  3IUT A;  4YYW A;  3N3K A;  2E00 A;  4YYS A;  2PAD A;  1CTE A;  3PBH A;  5CHV A;  1KHQ A;  2NQG A;  1ICF A;  3P5W A;  4W5C A;  4YV8 A;  4X6H A;  3KKU A;  1DF0 A;  4I04 A;  1K3B B;  4PAD A;  2PNS A;  2JQF R;  3F75 A;  1KHP A;  2VHF A;  3PDF A;  2P7U A;  1VSN A;  2FUD A;  4P6E A;  3N4C A;  2VHS A;  1AYW A;  1EWP A;  1KFX L;  1X9Y A;  1AEC A;  3K24 A;  2XU1 A;  2DZY A;  2FRQ A;  2R6N A;  4I07 A;  1CSB B;  2AYO A;  3BWK A;  2DJF B;  3V6E A;  2XU5 A;  3BC3 A;  2P0R A;  2CIO A;  4W4U A;  3HHI A;  4RY2 A;  3KWB X;  1NB3 A;  2E03 A;  1AU2 A;  2BDZ A;  2FQ9 A;  1U9Q X;  1F2A A;  4QBB A;  1U9W A;  3CH3 X;  3CBJ A;  3BOW A;  2HH5 A;  1ME3 A;  5A24 A;  1DEU A;  1FH0 A;  2WBF X;  3ERV A;  2YJC A;  3MTN A;  3LXS A;  2CB5 A;  1AU0 A;  1MDW A;  1QDQ A;  2B1M A;  1PPD A;  3C9E A;  5CHT A;  3RVW A;  1ATK A;  6PAD A;  1JQP A;  4BS5 A;  1U9V A;  3WXE A;  4MSX A;  2AIM A;  5CVO B;  3O1G A;  3KSE A;  3OF8 A;  4AXL A;  4G54 A;  2AU1 A;  3TNX A;  2FRA A;  1CS8 A;  1BY8 A;  1PPN A;  2ARY A;  2G7Y A;  3H89 A;  1NL6 A;  2OP3 A;  2B1N A;  3MOR A;  4BPV A;  5FPW A;  1CB5 A;  2G8E A;  1EWO A;  1ME4 A;  1STF E;  2AUZ A;  1NLJ A;  4YYV A;  1PAD A;  3P5U A;  2YJB A;  4X6I A;  4XR7 A;  4CDD B;  2IBI A;  4WA6 A;  2YJ2 A;  3KX1 A;  1PXV A;  4W5B A;  1ITO A;  4QH6 A;  1AU4 A;  2R9M A;  5K16 A;  3CH2 X;  3IOQ A;  4DMX A;  2AUX A;  2R9F A;  4BSQ A;  1VJV A;  3KWZ A;  2P86 A;  5JA7 A;  3NHE A;  1TLO A;  4FK5 A;  1AYU A;  4ZUX U;  3WXG A;  1MEG A;  3CBK A;  3ZUA A;  4AXM A;  1PIP A;  1F2C A;  4Q8H A;  2FO5 A;  2PRE A;  1MHW A;  4MZO A;  1TU6 A;  2Y6E A;  2Y5B A;  3HD3 A;  3IHP A;  2YJ8 A;  2HHN A;  3B79 A;  2F1G A;  3AI8 A;  4N8W A;  3IV2 A;  4CDF B;  1S4V A;  4I05 A;  3LFY A;  1O0E A;  3USV A;  4OEM A;  3OVZ A;  2BDL A;  4QRG A;  8PCH A;  4MZS A;  2DCD A;  5JH3 A;  2AS8 A;  3DF0 A;  1Q6K A;  2DCB A;  3OF9 A;  4FIP A;  1THE A;  3H8B A;  1AU3 A;  3BCN A;  4OEL A;  1CVZ A;  1ZIV A;  3HWN A;  3QSD A;  2R9N A;  4KLB A;  5EF4 A;  5CVN B;  2OZ2 A;  4HWY A;  1EWM A;  1SP4 B;  4N4Z A;  4CZW A;  1BQI A;  2PBH A;  4QRX A;  3S3Q A;  4PI3 A;  1PPO A;  1A6R A;  1F2B A;  4DMY A;  1EWL A;  1MIR A;  1NQC A;  4FJC A;  5EGW A;  1YT7 A;  2AVW A;  3F5V A;  3OIS A;  2AYN A;  3PNR A;  1EF7 A;  4QRV A;  3PW3 A;  4YYU A;  3H8C A;  1GEC E;  4XUI A;  1BP4 A;  1YK8 A; 
#chains in the Genus database with same CATH topology
 3RVV A;  2YJ9 A;  3IEJ A;  5F02 A;  1KFU L;  3P5V A;  5KO3 A;  2H7J A;  1YVB A;  3BB7 A;  1IWD A;  1QOL A;  1Y4H A;  3HHA A;  4GUA A;  4RF1 A;  1HUC B;  1PCI A;  4PP1 A;  4CDC B;  1QMY A;  3PRP A;  3O0U A;  3M99 A;  3RVX A;  3N3G A;  4D8E A;  2DCC A;  3BPF A;  3MHS A;  2DCA A;  1M6D A;  5J94 A;  4D8B A;  1U9X A;  1QXP A;  2DC9 A;  4M0W A;  1NB5 A;  2BU3 A;  1UKF A;  1XKG A;  2C0Y A;  5CVM A;  2HD5 A;  3B21 A;  1PE6 A;  3H6S A;  1CJL A;  3WXF A;  1Y08 A;  2ACT A;  4CDE B;  1GCB A;  4BQV A;  4K7C A;  1GLO A;  3QJ3 A;  1AIM A;  2NQI A;  2HXZ A;  5EZS A;  4P6G A;  1PVJ A;  1KXR A;  3W30 A;  2FT2 A;  2IPP B;  2DC8 A;  3OVX A;  2ATO A;  1BGO A;  1GMY A;  1NPZ A;  1SNK A;  1CQD A;  2R9C A;  2E01 A;  2NQD B;  2DZZ A;  2E02 A;  1ZCM A;  2GHU A;  2DC7 A;  3GCB A;  3K8U A;  5JZE A;  3MHH A;  3P5X A;  3I3T A;  2O6X A;  3BY4 A;  2R9O A;  2JQG R;  1TL9 A;  1YK7 A;  1PPP A;  9PAP A;  2G8J A;  2OUL A;  1CPJ A;  3K9M A;  7PCK A;  3QT4 A;  1YAL A;  4X6J A;  1PBH A;  3S3R A;  1F29 A;  2F7D A;  1MEM A;  3D6S A;  3E1Z B;  4YYR A;  2G6D A;  3I06 A;  5PAD A;  2DC6 A;  3BPM A;  4Q8G A;  3H7D A;  4PP2 E;  4WUR A;  4YVA A;  3U8E A;  1CV8 A;  2NQA A;  2DJG B;  2GFO A;  1MS6 A;  4YYQ A;  4N79 A;  4P16 A;  1AYV A;  2FYE A;  1POP A;  2FTD A;  3V6C A;  3IMA A;  5E6J A;  4BS6 A;  3KW9 A;  3KFQ A;  1U5I A;  1YZB A;  4MM3 B;  2XU3 A;  2XU4 A;  3W31 A;  3IUT A;  4YYW A;  3N3K A;  4PT5 A;  2E00 A;  4YYS A;  2PAD A;  1CTE A;  3PBH A;  5CHV A;  1KHQ A;  2J7Q C;  2NQG A;  4R3D A;  1ICF A;  3P5W A;  4BOU A;  4W5C A;  4YV8 A;  3PSE A;  4X6H A;  3KKU A;  1DF0 A;  4I04 A;  1K3B B;  2JTC A;  4PAD A;  2PNS A;  2JQF R;  3F75 A;  1KHP A;  2VHF A;  3PDF A;  2P7U A;  1VSN A;  2FUD A;  4P6E A;  4RKX A;  3N4C A;  2VHS A;  2AGA A;  4BOQ A;  4OW0 A;  1AYW A;  1EWP A;  2BTW B;  1KFX L;  1X9Y A;  1AEC A;  3K24 A;  3E9S A;  2XU1 A;  2DZY A;  2FRQ A;  2R6N A;  4I07 A;  1CSB B;  2AYO A;  4REZ A;  3BWK A;  2DJF B;  3V6E A;  2XU5 A;  3BC3 A;  2P0R A;  2CIO A;  4W4U A;  2FE8 A;  3HHI A;  4RY2 A;  3PRM A;  3KWB X;  1NB3 A;  2E03 A;  1AU2 A;  2BDZ A;  4XZX A;  2FQ9 A;  1U9Q X;  1F2A A;  2BTW A;  4QBB A;  1U9W A;  3TRK A;  3CH3 X;  3CBJ A;  3BOW A;  3PHX A;  2HH5 A;  4MI7 A;  1ME3 A;  2DOS A;  5A24 A;  1DEU A;  1FH0 A;  4OVZ B;  2WBF X;  3ERV A;  2YJC A;  3O65 A;  3MTN A;  3LXS A;  2J7Q A;  2CB5 A;  1AU0 A;  1MDW A;  1QDQ A;  2B1M A;  1PPD A;  3C9E A;  3C0R A;  4RF0 A;  3PT2 A;  5CHT A;  3RVW A;  3ZNH A;  4OVZ A;  1ATK A;  6PAD A;  1JQP A;  4BS5 A;  1U9V A;  3TMP A;  3WXE A;  4HXD B;  3PHW A;  2AIM A;  4MSX A;  5CVO B;  3O1G A;  3KSE A;  3OF8 A;  4AXL A;  4G54 A;  2AU1 A;  3TNX A;  2FRA A;  1CS8 A;  1BY8 A;  4IP3 A;  1PPN A;  2ARY A;  2G7Y A;  3H89 A;  1NL6 A;  2OP3 A;  2B1N A;  3MJ5 A;  3MOR A;  4BPV A;  5FPW A;  4A5U A;  4IUM A;  1CB5 A;  2G8E A;  3PHU A;  1EWO A;  1ME4 A;  1STF E;  2AUZ A;  1NLJ A;  4YYV A;  1PAD A;  3P5U A;  2YJB A;  4X6I A;  4XR7 A;  4CDD B;  2IBI A;  4WA6 A;  2YJ2 A;  3KX1 A;  1PXV A;  4W5B A;  1ITO A;  4QH6 A;  4RNA A;  1AU4 A;  2R9M A;  5K16 A;  3CH2 X;  3IOQ A;  4DMX A;  2AUX A;  2R9F A;  4BSQ A;  1VJV A;  3KWZ A;  2P86 A;  5JA7 A;  3NHE A;  1TLO A;  3MP2 A;  4FK5 A;  1AYU A;  4ZUX U;  3WXG A;  1MEG A;  3CBK A;  3OQC A;  3ZUA A;  4AXM A;  1PIP A;  1F2C A;  4Q8H A;  2FO5 A;  2PRE A;  1MHW A;  4MZO A;  1TU6 A;  4BOS A;  1DKI A;  2Y6E A;  2Y5B A;  3HD3 A;  2HWK A;  3IHP A;  2YJ8 A;  2HHN A;  3B79 A;  2F1G A;  3AI8 A;  4N8W A;  5EZQ A;  3IV2 A;  4CDF B;  1S4V A;  4I05 A;  3LFY A;  1O0E A;  3USV A;  4OEM A;  3OVZ A;  2BDL A;  4QRG A;  8PCH A;  4MZS A;  2DCD A;  5JH3 A;  2Z84 A;  2AS8 A;  3DF0 A;  1Q6K A;  2DCB A;  3OF9 A;  4FIP A;  1THE A;  3H8B A;  2UZJ A;  1AU3 A;  3BCN A;  4OEL A;  1CVZ A;  1ZIV A;  3HWN A;  3QSD A;  2R9N A;  4D8I A;  4KLB A;  5EF4 A;  5CVN B;  2OZ2 A;  4HWY A;  1EWM A;  1SP4 B;  4N4Z A;  4CZW A;  2JRI A;  1BQI A;  2PBH A;  3BBA A;  4QRX A;  3S3Q A;  4PI3 A;  1PPO A;  4ZTB A;  1A6R A;  1F2B A;  3IFU A;  4BOP A;  4DMY A;  1EWL A;  1MIR A;  3RNV A;  1NQC A;  4FJC A;  5EGW A;  1YT7 A;  2AVW A;  3F5V A;  3OIS A;  2AYN A;  3PNR A;  1EF7 A;  4QRV A;  3PW3 A;  3MTV A;  4YYU A;  3H8C A;  1GEC E;  4XUI A;  1BP4 A;  4BOZ A;  1YK8 A; 
#chains in the Genus database with same CATH homology
 3RVV A;  2YJ9 A;  3IEJ A;  5F02 A;  1KFU L;  3P5V A;  2H7J A;  1YVB A;  1IWD A;  1QOL A;  1Y4H A;  3HHA A;  1HUC B;  1PCI A;  4PP1 A;  4CDC B;  1QMY A;  3O0U A;  3M99 A;  3RVX A;  3N3G A;  2DCC A;  1GX3 A;  3BPF A;  3MHS A;  2DCA A;  1M6D A;  5J94 A;  1U9X A;  1QXP A;  2DC9 A;  1NB5 A;  1XKG A;  2C0Y A;  5CVM A;  2HD5 A;  1PE6 A;  3H6S A;  1CJL A;  3WXF A;  1Y08 A;  2ACT A;  4CDE B;  1GCB A;  4BQV A;  4K7C A;  1GLO A;  3QJ3 A;  1AIM A;  2NQI A;  2HXZ A;  4GUZ A;  4P6G A;  1KXR A;  2FT2 A;  2IPP B;  2DC8 A;  3OVX A;  2ATO A;  1BGO A;  1GMY A;  1NPZ A;  1SNK A;  1CQD A;  2R9C A;  2E01 A;  2NQD B;  2DZZ A;  2E02 A;  1ZCM A;  2GHU A;  2DC7 A;  3GCB A;  3K8U A;  3MHH A;  3P5X A;  3I3T A;  2O6X A;  2R9O A;  2JQG R;  1TL9 A;  1YK7 A;  1PPP A;  9PAP A;  2G8J A;  2OUL A;  1CPJ A;  3K9M A;  7PCK A;  3QT4 A;  1YAL A;  4X6J A;  1PBH A;  3S3R A;  1F29 A;  2F7D A;  1MEM A;  3D6S A;  3E1Z B;  4YYR A;  2G6D A;  3I06 A;  5PAD A;  2DC6 A;  3BPM A;  4Q8G A;  3H7D A;  4PP2 E;  4YVA A;  3U8E A;  1CV8 A;  2NQA A;  2DJG B;  2GFO A;  1MS6 A;  4YYQ A;  4N79 A;  1AYV A;  2FYE A;  1POP A;  2FTD A;  3V6C A;  3IMA A;  4BS6 A;  3KW9 A;  3KFQ A;  1U5I A;  2XU3 A;  2XU4 A;  4C5P A;  3IUT A;  4YYW A;  3N3K A;  2E00 A;  4YYS A;  2BSZ A;  2PAD A;  1CTE A;  3PBH A;  5CHV A;  1KHQ A;  2NQG A;  1ICF A;  3P5W A;  4W5C A;  4YV8 A;  4X6H A;  3KKU A;  1DF0 A;  4I04 A;  1K3B B;  4PAD A;  2PNS A;  2JQF R;  3F75 A;  1KHP A;  2VHF A;  3PDF A;  2P7U A;  1VSN A;  2FUD A;  4P6E A;  3N4C A;  2VHS A;  1AYW A;  1EWP A;  1KFX L;  1X9Y A;  1AEC A;  3K24 A;  2XU1 A;  2DZY A;  2FRQ A;  2R6N A;  4I07 A;  1CSB B;  2AYO A;  3BWK A;  2DJF B;  3V6E A;  2XU5 A;  3BC3 A;  2P0R A;  2CIO A;  4W4U A;  3HHI A;  4RY2 A;  1E2T A;  3KWB X;  1NB3 A;  2E03 A;  1AU2 A;  2BDZ A;  2FQ9 A;  1U9Q X;  1F2A A;  4QBB A;  1U9W A;  3CH3 X;  3CBJ A;  3BOW A;  2HH5 A;  2VFC A;  1ME3 A;  4NV8 A;  5A24 A;  1DEU A;  1FH0 A;  2WBF X;  3ERV A;  2YJC A;  3MTN A;  3LXS A;  2CB5 A;  1AU0 A;  1MDW A;  1QDQ A;  2B1M A;  1PPD A;  3C9E A;  5CHT A;  3RVW A;  1ATK A;  6PAD A;  1JQP A;  4BS5 A;  1U9V A;  3WXE A;  4MSX A;  2AIM A;  5CVO B;  3O1G A;  3D9W A;  3KSE A;  4BGF A;  3OF8 A;  4AXL A;  4G54 A;  2AU1 A;  3TNX A;  2FRA A;  1CS8 A;  1BY8 A;  1PPN A;  2ARY A;  2G7Y A;  3H89 A;  1NL6 A;  2VFB A;  2OP3 A;  2B1N A;  3MOR A;  4BPV A;  5FPW A;  1W5R A;  1CB5 A;  2G8E A;  1EWO A;  1ME4 A;  1STF E;  2AUZ A;  1NLJ A;  4YYV A;  1PAD A;  3P5U A;  2YJB A;  3LTW A;  4X6I A;  4B55 A;  4XR7 A;  4CDD B;  2IBI A;  4WA6 A;  2YJ2 A;  3KX1 A;  1PXV A;  4W5B A;  1ITO A;  4QH6 A;  1AU4 A;  2R9M A;  5K16 A;  3CH2 X;  3IOQ A;  4DMX A;  2AUX A;  2R9F A;  4BSQ A;  1VJV A;  3KWZ A;  2P86 A;  5JA7 A;  3NHE A;  1TLO A;  4FK5 A;  1AYU A;  4ZUX U;  3WXG A;  1MEG A;  3CBK A;  3ZUA A;  4AXM A;  1PIP A;  1F2C A;  4Q8H A;  2FO5 A;  2PRE A;  1MHW A;  4MZO A;  1TU6 A;  2Y6E A;  2Y5B A;  3HD3 A;  3IHP A;  2YJ8 A;  2HHN A;  4NV7 A;  3B79 A;  2F1G A;  3AI8 A;  4N8W A;  3IV2 A;  4CDF B;  1S4V A;  4I05 A;  3LFY A;  1O0E A;  3USV A;  4OEM A;  3OVZ A;  1W6F A;  2BDL A;  4QRG A;  8PCH A;  4MZS A;  2DCD A;  5JH3 A;  2AS8 A;  3DF0 A;  1Q6K A;  2DCB A;  3OF9 A;  4FIP A;  1THE A;  3H8B A;  1AU3 A;  3BCN A;  4OEL A;  1CVZ A;  1ZIV A;  1W4T A;  3HWN A;  3QSD A;  2R9N A;  4KLB A;  5EF4 A;  5CVN B;  2OZ2 A;  4HWY A;  1EWM A;  1SP4 B;  4N4Z A;  4CZW A;  1BQI A;  2PBH A;  4QRX A;  3S3Q A;  4PI3 A;  1PPO A;  1A6R A;  1F2B A;  4DMY A;  1EWL A;  1MIR A;  1NQC A;  4FJC A;  5EGW A;  1YT7 A;  2AVW A;  3OIS A;  3F5V A;  2AYN A;  3PNR A;  1EF7 A;  4QRV A;  3PW3 A;  4YYU A;  3H8C A;  1GEC E;  4XUI A;  1BP4 A;  1YK8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...