4BOUA

Structure of otud3 otu domain
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
141
structure length
141
Chain Sequence
GPEFVSFANQLQALGLKLREVPGDGNCLFRALGDQLEGHSRNHLKHRQETVDYMIKQREDFEPFVEDDIPFEKHVASLAKPGTFAGNDAIVAFARNHQLNVVIHQLNAPLWQIRGTEKSSVRELHIAYRYGEHYDSVRRIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Otu Deubiquitinases Reveal Mechanisms of Linkage Specificity and Enable Ubiquitin Chain Restriction Analysis.
pubmed doi rcsb
molecule keywords OTU DOMAIN-CONTAINING PROTEIN 3
molecule tags Hydrolase
source organism Homo sapiens
total genus 47
structure length 141
sequence length 141
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2013-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02338 OTU OTU-like cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.80 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 4bouA00
3PT2A 4BOSA 5JZEA 3PRMA 3TMPA 4BOQA 3BY4A 3PSEA 4HXDB 3PRPA 4BOZA 3C0RA 4BOUA 3PHXA 3ZNHA 3PHWA 4BOPA 3PHUA
chains in the Genus database with same CATH superfamily
4QH6A 2PBHA 5CVOB 1AYUA 2JRIA 1CS8A 4Q8GA 2GHUA 3USVA 1BGOA 4CDDB 3D6SA 3CH2X 3BWKA 3IV2A 3BPMA 1U9WA 3PRMA 1O0EA 1EWPA 2E02A 3PHXA 1POPA 1VSNA 2YJBA 4RKXA 2ARYA 3N3KA 5CVNB 4BQVA 1QDQA 2BTWB 1THEA 4BSQA 2XU4A 2OULA 1YVBA 3IMAA 4I04A 1K3BB 4AXLA 4PT5A 3MORA 1PBHA 3C0RA 3P5XA 2FYEA 3BBAA 2XU1A 4YVAA 5EF4A 2VHFA 4OVZA 1STFE 3HD3A 1MS6A 2JTCA 4XUIA 2PNSA 3RVVA 3F75A 4PP2E 4BOSA 2YJCA 1AECA 2F7DA 1PCIA 2FO5A 5EZQA 4BS5A 1EF7A 5CVMA 4MSXA 3HHAA 5F02A 1F2AA 3IOQA 3ZUAA 3BC3A 4Q8HA 3MHSA 1AU3A 2IPPB 4FJCA 3OF8A 1NB3A 4W5CA 3MHHA 1HUCB 4BS6A 4ZUXU 3N3GA 2HH5A 1ME4A 1XKGA 1QOLA 3KWBX 1CV8A 3K24A 9PAPA 1A6RA 1AYVA 1ITOA 3OISA 2FTDA 1MIRA 3O0UA 3MTNA 5EZSA 1AU2A 3HHIA 3PW3A 3IUTA 1GMYA 5E6JA 2UZJA 3BCNA 1PXVA 2DJGB 1F2CA 3PT2A 4A5UA 2FQ9A 4FIPA 1PPOA 3KWZA 3RVXA 4BOUA 4D8BA 3CBJA 2PREA 3H8CA 2Z84A 4HXDB 1AU4A 5FPWA 4QBBA 3RNVA 3IEJA 1VJVA 1PE6A 2XU3A 1F29A 4PI3A 2AS8A 4XZXA 1EWLA 1ZCMA 3I3TA 4REZA 4W5BA 4OEMA 2C0YA 3V6CA 1YK7A 3BY4A 4BOZA 1NB5A 2FUDA 2ACTA 4DMXA 1CVZA 1FH0A 2WBFX 3KFQA 1NLJA 3CH3X 4I05A 4R3DA 2NQAA 4MZOA 3RVWA 4CDEB 2B1MA 1MEGA 2B1NA 3WXEA 4YYRA 4HWYA 4N79A 3U8EA 3HWNA 3PNRA 1SP4B 3C9EA 3P5WA 4YYWA 1BQIA 1ATKA 2G7YA 3NHEA 2O6XA 1KFUL 4QRVA 4IUMA 1Q6KA 1ME3A 4BOPA 3K9MA 3PBHA 4XR7A 2FE8A 1YZBA 1NPZA 3BOWA 4OVZB 2E01A 2BU3A 4ZTBA 1Y4HA 4MZSA 3MP2A 3W30A 1CTEA 5EGWA 1EWMA 2DC7A 3PHUA 1AIMA 2R6NA 4OW0A 4PADA 2HXZA 2GFOA 1CQDA 2DCBA 3CBKA 5J94A 6PADA 1SNKA 2R9FA 4G54A 1GLOA 2FRQA 5A24A 1JQPA 4P6EA 2AGAA 3LXSA 3PHWA 4X6IA 4N8WA 2NQDB 3MTVA 4RY2A 1S4VA 3E1ZB 3PDFA 4YYQA 4AXMA 1CB5A 1U5IA 3E9SA 2BDZA 4QRGA 2E03A 2HWKA 2DCAA 4X6JA 3V6EA 3KSEA 3TRKA 1DEUA 1PPNA 2DJFB 1Y08A 2PADA 7PCKA 3H89A 1YK8A 2DCDA 4I07A 2FT2A 1PVJA 4M0WA 4D8EA 1KHQA 2YJ8A 4X6HA 4BOQA 2VHSA 3N4CA 2BDLA 2OP3A 1QXPA 5PADA 2DC8A 4BPVA 3H7DA 2CB5A 4D8IA 3W31A 2AUZA 3H8BA 3B79A 3P5VA 2P0RA 3PRPA 3AI8A 1CPJA 2DC6A 5CHTA 3OVZA 2HHNA 2F1GA 3GCBA 4WA6A 1IWDA 2YJ2A 3B21A 3KKUA 2NQIA 1KHPA 3F5VA 2DZYA 3K8UA 4YYUA 2CIOA 2J7QA 4YYSA 3S3QA 2AIMA 1GCBA 1NL6A 4DMYA 3TNXA 4IP3A 2AUXA 4P16A 2AYNA 2FRAA 1U9QX 3QT4A 1F2BA 1X9YA 3IFUA 1UKFA 3OVXA 3WXGA 2XU5A 1PIPA 3M99A 3MJ5A 4N4ZA 1ICFA 2P7UA 2H7JA 1ZIVA 5JH3A 2DC9A 3H6SA 4RF1A 3PSEA 2R9MA 3KX1A 1TL9A 5CHVA 1GECE 2BTWA 3LFYA 1TU6A 2Y6EA 4RNAA 1MHWA 1KXRA 2J7QC 3I06A 4CZWA 1YT7A 1AYWA 3QJ3A 2G6DA 2DOSA 4PP1A 1KFXL 1YALA 3OQCA 3OF9A 1PPPA 2E00A 2JQGR 2G8JA 8PCHA 4GUAA 1U9XA 3O65A 2JQFR 1BY8A 2R9OA 2ATOA 1NQCA 1QMYA 3DF0A 2Y5BA 2AVWA 1DKIA 2P86A 1PADA 2DZZA 2R9CA 3O1GA 3BB7A 4MM3B 5KO3A 2AU1A 3KW9A 4RF0A 4FK5A 1PPDA 2OZ2A 2DCCA 1CSBB 2NQGA 4CDFB 3WXFA 3TMPA 2HD5A 4K7CA 5JZEA 3P5UA 3IHPA 4OELA 4P6GA 1DF0A 2YJ9A 1EWOA 4WURA 5K16A 2AYOA 1BP4A 1AU0A 3ZNHA 3BPFA 4KLBA 4YYVA 4QRXA 1MEMA 2IBIA 1U9VA 1M6DA 3QSDA 3ERVA 1MDWA 4MI7A 5JA7A 3S3RA 4CDCB 1TLOA 2G8EA 4YV8A 4W4UA 1CJLA 2R9NA
chains in the Genus database with same CATH topology
2Z84A 4HXDB 3RNVA 2BTWA 2JRIA 3E9SA 4RNAA 4XZXA 2HWKA 2J7QC 3PRMA 3TRKA 4REZA 3PHXA 4RKXA 3BY4A 2DOSA 4BOZA 3OQCA 2BTWB 1PVJA 4M0WA 4D8EA 4R3DA 4GUAA 4PT5A 3C0RA 3BBAA 4BOQA 3O65A 4OVZA 2JTCA 1DKIA 4D8IA 3W31A 4MM3B 3BB7A 5KO3A 4BOSA 4RF0A 3PRPA 4IUMA 5EZQA 4BOPA 3TMPA 2FE8A 1YZBA 5JZEA 4OVZB 2BU3A 4ZTBA 3MP2A 3B21A 3W30A 3PHUA 4WURA 4OW0A 2J7QA 3ZNHA 4IP3A 4P16A 4MI7A 3IFUA 1UKFA 5EZSA 3MJ5A 5E6JA 2UZJA 2AGAA 3PHWA 3PT2A 4A5UA 3MTVA 4RF1A 3PSEA 4BOUA 4D8BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PT2 A;  4BOS A;  5JZE A;  3PRM A;  3TMP A;  4BOQ A;  3BY4 A;  3PSE A;  4HXD B;  3PRP A;  4BOZ A;  3C0R A;  4BOU A;  3PHX A;  3ZNH A;  3PHW A;  4BOP A;  3PHU A; 
#chains in the Genus database with same CATH topology
 4QH6 A;  2PBH A;  5CVO B;  1AYU A;  2JRI A;  1CS8 A;  4Q8G A;  2GHU A;  3USV A;  1BGO A;  4CDD B;  3D6S A;  3CH2 X;  3BWK A;  3IV2 A;  3BPM A;  1U9W A;  3PRM A;  1O0E A;  1EWP A;  2E02 A;  3PHX A;  1POP A;  1VSN A;  2YJB A;  4RKX A;  2ARY A;  3N3K A;  5CVN B;  4BQV A;  1QDQ A;  2BTW B;  1THE A;  4BSQ A;  2XU4 A;  2OUL A;  1YVB A;  3IMA A;  4I04 A;  1K3B B;  4AXL A;  4PT5 A;  3MOR A;  1PBH A;  3C0R A;  3P5X A;  2FYE A;  3BBA A;  2XU1 A;  4YVA A;  5EF4 A;  2VHF A;  4OVZ A;  1STF E;  3HD3 A;  1MS6 A;  2JTC A;  4XUI A;  2PNS A;  3RVV A;  3F75 A;  4PP2 E;  4BOS A;  2YJC A;  1AEC A;  2F7D A;  1PCI A;  2FO5 A;  5EZQ A;  4BS5 A;  1EF7 A;  5CVM A;  4MSX A;  3HHA A;  5F02 A;  1F2A A;  3IOQ A;  3ZUA A;  3BC3 A;  4Q8H A;  3MHS A;  1AU3 A;  2IPP B;  4FJC A;  3OF8 A;  1NB3 A;  4W5C A;  3MHH A;  1HUC B;  4BS6 A;  4ZUX U;  3N3G A;  2HH5 A;  1ME4 A;  1XKG A;  1QOL A;  3KWB X;  1CV8 A;  3K24 A;  9PAP A;  1A6R A;  1AYV A;  1ITO A;  3OIS A;  2FTD A;  1MIR A;  3O0U A;  3MTN A;  5EZS A;  1AU2 A;  3HHI A;  3PW3 A;  3IUT A;  1GMY A;  5E6J A;  2UZJ A;  3BCN A;  1PXV A;  2DJG B;  1F2C A;  3PT2 A;  4A5U A;  2FQ9 A;  4FIP A;  1PPO A;  3KWZ A;  3RVX A;  4BOU A;  4D8B A;  3CBJ A;  2PRE A;  3H8C A;  2Z84 A;  4HXD B;  1AU4 A;  5FPW A;  4QBB A;  3RNV A;  3IEJ A;  1VJV A;  1PE6 A;  2XU3 A;  1F29 A;  4PI3 A;  2AS8 A;  4XZX A;  1EWL A;  1ZCM A;  3I3T A;  4REZ A;  4W5B A;  4OEM A;  2C0Y A;  3V6C A;  1YK7 A;  3BY4 A;  4BOZ A;  1NB5 A;  2FUD A;  2ACT A;  4DMX A;  1CVZ A;  1FH0 A;  2WBF X;  3KFQ A;  1NLJ A;  3CH3 X;  4I05 A;  4R3D A;  2NQA A;  4MZO A;  3RVW A;  4CDE B;  2B1M A;  1MEG A;  2B1N A;  3WXE A;  4YYR A;  4HWY A;  4N79 A;  3U8E A;  3HWN A;  3PNR A;  1SP4 B;  3C9E A;  3P5W A;  4YYW A;  1BQI A;  1ATK A;  2G7Y A;  3NHE A;  2O6X A;  1KFU L;  4QRV A;  4IUM A;  1Q6K A;  1ME3 A;  4BOP A;  3K9M A;  3PBH A;  4XR7 A;  2FE8 A;  1YZB A;  1NPZ A;  3BOW A;  4OVZ B;  2E01 A;  2BU3 A;  4ZTB A;  1Y4H A;  4MZS A;  3MP2 A;  3W30 A;  1CTE A;  5EGW A;  1EWM A;  2DC7 A;  3PHU A;  1AIM A;  2R6N A;  4OW0 A;  4PAD A;  2HXZ A;  2GFO A;  1CQD A;  2DCB A;  3CBK A;  5J94 A;  6PAD A;  1SNK A;  2R9F A;  4G54 A;  1GLO A;  2FRQ A;  5A24 A;  1JQP A;  4P6E A;  2AGA A;  3LXS A;  3PHW A;  4X6I A;  4N8W A;  2NQD B;  3MTV A;  4RY2 A;  1S4V A;  3E1Z B;  3PDF A;  4YYQ A;  4AXM A;  1CB5 A;  1U5I A;  3E9S A;  2BDZ A;  4QRG A;  2E03 A;  2HWK A;  2DCA A;  4X6J A;  3V6E A;  3KSE A;  3TRK A;  1DEU A;  1PPN A;  2DJF B;  1Y08 A;  2PAD A;  7PCK A;  3H89 A;  1YK8 A;  2DCD A;  4I07 A;  2FT2 A;  1PVJ A;  4M0W A;  4D8E A;  1KHQ A;  2YJ8 A;  4X6H A;  4BOQ A;  2VHS A;  3N4C A;  2BDL A;  2OP3 A;  1QXP A;  5PAD A;  2DC8 A;  4BPV A;  3H7D A;  2CB5 A;  4D8I A;  3W31 A;  2AUZ A;  3H8B A;  3B79 A;  3P5V A;  2P0R A;  3PRP A;  3AI8 A;  1CPJ A;  2DC6 A;  5CHT A;  3OVZ A;  2HHN A;  2F1G A;  3GCB A;  4WA6 A;  1IWD A;  2YJ2 A;  3B21 A;  3KKU A;  2NQI A;  1KHP A;  3F5V A;  2DZY A;  3K8U A;  4YYU A;  2CIO A;  2J7Q A;  4YYS A;  3S3Q A;  2AIM A;  1GCB A;  1NL6 A;  4DMY A;  3TNX A;  4IP3 A;  2AUX A;  4P16 A;  2AYN A;  2FRA A;  1U9Q X;  3QT4 A;  1F2B A;  1X9Y A;  3IFU A;  1UKF A;  3OVX A;  3WXG A;  2XU5 A;  1PIP A;  3M99 A;  3MJ5 A;  4N4Z A;  1ICF A;  2P7U A;  2H7J A;  1ZIV A;  5JH3 A;  2DC9 A;  3H6S A;  4RF1 A;  3PSE A;  2R9M A;  3KX1 A;  1TL9 A;  5CHV A;  1GEC E;  2BTW A;  3LFY A;  1TU6 A;  2Y6E A;  4RNA A;  1MHW A;  1KXR A;  2J7Q C;  3I06 A;  4CZW A;  1YT7 A;  1AYW A;  3QJ3 A;  2G6D A;  2DOS A;  4PP1 A;  1KFX L;  1YAL A;  3OQC A;  3OF9 A;  1PPP A;  2E00 A;  2JQG R;  2G8J A;  8PCH A;  4GUA A;  1U9X A;  3O65 A;  2JQF R;  1BY8 A;  2R9O A;  2ATO A;  1NQC A;  1QMY A;  3DF0 A;  2Y5B A;  2AVW A;  1DKI A;  2P86 A;  1PAD A;  2DZZ A;  2R9C A;  3O1G A;  3BB7 A;  4MM3 B;  5KO3 A;  2AU1 A;  3KW9 A;  4RF0 A;  4FK5 A;  1PPD A;  2OZ2 A;  2DCC A;  1CSB B;  2NQG A;  4CDF B;  3WXF A;  3TMP A;  2HD5 A;  4K7C A;  5JZE A;  3P5U A;  3IHP A;  4OEL A;  4P6G A;  1DF0 A;  2YJ9 A;  1EWO A;  4WUR A;  5K16 A;  2AYO A;  1BP4 A;  1AU0 A;  3ZNH A;  3BPF A;  4KLB A;  4YYV A;  4QRX A;  1MEM A;  2IBI A;  1U9V A;  1M6D A;  3QSD A;  3ERV A;  1MDW A;  4MI7 A;  5JA7 A;  3S3R A;  4CDC B;  1TLO A;  2G8E A;  4YV8 A;  4W4U A;  1CJL A;  2R9N A; 
#chains in the Genus database with same CATH homology
 2Z84 A;  4HXD B;  3RNV A;  2BTW A;  2JRI A;  3E9S A;  4RNA A;  4XZX A;  2HWK A;  2J7Q C;  3PRM A;  3TRK A;  4REZ A;  3PHX A;  4RKX A;  3BY4 A;  2DOS A;  4BOZ A;  3OQC A;  2BTW B;  1PVJ A;  4M0W A;  4D8E A;  4R3D A;  4GUA A;  4PT5 A;  3C0R A;  3BBA A;  4BOQ A;  3O65 A;  4OVZ A;  2JTC A;  1DKI A;  4D8I A;  3W31 A;  4MM3 B;  3BB7 A;  5KO3 A;  4BOS A;  4RF0 A;  3PRP A;  4IUM A;  5EZQ A;  4BOP A;  3TMP A;  2FE8 A;  1YZB A;  5JZE A;  4OVZ B;  2BU3 A;  4ZTB A;  3MP2 A;  3B21 A;  3W30 A;  3PHU A;  4WUR A;  4OW0 A;  2J7Q A;  3ZNH A;  4IP3 A;  4P16 A;  4MI7 A;  3IFU A;  1UKF A;  5EZS A;  3MJ5 A;  5E6J A;  2UZJ A;  2AGA A;  3PHW A;  3PT2 A;  4A5U A;  3MTV A;  4RF1 A;  3PSE A;  4BOU A;  4D8B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...