4BOUA

Structure of otud3 otu domain
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
141
structure length
141
Chain Sequence
GPEFVSFANQLQALGLKLREVPGDGNCLFRALGDQLEGHSRNHLKHRQETVDYMIKQREDFEPFVEDDIPFEKHVASLAKPGTFAGNDAIVAFARNHQLNVVIHQLNAPLWQIRGTEKSSVRELHIAYRYGEHYDSVRRIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Otu Deubiquitinases Reveal Mechanisms of Linkage Specificity and Enable Ubiquitin Chain Restriction Analysis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords OTU DOMAIN-CONTAINING PROTEIN 3
total genus 47
structure length 141
sequence length 141
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2013-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02338 OTU OTU-like cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.80 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 4bouA00
3BY4A 3PRMA 4BOQA 3PRPA 4BOSA 3PHWA 5JZEA 3PHXA 3ZNHA 4BOPA 3PHUA 3PSEA 3C0RA 4BOZA 4BOUA 3PT2A 4HXDB 3TMPA
chains in the Genus database with same CATH superfamily
4ZTBA 1M6DA 1PPNA 2P86A 1F2AA 4AXMA 1MEGA 2E03A 4R3DA 3IHPA 3HWNA 4MM3B 4IP3A 2FTDA 2YJBA 3BB7A 1U9VA 5CVNB 5EF4A 2FRQA 3ZUAA 1GECE 1TL9A 1AIMA 4PADA 3PDFA 3PT2A 3PHWA 2BU3A 3BCNA 3RNVA 2G6DA 2ACTA 2E00A 4YYSA 4OELA 2VHFA 3E1ZB 2YJ2A 4FJCA 1Q6KA 1PBHA 4RY2A 1DF0A 3RVVA 2YJ8A 3IFUA 2F7DA 1HUCB 1YK7A 1AYUA 3O65A 6PADA 4MI7A 1A6RA 2CIOA 2C0YA 4BOPA 2P7UA 1CS8A 1NB5A 4PP2E 4RF1A 4YYUA 1ICFA 3K24A 2FE8A 3HHIA 3N3KA 1KHPA 3P5WA 1PVJA 3B79A 4CDDB 4DMYA 4CDCB 3RVWA 2Z84A 3WXFA 4FIPA 1MDWA 3QSDA 1SP4B 4BSQA 4BS5A 3P5UA 2JRIA 2PADA 1CV8A 2E01A 1CJLA 1QMYA 2DCDA 1U9WA 3O1GA 1AU4A 4BOUA 1ZIVA 2NQAA 5CVMA 2JQGR 3NHEA 2XU1A 3PNRA 1MEMA 4QRVA 3LFYA 4N4ZA 2DZYA 3QJ3A 2HH5A 3K8UA 2Y6EA 4HWYA 1IWDA 3PHUA 5J94A 4N79A 3CH2X 3OF8A 4KLBA 4P16A 2J7QC 4QBBA 1FH0A 1ZCMA 2YJ9A 1NL6A 4OVZB 3CH3X 3OQCA 4I04A 8PCHA 3KX1A 1ATKA 3GCBA 3PBHA 3KWBX 2BDLA 4X6HA 1KXRA 1NPZA 2B1MA 1O0EA 3V6CA 1QXPA 4P6GA 1CSBB 1U9XA 1BQIA 3E9SA 3H89A 1K3BB 2P0RA 2R9CA 2XU3A 1POPA 4CDFB 2DOSA 1CQDA 2FT2A 4I05A 2XU4A 5F02A 1MHWA 4FK5A 3IUTA 2VHSA 3MHSA 4RNAA 1CTEA 2DC6A 3K9MA 2GFOA 2AYOA 1U9QX 2PNSA 4IUMA 4QRXA 3PSEA 2PREA 4YV8A 2BDZA 2BTWB 4MSXA 2FRAA 2XU5A 1AU0A 2R9FA 2BTWA 3BPFA 1VSNA 2NQGA 1TLOA 4XUIA 1DEUA 1NQCA 5A24A 1PCIA 5EGWA 5PADA 1TU6A 3OVXA 2AVWA 3M99A 2R9NA 3MHHA 1QOLA 3KWZA 3C0RA 3I06A 3H8CA 1STFE 1YZBA 4W4UA 2HHNA 4K7CA 2J7QA 1PADA 3H6SA 3MP2A 4DMXA 4QRGA 4M0WA 4WA6A 3KFQA 2PBHA 5CHTA 1NB3A 3WXGA 3V6EA 2DZZA 4HXDB 3TRKA 1MS6A 1BY8A 1BP4A 3ZNHA 5JH3A 1YK8A 3DF0A 1JQPA 2IPPB 2WBFX 3HHAA 3D6SA 2GHUA 1AU2A 4N8WA 1ME3A 3BY4A 1S4VA 1KHQA 4MZOA 1PPOA 2R6NA 2NQDB 3IEJA 4RKXA 5CHVA 2AGAA 2DJFB 3P5XA 4PT5A 3I3TA 2DC9A 3IV2A 4G54A 2Y5BA 3U8EA 3N3GA 2AUXA 2H7JA 1PPDA 3W31A 3MJ5A 5JA7A 1UKFA 1SNKA 4D8EA 4OEMA 3HD3A 3KSEA 4ZUXU 4REZA 5EZQA 2HWKA 3W30A 4CZWA 1GCBA 9PAPA 5E6JA 1YVBA 4BPVA 4CDEB 1CVZA 2F1GA 5JZEA 4YYVA 1PIPA 3QT4A 1BGOA 4QH6A 5K16A 1YALA 4BOQA 3BC3A 4XZXA 4BS6A 1F29A 2CB5A 4OVZA 1THEA 1GMYA 1KFXL 3PRMA 2JQFR 2G8JA 3F5VA 2DCCA 1AU3A 1EWMA 1XKGA 3BPMA 2DCAA 2JTCA 4AXLA 2ARYA 4P6EA 3CBKA 3S3QA 3IMAA 1AYVA 4PI3A 1PXVA 2OZ2A 4D8BA 1YT7A 3OISA 5FPWA 2DC8A 2YJCA 2DC7A 1MIRA 3RVXA 1X9YA 2G8EA 2HD5A 4Q8GA 4BOZA 1PPPA 4D8IA 1DKIA 1ITOA 4WURA 3PRPA 3OF9A 3N4CA 3BOWA 1AYWA 1Y08A 3AI8A 4X6JA 2NQIA 1VJVA 2R9OA 1F2BA 1NLJA 3ERVA 3BBAA 3USVA 2FYEA 4YYWA 1CB5A 3P5VA 3MTVA 2O6XA 1KFUL 2IBIA 2OP3A 3CBJA 4PP1A 3S3RA 1GLOA 2DJGB 1Y4HA 3KW9A 5EZSA 2HXZA 3H8BA 1F2CA 1AECA 2UZJA 2G7YA 2FQ9A 4X6IA 4OW0A 4BOSA 3TNXA 1EWPA 4BQVA 4YVAA 2AIMA 4YYQA 3C9EA 4GUAA 2R9MA 3BWKA 2B1NA 3TMPA 4RF0A 1PE6A 5KO3A 3H7DA 3B21A 4I07A 4W5CA 4Q8HA 3MORA 2FUDA 3LXSA 1CPJA 1EWLA 2AUZA 2DCBA 1ME4A 2FO5A 3IOQA 3KKUA 4W5BA 2OULA 1EWOA 2ATOA 2AU1A 4YYRA 4MZSA 4A5UA 1EF7A 4XR7A 3PHXA 5CVOB 3O0UA 7PCKA 2AYNA 3MTNA 1U5IA 3F75A 3PW3A 2E02A 1QDQA 3OVZA 3WXEA 2AS8A
chains in the Genus database with same CATH topology
4ZTBA 3PRMA 4RKXA 3PHWA 5EZQA 2AGAA 4GUAA 2HWKA 3O65A 2BU3A 4PT5A 4MI7A 3W30A 3MTVA 3RNVA 4REZA 5E6JA 3TMPA 4RF0A 5KO3A 4RNAA 4R3DA 3ZNHA 4BOPA 3PHUA 2JRIA 3B21A 3C0RA 4BOZA 2JTCA 4MM3B 4D8IA 3E9SA 1DKIA 4A5UA 1YZBA 4WURA 3PRPA 4IP3A 4P16A 4RF1A 3PHXA 2J7QC 4IUMA 5EZSA 2J7QA 3PSEA 5JZEA 3BB7A 2FE8A 3MP2A 3TRKA 3W31A 3MJ5A 4BOUA 4M0WA 1UKFA 2UZJA 2DOSA 4D8EA 4OW0A 2BTWB 1PVJA 3BY4A 4OVZB 4BOSA 4BOQA 3OQCA 4XZXA 3IFUA 4OVZA 4D8BA 2BTWA 3PT2A 4HXDB 3BBAA 2Z84A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BY4 A;  3PRM A;  4BOQ A;  3PRP A;  4BOS A;  3PHW A;  5JZE A;  3PHX A;  3ZNH A;  4BOP A;  3PHU A;  3PSE A;  3C0R A;  4BOZ A;  4BOU A;  3PT2 A;  4HXD B;  3TMP A; 
#chains in the Genus database with same CATH topology
 4ZTB A;  1M6D A;  1PPN A;  2P86 A;  1F2A A;  4AXM A;  1MEG A;  2E03 A;  4R3D A;  3IHP A;  3HWN A;  4MM3 B;  4IP3 A;  2FTD A;  2YJB A;  3BB7 A;  1U9V A;  5CVN B;  5EF4 A;  2FRQ A;  3ZUA A;  1GEC E;  1TL9 A;  1AIM A;  4PAD A;  3PDF A;  3PT2 A;  3PHW A;  2BU3 A;  3BCN A;  3RNV A;  2G6D A;  2ACT A;  2E00 A;  4YYS A;  4OEL A;  2VHF A;  3E1Z B;  2YJ2 A;  4FJC A;  1Q6K A;  1PBH A;  4RY2 A;  1DF0 A;  3RVV A;  2YJ8 A;  3IFU A;  2F7D A;  1HUC B;  1YK7 A;  1AYU A;  3O65 A;  6PAD A;  4MI7 A;  1A6R A;  2CIO A;  2C0Y A;  4BOP A;  2P7U A;  1CS8 A;  1NB5 A;  4PP2 E;  4RF1 A;  4YYU A;  1ICF A;  3K24 A;  2FE8 A;  3HHI A;  3N3K A;  1KHP A;  3P5W A;  1PVJ A;  3B79 A;  4CDD B;  4DMY A;  4CDC B;  3RVW A;  2Z84 A;  3WXF A;  4FIP A;  1MDW A;  3QSD A;  1SP4 B;  4BSQ A;  4BS5 A;  3P5U A;  2JRI A;  2PAD A;  1CV8 A;  2E01 A;  1CJL A;  1QMY A;  2DCD A;  1U9W A;  3O1G A;  1AU4 A;  4BOU A;  1ZIV A;  2NQA A;  5CVM A;  2JQG R;  3NHE A;  2XU1 A;  3PNR A;  1MEM A;  4QRV A;  3LFY A;  4N4Z A;  2DZY A;  3QJ3 A;  2HH5 A;  3K8U A;  2Y6E A;  4HWY A;  1IWD A;  3PHU A;  5J94 A;  4N79 A;  3CH2 X;  3OF8 A;  4KLB A;  4P16 A;  2J7Q C;  4QBB A;  1FH0 A;  1ZCM A;  2YJ9 A;  1NL6 A;  4OVZ B;  3CH3 X;  3OQC A;  4I04 A;  8PCH A;  3KX1 A;  1ATK A;  3GCB A;  3PBH A;  3KWB X;  2BDL A;  4X6H A;  1KXR A;  1NPZ A;  2B1M A;  1O0E A;  3V6C A;  1QXP A;  4P6G A;  1CSB B;  1U9X A;  1BQI A;  3E9S A;  3H89 A;  1K3B B;  2P0R A;  2R9C A;  2XU3 A;  1POP A;  4CDF B;  2DOS A;  1CQD A;  2FT2 A;  4I05 A;  2XU4 A;  5F02 A;  1MHW A;  4FK5 A;  3IUT A;  2VHS A;  3MHS A;  4RNA A;  1CTE A;  2DC6 A;  3K9M A;  2GFO A;  2AYO A;  1U9Q X;  2PNS A;  4IUM A;  4QRX A;  3PSE A;  2PRE A;  4YV8 A;  2BDZ A;  2BTW B;  4MSX A;  2FRA A;  2XU5 A;  1AU0 A;  2R9F A;  2BTW A;  3BPF A;  1VSN A;  2NQG A;  1TLO A;  4XUI A;  1DEU A;  1NQC A;  5A24 A;  1PCI A;  5EGW A;  5PAD A;  1TU6 A;  3OVX A;  2AVW A;  3M99 A;  2R9N A;  3MHH A;  1QOL A;  3KWZ A;  3C0R A;  3I06 A;  3H8C A;  1STF E;  1YZB A;  4W4U A;  2HHN A;  4K7C A;  2J7Q A;  1PAD A;  3H6S A;  3MP2 A;  4DMX A;  4QRG A;  4M0W A;  4WA6 A;  3KFQ A;  2PBH A;  5CHT A;  1NB3 A;  3WXG A;  3V6E A;  2DZZ A;  4HXD B;  3TRK A;  1MS6 A;  1BY8 A;  1BP4 A;  3ZNH A;  5JH3 A;  1YK8 A;  3DF0 A;  1JQP A;  2IPP B;  2WBF X;  3HHA A;  3D6S A;  2GHU A;  1AU2 A;  4N8W A;  1ME3 A;  3BY4 A;  1S4V A;  1KHQ A;  4MZO A;  1PPO A;  2R6N A;  2NQD B;  3IEJ A;  4RKX A;  5CHV A;  2AGA A;  2DJF B;  3P5X A;  4PT5 A;  3I3T A;  2DC9 A;  3IV2 A;  4G54 A;  2Y5B A;  3U8E A;  3N3G A;  2AUX A;  2H7J A;  1PPD A;  3W31 A;  3MJ5 A;  5JA7 A;  1UKF A;  1SNK A;  4D8E A;  4OEM A;  3HD3 A;  3KSE A;  4ZUX U;  4REZ A;  5EZQ A;  2HWK A;  3W30 A;  4CZW A;  1GCB A;  9PAP A;  5E6J A;  1YVB A;  4BPV A;  4CDE B;  1CVZ A;  2F1G A;  5JZE A;  4YYV A;  1PIP A;  3QT4 A;  1BGO A;  4QH6 A;  5K16 A;  1YAL A;  4BOQ A;  3BC3 A;  4XZX A;  4BS6 A;  1F29 A;  2CB5 A;  4OVZ A;  1THE A;  1GMY A;  1KFX L;  3PRM A;  2JQF R;  2G8J A;  3F5V A;  2DCC A;  1AU3 A;  1EWM A;  1XKG A;  3BPM A;  2DCA A;  2JTC A;  4AXL A;  2ARY A;  4P6E A;  3CBK A;  3S3Q A;  3IMA A;  1AYV A;  4PI3 A;  1PXV A;  2OZ2 A;  4D8B A;  1YT7 A;  3OIS A;  5FPW A;  2DC8 A;  2YJC A;  2DC7 A;  1MIR A;  3RVX A;  1X9Y A;  2G8E A;  2HD5 A;  4Q8G A;  4BOZ A;  1PPP A;  4D8I A;  1DKI A;  1ITO A;  4WUR A;  3PRP A;  3OF9 A;  3N4C A;  3BOW A;  1AYW A;  1Y08 A;  3AI8 A;  4X6J A;  2NQI A;  1VJV A;  2R9O A;  1F2B A;  1NLJ A;  3ERV A;  3BBA A;  3USV A;  2FYE A;  4YYW A;  1CB5 A;  3P5V A;  3MTV A;  2O6X A;  1KFU L;  2IBI A;  2OP3 A;  3CBJ A;  4PP1 A;  3S3R A;  1GLO A;  2DJG B;  1Y4H A;  3KW9 A;  5EZS A;  2HXZ A;  3H8B A;  1F2C A;  1AEC A;  2UZJ A;  2G7Y A;  2FQ9 A;  4X6I A;  4OW0 A;  4BOS A;  3TNX A;  1EWP A;  4BQV A;  4YVA A;  2AIM A;  4YYQ A;  3C9E A;  4GUA A;  2R9M A;  3BWK A;  2B1N A;  3TMP A;  4RF0 A;  1PE6 A;  5KO3 A;  3H7D A;  3B21 A;  4I07 A;  4W5C A;  4Q8H A;  3MOR A;  2FUD A;  3LXS A;  1CPJ A;  1EWL A;  2AUZ A;  2DCB A;  1ME4 A;  2FO5 A;  3IOQ A;  3KKU A;  4W5B A;  2OUL A;  1EWO A;  2ATO A;  2AU1 A;  4YYR A;  4MZS A;  4A5U A;  1EF7 A;  4XR7 A;  3PHX A;  5CVO B;  3O0U A;  7PCK A;  2AYN A;  3MTN A;  1U5I A;  3F75 A;  3PW3 A;  2E02 A;  1QDQ A;  3OVZ A;  3WXE A;  2AS8 A; 
#chains in the Genus database with same CATH homology
 4ZTB A;  3PRM A;  4RKX A;  3PHW A;  5EZQ A;  2AGA A;  4GUA A;  2HWK A;  3O65 A;  2BU3 A;  4PT5 A;  4MI7 A;  3W30 A;  3MTV A;  3RNV A;  4REZ A;  5E6J A;  3TMP A;  4RF0 A;  5KO3 A;  4RNA A;  4R3D A;  3ZNH A;  4BOP A;  3PHU A;  2JRI A;  3B21 A;  3C0R A;  4BOZ A;  2JTC A;  4MM3 B;  4D8I A;  3E9S A;  1DKI A;  4A5U A;  1YZB A;  4WUR A;  3PRP A;  4IP3 A;  4P16 A;  4RF1 A;  3PHX A;  2J7Q C;  4IUM A;  5EZS A;  2J7Q A;  3PSE A;  5JZE A;  3BB7 A;  2FE8 A;  3MP2 A;  3TRK A;  3W31 A;  3MJ5 A;  4BOU A;  4M0W A;  1UKF A;  2UZJ A;  2DOS A;  4D8E A;  4OW0 A;  2BTW B;  1PVJ A;  3BY4 A;  4OVZ B;  4BOS A;  4BOQ A;  3OQC A;  4XZX A;  3IFU A;  4OVZ A;  4D8B A;  2BTW A;  3PT2 A;  4HXD B;  3BBA A;  2Z84 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...