4I05A

Structure of intermediate processing form of cathepsin b1 from schistosoma mansoni
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
277
structure length
276
Chain Sequence
GARREEPDLRRTRRPTVDHNDWNVEIPSSFDSRKKWPRCKSIATIRDQSRCGSWAFGAVEAMSDRSCIQSGGKQNVELSAVDLLSCCESCGLGCEGGILGPAWDYWVKEGIVTGSSKENHAGCEPYPFPKCEHHTKGKYPPCGSKIYKTPRCKQTCQKKYKTPYTQDKHRGKSSYNVKNDEKAIQKEIMKYGPVEAGFTVYEDFLNYKSGIYKHITGETLGGHAIRIIGWGVENKAPYWLIANSWNEDWGENGYFRIVRGRDECSIESEVTAGRIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cathepsin B-like peptidase (C01 family)
publication title Activation route of the Schistosoma mansoni cathepsin B1 drug target: structural map with a glycosaminoglycan switch
pubmed doi rcsb
source organism Schistosoma mansoni
molecule tags Hydrolase
total genus 95
structure length 276
sequence length 277
ec nomenclature ec 3.4.22.1: Cathepsin B.
pdb deposition date 2012-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 4i05A00
1AIMA 1F2AA 3KWZA 2WBFX 2DZZA 2IBIA 1THEA 4PP1A 1KFUL 1U9QX 1U5IA 1VSNA 3ZUAA 4YYUA 3K9MA 3D6SA 4RY2A 2C0YA 3CH2X 4OELA 1YK8A 1ICFA 2F1GA 2ATOA 2YJ9A 4KLBA 4YVAA 2R9OA 3MORA 4X6HA 2FRAA 2P86A 3IUTA 3H8CA 1IWDA 3U8EA 1XKGA 1GCBA 2YJ2A 4CDCB 4MSXA 2XU5A 1CQDA 1GLOA 2P7UA 3AI8A 4BPVA 1GMYA 2DC9A 3ERVA 1MS6A 1JQPA 1PBHA 1PCIA 2R6NA 1Q6KA 1NB5A 2E02A 4QRXA 4DMXA 5JA7A 3MHSA 1PPOA 3OISA 4P6GA 5EGWA 3HWNA 4Q8GA 3RVVA 4BS5A 2DC8A 4FJCA 3IV2A 1U9XA 1MEGA 1GECE 2DCAA 2DJFB 4N4ZA 4WA6A 1CPJA 1QDQA 2B1NA 1AECA 1AU0A 3OVZA 1F2CA 3E1ZB 5JH3A 3V6EA 4I05A 1YVBA 1F2BA 1EWPA 1Y4HA 2G8JA 1EWMA 3BWKA 2PNSA 2YJBA 3PNRA 2E00A 3H7DA 3H8BA 2VHFA 3V6CA 1STFE 1ZIVA 2R9NA 2GHUA 3KFQA 5CVMA 1MHWA 1NLJA 4AXMA 2HXZA 3LXSA 2HD5A 3BOWA 2FUDA 1TL9A 1CJLA 3IOQA 2Y5BA 4MZSA 2NQGA 4XUIA 1X9YA 2AIMA 3OF8A 2FYEA 4AXLA 3HHIA 2R9CA 3I06A 1PIPA 3QJ3A 2DZYA 1MIRA 3IHPA 2DC6A 4W5BA 1PPDA 1AU3A 1KXRA 1A6RA 4CDEB 1KHQA 8PCHA 2PADA 2PBHA 3TNXA 6PADA 1K3BB 3PBHA 3P5VA 1ATKA 1QXPA 1U9VA 3LFYA 3K8UA 3N4CA 2B1MA 3C9EA 1HUCB 2AU1A 1TLOA 1FH0A 3IEJA 3H89A 2YJ8A 1CB5A 1O0EA 2AS8A 4CZWA 5J94A 3BPFA 5CHVA 4QH6A 1NL6A 4YYWA 2OP3A 4FK5A 2HHNA 2NQAA 4N79A 9PAPA 3S3RA 5PADA 3N3KA 1BGOA 3DF0A 4K7CA 2DJGB 4ZUXU 2G8EA 3CBJA 2FO5A 2XU3A 2AUXA 4N8WA 4Q8HA 1ZCMA 4BQVA 1VJVA 1YALA 1NPZA 5CVNB 2G7YA 3QT4A 1DEUA 2AUZA 3O0UA 3BCNA 4W5CA 3PW3A 1PXVA 1PADA 4MZOA 1KFXL 5F02A 2ACTA 1AYUA 2NQDB 5EF4A 1Y08A 3BPMA 2CB5A 1ME4A 1S4VA 1BY8A 4YYVA 1YK7A 2FQ9A 3WXFA 2AVWA 3WXEA 3H6SA 1PPNA 4DMYA 3PDFA 1MEMA 2DC7A 2FTDA 1EWOA 4P6EA 2AYNA 4HWYA 3NHEA 3RVXA 1SP4B 2DCBA 4W4UA 4BS6A 3KW9A 1F29A 7PCKA 2FT2A 2JQFR 2JQGR 3P5UA 1BQIA 1EWLA 5FPWA 1CTEA 1NQCA 3WXGA 4QRGA 2XU1A 4CDFB 1QOLA 2OULA 1CVZA 2CIOA 3OF9A 2OZ2A 1QMYA 3I3TA 3MTNA 2O6XA 4BSQA 1ITOA 3P5WA 2R9MA 1CSBB 2IPPB 2VHSA 3M99A 2BDZA 4X6JA 5CHTA 2Y6EA 1CS8A 3HD3A 4PI3A 1M6DA 4QRVA 3CH3X 4XR7A 4FIPA 1EF7A 1DF0A 3P5XA 4YYRA 4QBBA 3CBKA 1ME3A 2R9FA 3BC3A 3OVXA 4X6IA 4YYQA 4G54A 3KWBX 1AU4A 3F5VA 3HHAA 4YYSA 4I07A 1AYVA 1PPPA 2XU4A 3B79A 3KKUA 5K16A 4PADA 2E03A 3MHHA 4I04A 2F7DA 2GFOA 5A24A 1AYWA 3QSDA 3KX1A 2PREA 2ARYA 3USVA 1CV8A 1BP4A 2DCDA 3GCBA 2DCCA 1NB3A 2P0RA 1U9WA 3F75A 1SNKA 4OEMA 2FRQA 2HH5A 2G6DA 2YJCA 2BDLA 2H7JA 3N3GA 3O1GA 3K24A 3S3QA 2E01A 4PP2E 5CVOB 1YT7A 4CDDB 3RVWA 1PE6A 1KHPA 1TU6A 2AYOA 3KSEA 1AU2A 1MDWA 3IMAA 4YV8A 1POPA 2NQIA
chains in the Genus database with same CATH superfamily
1AIMA 1F2AA 3KWZA 2FE8A 2WBFX 2DZZA 2IBIA 1THEA 4PP1A 1KFUL 1U9QX 3OQCA 1PVJA 1U5IA 1VSNA 3ZUAA 4YYUA 3K9MA 3D6SA 4RY2A 4BOZA 3O65A 2C0YA 3CH2X 4OELA 1YK8A 1ICFA 2F1GA 2ATOA 5JZEA 2YJ9A 4KLBA 4YVAA 2R9OA 2AGAA 3MORA 4X6HA 2FRAA 2P86A 3IUTA 3H8CA 1IWDA 4IUMA 3U8EA 1XKGA 1GCBA 2UZJA 2YJ2A 4CDCB 4MSXA 2XU5A 1CQDA 1GLOA 2P7UA 3AI8A 4BPVA 1GMYA 2DC9A 3ERVA 1MS6A 4GUAA 1JQPA 3BBAA 1PBHA 1PCIA 2R6NA 1Q6KA 1NB5A 4D8BA 2E02A 4QRXA 4DMXA 4D8IA 5JA7A 3MHSA 1PPOA 3OISA 3TMPA 4P6GA 5EGWA 3HWNA 4RKXA 4Q8GA 3RVVA 4BS5A 2DC8A 4FJCA 3IV2A 1U9XA 1MEGA 1GECE 4WURA 2DCAA 2DJFB 4N4ZA 4WA6A 1CPJA 4A5UA 1QDQA 2B1NA 1AECA 1AU0A 3OVZA 1F2CA 3E1ZB 5JH3A 3V6EA 3W30A 4I05A 3B21A 1YVBA 1F2BA 1EWPA 1Y4HA 2G8JA 1EWMA 3BWKA 2PNSA 4MM3B 2YJBA 3PNRA 5EZSA 2E00A 3H7DA 3H8BA 2VHFA 3V6CA 4M0WA 1STFE 1ZIVA 2R9NA 2HWKA 2GHUA 3KFQA 1YZBA 5CVMA 1MHWA 1NLJA 4AXMA 3BB7A 2HXZA 3LXSA 2HD5A 3BOWA 3RNVA 2FUDA 1TL9A 1CJLA 3IOQA 2Y5BA 4MZSA 2NQGA 4XUIA 4D8EA 1X9YA 2AIMA 3OF8A 2FYEA 4AXLA 3HHIA 2R9CA 3I06A 1PIPA 3QJ3A 3PRPA 2DZYA 1MIRA 3IHPA 2DC6A 4R3DA 1PPDA 4W5BA 1AU3A 1KXRA 1A6RA 4CDEB 1KHQA 8PCHA 2PADA 2PBHA 3TNXA 6PADA 1K3BB 3PBHA 3P5VA 1ATKA 1QXPA 1U9VA 3LFYA 3PHXA 3K8UA 3N4CA 2B1MA 3C9EA 1HUCB 3BY4A 5EZQA 2AU1A 3E9SA 1TLOA 1FH0A 3IEJA 3H89A 2YJ8A 1CB5A 1O0EA 4PT5A 2AS8A 4CZWA 4BOSA 5J94A 3BPFA 5CHVA 4QH6A 1NL6A 4YYWA 2OP3A 4FK5A 2JRIA 2HHNA 2NQAA 4N79A 9PAPA 3S3RA 5PADA 3N3KA 1BGOA 3DF0A 4K7CA 2DJGB 3PRMA 4ZUXU 4BOQA 2G8EA 3CBJA 2FO5A 4IP3A 2XU3A 2AUXA 2DOSA 4N8WA 4Q8HA 4OVZB 1ZCMA 4BQVA 1VJVA 1YALA 1NPZA 5CVNB 2G7YA 3QT4A 1DEUA 2AUZA 3O0UA 3BCNA 4W5CA 3PW3A 1PXVA 3IFUA 1PADA 4MZOA 1KFXL 5F02A 2ACTA 1AYUA 2NQDB 5EF4A 1Y08A 3BPMA 2CB5A 1ME4A 3MP2A 1S4VA 1BY8A 4YYVA 1YK7A 2FQ9A 3WXFA 2AVWA 3WXEA 4HXDB 3H6SA 1PPNA 3MTVA 2BTWB 4DMYA 3PDFA 1MEMA 2DC7A 2FTDA 1EWOA 4P6EA 3TRKA 2AYNA 4HWYA 3NHEA 2J7QA 4REZA 3RVXA 1UKFA 1SP4B 2DCBA 4W4UA 4BS6A 3KW9A 4MI7A 1F29A 4OVZA 7PCKA 2FT2A 2JQFR 2JQGR 4RF0A 3P5UA 1BQIA 1EWLA 5FPWA 1CTEA 1NQCA 3WXGA 4QRGA 3PHUA 2XU1A 4CDFB 1QOLA 2OULA 1CVZA 2CIOA 3OF9A 2OZ2A 1QMYA 3I3TA 3MTNA 2O6XA 4BSQA 1ITOA 3P5WA 2R9MA 1CSBB 2IPPB 2VHSA 3M99A 2BDZA 4X6JA 5CHTA 2Y6EA 1CS8A 3HD3A 4PI3A 1M6DA 4QRVA 2BTWA 3CH3X 4XR7A 2J7QC 4FIPA 1EF7A 1DF0A 2Z84A 3PHWA 3P5XA 4XZXA 2BU3A 4YYRA 4QBBA 3CBKA 1ME3A 4OW0A 2R9FA 3BC3A 3OVXA 4X6IA 4YYQA 4G54A 3KWBX 1AU4A 4P16A 3F5VA 3HHAA 3PT2A 4YYSA 4I07A 1AYVA 1DKIA 1PPPA 2XU4A 3B79A 4ZTBA 3MJ5A 3KKUA 5K16A 4PADA 2E03A 3MHHA 4I04A 2F7DA 2GFOA 5A24A 1AYWA 3QSDA 5KO3A 5E6JA 3KX1A 4RNAA 2PREA 2ARYA 3USVA 1CV8A 1BP4A 2DCDA 3GCBA 2DCCA 2JTCA 4RF1A 1NB3A 2P0RA 1U9WA 3F75A 1SNKA 4OEMA 2FRQA 3W31A 2HH5A 2G6DA 4BOUA 2YJCA 2BDLA 2H7JA 3N3GA 3O1GA 3C0RA 3K24A 3S3QA 2E01A 4PP2E 3ZNHA 5CVOB 1YT7A 3PSEA 4BOPA 4CDDB 3RVWA 1PE6A 1KHPA 1TU6A 2AYOA 3KSEA 1AU2A 1MDWA 3IMAA 4YV8A 1POPA 2NQIA
chains in the Genus database with same CATH topology
1AIMA 1F2AA 3KWZA 2WBFX 2DZZA 2IBIA 1THEA 4PP1A 1KFUL 1U9QX 1U5IA 1VSNA 3ZUAA 4YYUA 3K9MA 3D6SA 4RY2A 2C0YA 3CH2X 4OELA 1YK8A 1ICFA 2F1GA 2ATOA 2YJ9A 4KLBA 4YVAA 2R9OA 3MORA 4X6HA 2FRAA 2P86A 3IUTA 3H8CA 1IWDA 3U8EA 1XKGA 1GCBA 2YJ2A 4CDCB 4MSXA 2XU5A 1CQDA 1GLOA 2P7UA 3AI8A 4BPVA 1GMYA 2DC9A 3ERVA 1MS6A 1JQPA 1PBHA 1PCIA 2R6NA 1Q6KA 1NB5A 2E02A 4QRXA 4DMXA 5JA7A 3MHSA 1PPOA 3OISA 4P6GA 5EGWA 3HWNA 4Q8GA 3RVVA 4BS5A 2DC8A 4FJCA 3IV2A 1U9XA 1MEGA 1GECE 2DCAA 2DJFB 4N4ZA 4WA6A 1W6FA 1CPJA 1QDQA 2B1NA 1AECA 1AU0A 3OVZA 1F2CA 3E1ZB 5JH3A 3V6EA 4I05A 1E2TA 1YVBA 1F2BA 1EWPA 1Y4HA 2G8JA 1EWMA 3BWKA 2PNSA 2YJBA 3PNRA 2E00A 3H7DA 3H8BA 2VHFA 3V6CA 1STFE 1ZIVA 2R9NA 2GHUA 3KFQA 5CVMA 1MHWA 1NLJA 4AXMA 2HXZA 3LXSA 2HD5A 3BOWA 2FUDA 1TL9A 1CJLA 3IOQA 2Y5BA 4MZSA 2NQGA 4XUIA 1W4TA 1X9YA 2AIMA 3OF8A 2FYEA 4AXLA 3HHIA 2R9CA 3I06A 1PIPA 3QJ3A 2DZYA 1W5RA 1MIRA 3IHPA 2DC6A 4W5BA 1PPDA 1AU3A 1KXRA 1A6RA 4CDEB 1KHQA 8PCHA 2PADA 2PBHA 3TNXA 6PADA 1K3BB 3PBHA 3P5VA 1ATKA 1QXPA 1U9VA 3LFYA 3K8UA 3N4CA 2B1MA 3C9EA 1HUCB 2AU1A 1TLOA 1FH0A 3IEJA 3H89A 2YJ8A 1CB5A 1O0EA 2AS8A 4CZWA 5J94A 3BPFA 5CHVA 4QH6A 1NL6A 4YYWA 2OP3A 4GUZA 1GX3A 4FK5A 2HHNA 2NQAA 4NV7A 4N79A 9PAPA 4BGFA 3S3RA 5PADA 3N3KA 1BGOA 3DF0A 4K7CA 2DJGB 4ZUXU 2G8EA 3CBJA 2FO5A 2XU3A 2AUXA 4N8WA 4Q8HA 1ZCMA 4BQVA 1VJVA 1YALA 1NPZA 5CVNB 2G7YA 3QT4A 1DEUA 2AUZA 3O0UA 3BCNA 4W5CA 3PW3A 1PXVA 1PADA 4MZOA 1KFXL 5F02A 2ACTA 4B55A 1AYUA 2NQDB 5EF4A 3D9WA 1Y08A 3BPMA 2CB5A 1ME4A 1S4VA 1BY8A 4YYVA 1YK7A 2FQ9A 3WXFA 2AVWA 3WXEA 3H6SA 1PPNA 4DMYA 3PDFA 1MEMA 2VFBA 2DC7A 2FTDA 1EWOA 4P6EA 2AYNA 4HWYA 3NHEA 3RVXA 1SP4B 2DCBA 4W4UA 4BS6A 3KW9A 1F29A 7PCKA 2FT2A 2JQFR 2JQGR 3P5UA 1BQIA 1EWLA 5FPWA 1CTEA 1NQCA 3WXGA 4QRGA 2XU1A 4CDFB 1QOLA 2OULA 1CVZA 2CIOA 3OF9A 2OZ2A 1QMYA 3I3TA 3MTNA 2O6XA 4BSQA 1ITOA 3P5WA 2R9MA 1CSBB 2IPPB 2VHSA 3M99A 2BDZA 4X6JA 5CHTA 2Y6EA 1CS8A 3HD3A 4PI3A 1M6DA 4QRVA 3CH3X 4XR7A 4FIPA 1EF7A 1DF0A 3P5XA 4YYRA 4QBBA 3CBKA 1ME3A 2R9FA 3BC3A 3OVXA 4X6IA 4YYQA 4G54A 3KWBX 1AU4A 3F5VA 3HHAA 4YYSA 4I07A 1AYVA 1PPPA 2XU4A 3B79A 3KKUA 5K16A 4PADA 2E03A 3MHHA 4C5PA 4I04A 2F7DA 2GFOA 5A24A 1AYWA 3QSDA 3LTWA 3KX1A 2PREA 2ARYA 2VFCA 3USVA 1CV8A 1BP4A 2DCDA 3GCBA 2DCCA 1NB3A 2BSZA 1U9WA 2P0RA 3F75A 1SNKA 4OEMA 4NV8A 2FRQA 2HH5A 2G6DA 2YJCA 2BDLA 2H7JA 3N3GA 3O1GA 3K24A 3S3QA 2E01A 4PP2E 5CVOB 1YT7A 4CDDB 3RVWA 1PE6A 1KHPA 1TU6A 2AYOA 3KSEA 1AU2A 1MDWA 3IMAA 4YV8A 1POPA 2NQIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AIM A;  1F2A A;  3KWZ A;  2WBF X;  2DZZ A;  2IBI A;  1THE A;  4PP1 A;  1KFU L;  1U9Q X;  1U5I A;  1VSN A;  3ZUA A;  4YYU A;  3K9M A;  3D6S A;  4RY2 A;  2C0Y A;  3CH2 X;  4OEL A;  1YK8 A;  1ICF A;  2F1G A;  2ATO A;  2YJ9 A;  4KLB A;  4YVA A;  2R9O A;  3MOR A;  4X6H A;  2FRA A;  2P86 A;  3IUT A;  3H8C A;  1IWD A;  3U8E A;  1XKG A;  1GCB A;  2YJ2 A;  4CDC B;  4MSX A;  2XU5 A;  1CQD A;  1GLO A;  2P7U A;  3AI8 A;  4BPV A;  1GMY A;  2DC9 A;  3ERV A;  1MS6 A;  1JQP A;  1PBH A;  1PCI A;  2R6N A;  1Q6K A;  1NB5 A;  2E02 A;  4QRX A;  4DMX A;  5JA7 A;  3MHS A;  1PPO A;  3OIS A;  4P6G A;  5EGW A;  3HWN A;  4Q8G A;  3RVV A;  4BS5 A;  2DC8 A;  4FJC A;  3IV2 A;  1U9X A;  1MEG A;  1GEC E;  2DCA A;  2DJF B;  4N4Z A;  4WA6 A;  1CPJ A;  1QDQ A;  2B1N A;  1AEC A;  1AU0 A;  3OVZ A;  1F2C A;  3E1Z B;  5JH3 A;  3V6E A;  4I05 A;  1YVB A;  1F2B A;  1EWP A;  1Y4H A;  2G8J A;  1EWM A;  3BWK A;  2PNS A;  2YJB A;  3PNR A;  2E00 A;  3H7D A;  3H8B A;  2VHF A;  3V6C A;  1STF E;  1ZIV A;  2R9N A;  2GHU A;  3KFQ A;  5CVM A;  1MHW A;  1NLJ A;  4AXM A;  2HXZ A;  3LXS A;  2HD5 A;  3BOW A;  2FUD A;  1TL9 A;  1CJL A;  3IOQ A;  2Y5B A;  4MZS A;  2NQG A;  4XUI A;  1X9Y A;  2AIM A;  3OF8 A;  2FYE A;  4AXL A;  3HHI A;  2R9C A;  3I06 A;  1PIP A;  3QJ3 A;  2DZY A;  1MIR A;  3IHP A;  2DC6 A;  4W5B A;  1PPD A;  1AU3 A;  1KXR A;  1A6R A;  4CDE B;  1KHQ A;  8PCH A;  2PAD A;  2PBH A;  3TNX A;  6PAD A;  1K3B B;  3PBH A;  3P5V A;  1ATK A;  1QXP A;  1U9V A;  3LFY A;  3K8U A;  3N4C A;  2B1M A;  3C9E A;  1HUC B;  2AU1 A;  1TLO A;  1FH0 A;  3IEJ A;  3H89 A;  2YJ8 A;  1CB5 A;  1O0E A;  2AS8 A;  4CZW A;  5J94 A;  3BPF A;  5CHV A;  4QH6 A;  1NL6 A;  4YYW A;  2OP3 A;  4FK5 A;  2HHN A;  2NQA A;  4N79 A;  9PAP A;  3S3R A;  5PAD A;  3N3K A;  1BGO A;  3DF0 A;  4K7C A;  2DJG B;  4ZUX U;  2G8E A;  3CBJ A;  2FO5 A;  2XU3 A;  2AUX A;  4N8W A;  4Q8H A;  1ZCM A;  4BQV A;  1VJV A;  1YAL A;  1NPZ A;  5CVN B;  2G7Y A;  3QT4 A;  1DEU A;  2AUZ A;  3O0U A;  3BCN A;  4W5C A;  3PW3 A;  1PXV A;  1PAD A;  4MZO A;  1KFX L;  5F02 A;  2ACT A;  1AYU A;  2NQD B;  5EF4 A;  1Y08 A;  3BPM A;  2CB5 A;  1ME4 A;  1S4V A;  1BY8 A;  4YYV A;  1YK7 A;  2FQ9 A;  3WXF A;  2AVW A;  3WXE A;  3H6S A;  1PPN A;  4DMY A;  3PDF A;  1MEM A;  2DC7 A;  2FTD A;  1EWO A;  4P6E A;  2AYN A;  4HWY A;  3NHE A;  3RVX A;  1SP4 B;  2DCB A;  4W4U A;  4BS6 A;  3KW9 A;  1F29 A;  7PCK A;  2FT2 A;  2JQF R;  2JQG R;  3P5U A;  1BQI A;  1EWL A;  5FPW A;  1CTE A;  1NQC A;  3WXG A;  4QRG A;  2XU1 A;  4CDF B;  1QOL A;  2OUL A;  1CVZ A;  2CIO A;  3OF9 A;  2OZ2 A;  1QMY A;  3I3T A;  3MTN A;  2O6X A;  4BSQ A;  1ITO A;  3P5W A;  2R9M A;  1CSB B;  2IPP B;  2VHS A;  3M99 A;  2BDZ A;  4X6J A;  5CHT A;  2Y6E A;  1CS8 A;  3HD3 A;  4PI3 A;  1M6D A;  4QRV A;  3CH3 X;  4XR7 A;  4FIP A;  1EF7 A;  1DF0 A;  3P5X A;  4YYR A;  4QBB A;  3CBK A;  1ME3 A;  2R9F A;  3BC3 A;  3OVX A;  4X6I A;  4YYQ A;  4G54 A;  3KWB X;  1AU4 A;  3F5V A;  3HHA A;  4YYS A;  4I07 A;  1AYV A;  1PPP A;  2XU4 A;  3B79 A;  3KKU A;  5K16 A;  4PAD A;  2E03 A;  3MHH A;  4I04 A;  2F7D A;  2GFO A;  5A24 A;  1AYW A;  3QSD A;  3KX1 A;  2PRE A;  2ARY A;  3USV A;  1CV8 A;  1BP4 A;  2DCD A;  3GCB A;  2DCC A;  1NB3 A;  2P0R A;  1U9W A;  3F75 A;  1SNK A;  4OEM A;  2FRQ A;  2HH5 A;  2G6D A;  2YJC A;  2BDL A;  2H7J A;  3N3G A;  3O1G A;  3K24 A;  3S3Q A;  2E01 A;  4PP2 E;  5CVO B;  1YT7 A;  4CDD B;  3RVW A;  1PE6 A;  1KHP A;  1TU6 A;  2AYO A;  3KSE A;  1AU2 A;  1MDW A;  3IMA A;  4YV8 A;  1POP A;  2NQI A; 
#chains in the Genus database with same CATH topology
 1AIM A;  1F2A A;  3KWZ A;  2FE8 A;  2WBF X;  2DZZ A;  2IBI A;  1THE A;  4PP1 A;  1KFU L;  1U9Q X;  3OQC A;  1PVJ A;  1U5I A;  1VSN A;  3ZUA A;  4YYU A;  3K9M A;  3D6S A;  4RY2 A;  4BOZ A;  3O65 A;  2C0Y A;  3CH2 X;  4OEL A;  1YK8 A;  1ICF A;  2F1G A;  2ATO A;  5JZE A;  2YJ9 A;  4KLB A;  4YVA A;  2R9O A;  2AGA A;  3MOR A;  4X6H A;  2FRA A;  2P86 A;  3IUT A;  3H8C A;  1IWD A;  4IUM A;  3U8E A;  1XKG A;  1GCB A;  2UZJ A;  2YJ2 A;  4CDC B;  4MSX A;  2XU5 A;  1CQD A;  1GLO A;  2P7U A;  3AI8 A;  4BPV A;  1GMY A;  2DC9 A;  3ERV A;  1MS6 A;  4GUA A;  1JQP A;  3BBA A;  1PBH A;  1PCI A;  2R6N A;  1Q6K A;  1NB5 A;  4D8B A;  2E02 A;  4QRX A;  4DMX A;  4D8I A;  5JA7 A;  3MHS A;  1PPO A;  3OIS A;  3TMP A;  4P6G A;  5EGW A;  3HWN A;  4RKX A;  4Q8G A;  3RVV A;  4BS5 A;  2DC8 A;  4FJC A;  3IV2 A;  1U9X A;  1MEG A;  1GEC E;  4WUR A;  2DCA A;  2DJF B;  4N4Z A;  4WA6 A;  1CPJ A;  4A5U A;  1QDQ A;  2B1N A;  1AEC A;  1AU0 A;  3OVZ A;  1F2C A;  3E1Z B;  5JH3 A;  3V6E A;  3W30 A;  4I05 A;  3B21 A;  1YVB A;  1F2B A;  1EWP A;  1Y4H A;  2G8J A;  1EWM A;  3BWK A;  2PNS A;  4MM3 B;  2YJB A;  3PNR A;  5EZS A;  2E00 A;  3H7D A;  3H8B A;  2VHF A;  3V6C A;  4M0W A;  1STF E;  1ZIV A;  2R9N A;  2HWK A;  2GHU A;  3KFQ A;  1YZB A;  5CVM A;  1MHW A;  1NLJ A;  4AXM A;  3BB7 A;  2HXZ A;  3LXS A;  2HD5 A;  3BOW A;  3RNV A;  2FUD A;  1TL9 A;  1CJL A;  3IOQ A;  2Y5B A;  4MZS A;  2NQG A;  4XUI A;  4D8E A;  1X9Y A;  2AIM A;  3OF8 A;  2FYE A;  4AXL A;  3HHI A;  2R9C A;  3I06 A;  1PIP A;  3QJ3 A;  3PRP A;  2DZY A;  1MIR A;  3IHP A;  2DC6 A;  4R3D A;  1PPD A;  4W5B A;  1AU3 A;  1KXR A;  1A6R A;  4CDE B;  1KHQ A;  8PCH A;  2PAD A;  2PBH A;  3TNX A;  6PAD A;  1K3B B;  3PBH A;  3P5V A;  1ATK A;  1QXP A;  1U9V A;  3LFY A;  3PHX A;  3K8U A;  3N4C A;  2B1M A;  3C9E A;  1HUC B;  3BY4 A;  5EZQ A;  2AU1 A;  3E9S A;  1TLO A;  1FH0 A;  3IEJ A;  3H89 A;  2YJ8 A;  1CB5 A;  1O0E A;  4PT5 A;  2AS8 A;  4CZW A;  4BOS A;  5J94 A;  3BPF A;  5CHV A;  4QH6 A;  1NL6 A;  4YYW A;  2OP3 A;  4FK5 A;  2JRI A;  2HHN A;  2NQA A;  4N79 A;  9PAP A;  3S3R A;  5PAD A;  3N3K A;  1BGO A;  3DF0 A;  4K7C A;  2DJG B;  3PRM A;  4ZUX U;  4BOQ A;  2G8E A;  3CBJ A;  2FO5 A;  4IP3 A;  2XU3 A;  2AUX A;  2DOS A;  4N8W A;  4Q8H A;  4OVZ B;  1ZCM A;  4BQV A;  1VJV A;  1YAL A;  1NPZ A;  5CVN B;  2G7Y A;  3QT4 A;  1DEU A;  2AUZ A;  3O0U A;  3BCN A;  4W5C A;  3PW3 A;  1PXV A;  3IFU A;  1PAD A;  4MZO A;  1KFX L;  5F02 A;  2ACT A;  1AYU A;  2NQD B;  5EF4 A;  1Y08 A;  3BPM A;  2CB5 A;  1ME4 A;  3MP2 A;  1S4V A;  1BY8 A;  4YYV A;  1YK7 A;  2FQ9 A;  3WXF A;  2AVW A;  3WXE A;  4HXD B;  3H6S A;  1PPN A;  3MTV A;  2BTW B;  4DMY A;  3PDF A;  1MEM A;  2DC7 A;  2FTD A;  1EWO A;  4P6E A;  3TRK A;  2AYN A;  4HWY A;  3NHE A;  2J7Q A;  4REZ A;  3RVX A;  1UKF A;  1SP4 B;  2DCB A;  4W4U A;  4BS6 A;  3KW9 A;  4MI7 A;  1F29 A;  4OVZ A;  7PCK A;  2FT2 A;  2JQF R;  2JQG R;  4RF0 A;  3P5U A;  1BQI A;  1EWL A;  5FPW A;  1CTE A;  1NQC A;  3WXG A;  4QRG A;  3PHU A;  2XU1 A;  4CDF B;  1QOL A;  2OUL A;  1CVZ A;  2CIO A;  3OF9 A;  2OZ2 A;  1QMY A;  3I3T A;  3MTN A;  2O6X A;  4BSQ A;  1ITO A;  3P5W A;  2R9M A;  1CSB B;  2IPP B;  2VHS A;  3M99 A;  2BDZ A;  4X6J A;  5CHT A;  2Y6E A;  1CS8 A;  3HD3 A;  4PI3 A;  1M6D A;  4QRV A;  2BTW A;  3CH3 X;  4XR7 A;  2J7Q C;  4FIP A;  1EF7 A;  1DF0 A;  2Z84 A;  3PHW A;  3P5X A;  4XZX A;  2BU3 A;  4YYR A;  4QBB A;  3CBK A;  1ME3 A;  4OW0 A;  2R9F A;  3BC3 A;  3OVX A;  4X6I A;  4YYQ A;  4G54 A;  3KWB X;  1AU4 A;  4P16 A;  3F5V A;  3HHA A;  3PT2 A;  4YYS A;  4I07 A;  1AYV A;  1DKI A;  1PPP A;  2XU4 A;  3B79 A;  4ZTB A;  3MJ5 A;  3KKU A;  5K16 A;  4PAD A;  2E03 A;  3MHH A;  4I04 A;  2F7D A;  2GFO A;  5A24 A;  1AYW A;  3QSD A;  5KO3 A;  5E6J A;  3KX1 A;  4RNA A;  2PRE A;  2ARY A;  3USV A;  1CV8 A;  1BP4 A;  2DCD A;  3GCB A;  2DCC A;  2JTC A;  4RF1 A;  1NB3 A;  2P0R A;  1U9W A;  3F75 A;  1SNK A;  4OEM A;  2FRQ A;  3W31 A;  2HH5 A;  2G6D A;  4BOU A;  2YJC A;  2BDL A;  2H7J A;  3N3G A;  3O1G A;  3C0R A;  3K24 A;  3S3Q A;  2E01 A;  4PP2 E;  3ZNH A;  5CVO B;  1YT7 A;  3PSE A;  4BOP A;  4CDD B;  3RVW A;  1PE6 A;  1KHP A;  1TU6 A;  2AYO A;  3KSE A;  1AU2 A;  1MDW A;  3IMA A;  4YV8 A;  1POP A;  2NQI A; 
#chains in the Genus database with same CATH homology
 1AIM A;  1F2A A;  3KWZ A;  2WBF X;  2DZZ A;  2IBI A;  1THE A;  4PP1 A;  1KFU L;  1U9Q X;  1U5I A;  1VSN A;  3ZUA A;  4YYU A;  3K9M A;  3D6S A;  4RY2 A;  2C0Y A;  3CH2 X;  4OEL A;  1YK8 A;  1ICF A;  2F1G A;  2ATO A;  2YJ9 A;  4KLB A;  4YVA A;  2R9O A;  3MOR A;  4X6H A;  2FRA A;  2P86 A;  3IUT A;  3H8C A;  1IWD A;  3U8E A;  1XKG A;  1GCB A;  2YJ2 A;  4CDC B;  4MSX A;  2XU5 A;  1CQD A;  1GLO A;  2P7U A;  3AI8 A;  4BPV A;  1GMY A;  2DC9 A;  3ERV A;  1MS6 A;  1JQP A;  1PBH A;  1PCI A;  2R6N A;  1Q6K A;  1NB5 A;  2E02 A;  4QRX A;  4DMX A;  5JA7 A;  3MHS A;  1PPO A;  3OIS A;  4P6G A;  5EGW A;  3HWN A;  4Q8G A;  3RVV A;  4BS5 A;  2DC8 A;  4FJC A;  3IV2 A;  1U9X A;  1MEG A;  1GEC E;  2DCA A;  2DJF B;  4N4Z A;  4WA6 A;  1W6F A;  1CPJ A;  1QDQ A;  2B1N A;  1AEC A;  1AU0 A;  3OVZ A;  1F2C A;  3E1Z B;  5JH3 A;  3V6E A;  4I05 A;  1E2T A;  1YVB A;  1F2B A;  1EWP A;  1Y4H A;  2G8J A;  1EWM A;  3BWK A;  2PNS A;  2YJB A;  3PNR A;  2E00 A;  3H7D A;  3H8B A;  2VHF A;  3V6C A;  1STF E;  1ZIV A;  2R9N A;  2GHU A;  3KFQ A;  5CVM A;  1MHW A;  1NLJ A;  4AXM A;  2HXZ A;  3LXS A;  2HD5 A;  3BOW A;  2FUD A;  1TL9 A;  1CJL A;  3IOQ A;  2Y5B A;  4MZS A;  2NQG A;  4XUI A;  1W4T A;  1X9Y A;  2AIM A;  3OF8 A;  2FYE A;  4AXL A;  3HHI A;  2R9C A;  3I06 A;  1PIP A;  3QJ3 A;  2DZY A;  1W5R A;  1MIR A;  3IHP A;  2DC6 A;  4W5B A;  1PPD A;  1AU3 A;  1KXR A;  1A6R A;  4CDE B;  1KHQ A;  8PCH A;  2PAD A;  2PBH A;  3TNX A;  6PAD A;  1K3B B;  3PBH A;  3P5V A;  1ATK A;  1QXP A;  1U9V A;  3LFY A;  3K8U A;  3N4C A;  2B1M A;  3C9E A;  1HUC B;  2AU1 A;  1TLO A;  1FH0 A;  3IEJ A;  3H89 A;  2YJ8 A;  1CB5 A;  1O0E A;  2AS8 A;  4CZW A;  5J94 A;  3BPF A;  5CHV A;  4QH6 A;  1NL6 A;  4YYW A;  2OP3 A;  4GUZ A;  1GX3 A;  4FK5 A;  2HHN A;  2NQA A;  4NV7 A;  4N79 A;  9PAP A;  4BGF A;  3S3R A;  5PAD A;  3N3K A;  1BGO A;  3DF0 A;  4K7C A;  2DJG B;  4ZUX U;  2G8E A;  3CBJ A;  2FO5 A;  2XU3 A;  2AUX A;  4N8W A;  4Q8H A;  1ZCM A;  4BQV A;  1VJV A;  1YAL A;  1NPZ A;  5CVN B;  2G7Y A;  3QT4 A;  1DEU A;  2AUZ A;  3O0U A;  3BCN A;  4W5C A;  3PW3 A;  1PXV A;  1PAD A;  4MZO A;  1KFX L;  5F02 A;  2ACT A;  4B55 A;  1AYU A;  2NQD B;  5EF4 A;  3D9W A;  1Y08 A;  3BPM A;  2CB5 A;  1ME4 A;  1S4V A;  1BY8 A;  4YYV A;  1YK7 A;  2FQ9 A;  3WXF A;  2AVW A;  3WXE A;  3H6S A;  1PPN A;  4DMY A;  3PDF A;  1MEM A;  2VFB A;  2DC7 A;  2FTD A;  1EWO A;  4P6E A;  2AYN A;  4HWY A;  3NHE A;  3RVX A;  1SP4 B;  2DCB A;  4W4U A;  4BS6 A;  3KW9 A;  1F29 A;  7PCK A;  2FT2 A;  2JQF R;  2JQG R;  3P5U A;  1BQI A;  1EWL A;  5FPW A;  1CTE A;  1NQC A;  3WXG A;  4QRG A;  2XU1 A;  4CDF B;  1QOL A;  2OUL A;  1CVZ A;  2CIO A;  3OF9 A;  2OZ2 A;  1QMY A;  3I3T A;  3MTN A;  2O6X A;  4BSQ A;  1ITO A;  3P5W A;  2R9M A;  1CSB B;  2IPP B;  2VHS A;  3M99 A;  2BDZ A;  4X6J A;  5CHT A;  2Y6E A;  1CS8 A;  3HD3 A;  4PI3 A;  1M6D A;  4QRV A;  3CH3 X;  4XR7 A;  4FIP A;  1EF7 A;  1DF0 A;  3P5X A;  4YYR A;  4QBB A;  3CBK A;  1ME3 A;  2R9F A;  3BC3 A;  3OVX A;  4X6I A;  4YYQ A;  4G54 A;  3KWB X;  1AU4 A;  3F5V A;  3HHA A;  4YYS A;  4I07 A;  1AYV A;  1PPP A;  2XU4 A;  3B79 A;  3KKU A;  5K16 A;  4PAD A;  2E03 A;  3MHH A;  4C5P A;  4I04 A;  2F7D A;  2GFO A;  5A24 A;  1AYW A;  3QSD A;  3LTW A;  3KX1 A;  2PRE A;  2ARY A;  2VFC A;  3USV A;  1CV8 A;  1BP4 A;  2DCD A;  3GCB A;  2DCC A;  1NB3 A;  2BSZ A;  1U9W A;  2P0R A;  3F75 A;  1SNK A;  4OEM A;  4NV8 A;  2FRQ A;  2HH5 A;  2G6D A;  2YJC A;  2BDL A;  2H7J A;  3N3G A;  3O1G A;  3K24 A;  3S3Q A;  2E01 A;  4PP2 E;  5CVO B;  1YT7 A;  4CDD B;  3RVW A;  1PE6 A;  1KHP A;  1TU6 A;  2AYO A;  3KSE A;  1AU2 A;  1MDW A;  3IMA A;  4YV8 A;  1POP A;  2NQI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...