4I05A

Structure of intermediate processing form of cathepsin b1 from schistosoma mansoni
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
277
structure length
276
Chain Sequence
b'GARREEPDLRRTRRPTVDHNDWNVEIPSSFDSRKKWPRCKSIATIRDQSRCGSWAFGAVEAMSDRSCIQSGGKQNVELSAVDLLSCCESCGLGCEGGILGPAWDYWVKEGIVTGSSKENHAGCEPYPFPKCEHHTKGKYPPCGSKIYKTPRCKQTCQKKYKTPYTQDKHRGKSSYNVKNDEKAIQKEIMKYGPVEAGFTVYEDFLNYKSGIYKHITGETLGGHAIRIIGWGVENKAPYWLIANSWNEDWGENGYFRIVRGRDECSIESEVTAGRIN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cathepsin B-like peptidase (C01 family)
molecule tags Hydrolase
source organism Schistosoma mansoni
publication title Activation route of the Schistosoma mansoni cathepsin B1 drug target: structural map with a glycosaminoglycan switch
pubmed doi rcsb
total genus 95
structure length 276
sequence length 277
ec nomenclature ec 3.4.22.1: Cathepsin B.
pdb deposition date 2012-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 4i05A00
4W5BA 2PNSA 3HHAA 1MEGA 1AYUA 1ME3A 3LXSA 4BS6A 1TU6A 1U5IA 1CS8A 1CSBB 1XKGA 1BP4A 2HH5A 5JH3A 2DZYA 4CDCB 4I07A 2GFOA 2WBFX 5A24A 1YT7A 3AI8A 3D6SA 1BY8A 4N79A 4I05A 4QBBA 1GECE 1Y08A 4YYSA 1Q6KA 1AIMA 1K3BB 4CDDB 2R6NA 1CPJA 2BDZA 4DMYA 2R9FA 2IBIA 1IWDA 4OELA 2DC9A 3BC3A 4HWYA 3KX1A 1MHWA 2FQ9A 5PADA 4MSXA 4BS5A 3P5WA 1QOLA 3I06A 3N3GA 3KFQA 1PPNA 2DCAA 4YYWA 4YYRA 2DJFB 3WXGA 3K8UA 5CVOB 4N8WA 2XU1A 4YYUA 2FYEA 3HHIA 2DC7A 1YVBA 1GCBA 2E03A 2AYOA 3F75A 5F02A 1ZIVA 2FTDA 3OF8A 2R9OA 3HD3A 3KKUA 4PI3A 3V6EA 3IHPA 1EF7A 2AUZA 3MORA 2XU3A 3V6CA 1PCIA 1GLOA 1A6RA 1AECA 3DF0A 2G8EA 1U9WA 2P0RA 4KLBA 3F5VA 1AU2A 1BQIA 2DCCA 2AU1A 1X9YA 2E01A 4FIPA 2H7JA 5CHTA 4W5CA 3IV2A 9PAPA 2CB5A 3MHSA 1DEUA 1CTEA 3WXEA 3P5VA 4AXLA 3NHEA 3QJ3A 1CQDA 2E02A 3RVXA 1ITOA 4MZSA 4WA6A 3H7DA 1KFUL 2NQDB 2JQGR 1EWOA 4BQVA 3MTNA 3OF9A 3H6SA 2F7DA 2P86A 4AXMA 4QRGA 3OVZA 3BPMA 3QSDA 1YK7A 4CDEB 2HXZA 1GMYA 4RY2A 1JQPA 3E1ZB 2DC6A 3KWBX 1QXPA 4MZOA 3PW3A 2F1GA 1AU3A 1F29A 2NQGA 3GCBA 4FJCA 3OISA 2Y5BA 1TLOA 3CH3X 3KWZA 2ARYA 1PPOA 1MDWA 4BSQA 2B1NA 2FRQA 1SNKA 1HUCB 2XU4A 8PCHA 7PCKA 4X6HA 4W4UA 4K7CA 3USVA 1NL6A 2AVWA 4CDFB 4YV8A 1SP4B 1MEMA 3IOQA 1NB5A 1EWLA 5K16A 4YYVA 1AU4A 4X6IA 1PXVA 2ATOA 2YJCA 1QDQA 2OULA 2AYNA 1FH0A 1NB3A 1CVZA 4G54A 2YJBA 1O0EA 2IPPB 4BPVA 4YVAA 1NLJA 1DF0A 1PPDA 2VHFA 2DCBA 3N3KA 2JQFR 1PIPA 5EGWA 3BOWA 1F2BA 2PADA 3BCNA 1BGOA 3QT4A 1STFE 5FPWA 3BPFA 1F2CA 3MHHA 2DC8A 2DJGB 4DMXA 2FO5A 3CBKA 3BWKA 1VJVA 4CZWA 2AUXA 3IMAA 4PADA 2OZ2A 1CJLA 3H89A 4X6JA 4P6EA 3IEJA 1THEA 2AS8A 3PDFA 2G8JA 5J94A 1S4VA 3HWNA 2G7YA 1F2AA 2OP3A 4OEMA 2VHSA 2XU5A 2HD5A 4P6GA 1KHQA 4XUIA 4Q8GA 1Y4HA 1KFXL 4N4ZA 1ZCMA 3WXFA 2PBHA 2Y6EA 1ME4A 2NQIA 2B1MA 3B79A 1M6DA 3LFYA 3H8CA 3S3QA 2R9NA 2R9MA 1PPPA 2E00A 4ZUXU 4Q8HA 3N4CA 3KW9A 1MS6A 1EWPA 2ACTA 5CVNB 6PADA 1TL9A 2O6XA 3I3TA 1YALA 1U9QX 2FRAA 3P5UA 2YJ2A 2AIMA 3ZUAA 3O0UA 1POPA 4PP1A 2DZZA 1KXRA 4FK5A 5JA7A 3K9MA 3IUTA 2FT2A 2GHUA 2NQAA 1VSNA 1MIRA 2G6DA 2HHNA 3O1GA 4QRVA 1ATKA 2YJ9A 3RVWA 2FUDA 2DCDA 1CV8A 2P7UA 3M99A 1PBHA 1YK8A 3TNXA 3ERVA 5EF4A 2C0YA 2R9CA 3CH2X 1U9VA 3H8BA 4YYQA 1AYWA 3PBHA 4QH6A 3PNRA 1PE6A 1AU0A 2BDLA 3RVVA 4XR7A 5CVMA 1ICFA 2PREA 1AYVA 2CIOA 4QRXA 1QMYA 1NQCA 1KHPA 1U9XA 3U8EA 3K24A 3OVXA 1NPZA 1EWMA 4I04A 4PP2E 3C9EA 3CBJA 3KSEA 3S3RA 1PADA 5CHVA 1CB5A 3P5XA 2YJ8A
chains in the Genus database with same CATH superfamily
4M0WA 4W5BA 2PNSA 3HHAA 1MEGA 1AYUA 1ME3A 3LXSA 4BS6A 1TU6A 3O65A 1U5IA 5KO3A 1CS8A 1CSBB 1XKGA 1BP4A 2HH5A 3PRMA 5JH3A 2DZYA 4CDCB 4I07A 2GFOA 2WBFX 5A24A 1YT7A 3AI8A 3D6SA 1BY8A 4N79A 4D8EA 4I05A 4QBBA 2UZJA 1GECE 1Y08A 4YYSA 4OW0A 1Q6KA 1AIMA 5EZQA 3PHUA 1K3BB 4CDDB 2R6NA 4RF0A 1CPJA 2BDZA 4DMYA 2R9FA 2IBIA 1IWDA 4OELA 3W30A 2J7QA 2Z84A 2DC9A 3BC3A 4HWYA 3KX1A 1MHWA 2FQ9A 5PADA 3TRKA 4MSXA 4BS5A 3P5WA 1QOLA 3I06A 3N3GA 3KFQA 1PPNA 2DCAA 4YYWA 4YYRA 5JZEA 4A5UA 2DJFB 3WXGA 3K8UA 5CVOB 4N8WA 4IP3A 2XU1A 4YYUA 2FYEA 3HHIA 2DC7A 1YVBA 1GCBA 2E03A 2AYOA 3BBAA 3F75A 5F02A 1ZIVA 2FTDA 3OF8A 2R9OA 3BB7A 3HD3A 3KKUA 4PI3A 3V6EA 2HWKA 3IHPA 1EF7A 2AUZA 3MORA 2XU3A 3V6CA 1PCIA 4WURA 4RNAA 3MJ5A 1GLOA 1A6RA 4P16A 1AECA 4HXDB 3DF0A 2G8EA 1U9WA 2P0RA 4IUMA 4KLBA 3F5VA 1AU2A 1BQIA 3PHXA 2DCCA 4PT5A 2AU1A 3MTVA 5E6JA 1X9YA 4FIPA 2E01A 2H7JA 5CHTA 4W5CA 3IV2A 9PAPA 2JTCA 2CB5A 3MHSA 4BOPA 1DEUA 1CTEA 3WXEA 3P5VA 4AXLA 3NHEA 3QJ3A 1CQDA 2E02A 3RVXA 1ITOA 4MZSA 4WA6A 4BOSA 4D8BA 3H7DA 1KFUL 2NQDB 2JQGR 1EWOA 4BQVA 3MTNA 3OF9A 3H6SA 2F7DA 2P86A 4AXMA 4QRGA 3OVZA 3BPMA 3QSDA 1YK7A 4CDEB 2HXZA 4OVZB 1GMYA 4RY2A 1JQPA 3E1ZB 2DC6A 3KWBX 1QXPA 4MZOA 3PW3A 4ZTBA 2F1GA 1AU3A 1F29A 2NQGA 3GCBA 4FJCA 3OISA 1DKIA 2Y5BA 1TLOA 3CH3X 3KWZA 2ARYA 1PPOA 1MDWA 4BSQA 2B1NA 2FRQA 1SNKA 1HUCB 2XU4A 8PCHA 7PCKA 3B21A 4X6HA 4RF1A 4K7CA 4W4UA 3USVA 1NL6A 2AVWA 4CDFB 4YV8A 1MEMA 1SP4B 3MP2A 3IOQA 1NB5A 1EWLA 5K16A 4YYVA 1AU4A 4X6IA 1PXVA 2ATOA 4BOUA 2YJCA 1QDQA 2OULA 2AYNA 1FH0A 1NB3A 1CVZA 4G54A 2YJBA 1O0EA 2IPPB 4BPVA 4YVAA 1NLJA 1YZBA 3ZNHA 1DF0A 1PPDA 2VHFA 2DCBA 3N3KA 2JQFR 1PIPA 5EGWA 3BOWA 1F2BA 2PADA 3BCNA 1BGOA 3QT4A 1STFE 5FPWA 3BPFA 4XZXA 1F2CA 3MHHA 2DC8A 2DJGB 4DMXA 4D8IA 2FO5A 3BY4A 3CBKA 3BWKA 4REZA 1VJVA 2J7QC 4CZWA 2AUXA 3IMAA 4PADA 2OZ2A 3TMPA 1CJLA 3H89A 4X6JA 4P6EA 3IEJA 1THEA 2AS8A 3PDFA 2G8JA 5J94A 1S4VA 3HWNA 3E9SA 2G7YA 3RNVA 1F2AA 2OP3A 4OEMA 2VHSA 2XU5A 2HD5A 4P6GA 1KHQA 4XUIA 3PT2A 5EZSA 4Q8GA 1Y4HA 1KFXL 4BOZA 4N4ZA 1ZCMA 3WXFA 2PBHA 2Y6EA 1ME4A 2NQIA 2B1MA 3B79A 3OQCA 1M6DA 4BOQA 3LFYA 3H8CA 3S3QA 2R9NA 2R9MA 1PPPA 2E00A 4ZUXU 4Q8HA 3N4CA 3KW9A 1MS6A 4MI7A 1EWPA 2ACTA 5CVNB 3PRPA 6PADA 1TL9A 2O6XA 3I3TA 1YALA 1U9QX 2FRAA 3P5UA 2YJ2A 2AIMA 3ZUAA 3O0UA 1POPA 4PP1A 2DZZA 1KXRA 4FK5A 5JA7A 3K9MA 3IUTA 4MM3B 2FT2A 2GHUA 2FE8A 2DOSA 2NQAA 1VSNA 1MIRA 2G6DA 2HHNA 3O1GA 4QRVA 4GUAA 2AGAA 1ATKA 3W31A 2YJ9A 3RVWA 2FUDA 2DCDA 1CV8A 2P7UA 3PSEA 2BTWA 3M99A 1PBHA 1YK8A 3TNXA 3ERVA 2BU3A 5EF4A 2BTWB 4OVZA 2C0YA 2R9CA 3CH2X 1U9VA 3H8BA 4YYQA 3C0RA 1AYWA 3PBHA 1PVJA 4QH6A 3PNRA 1PE6A 1AU0A 2BDLA 3RVVA 4XR7A 3IFUA 5CVMA 3PHWA 4R3DA 1ICFA 2PREA 1AYVA 2CIOA 4QRXA 1QMYA 1NQCA 1UKFA 2JRIA 1KHPA 1U9XA 3U8EA 3K24A 3OVXA 1NPZA 1EWMA 4RKXA 4I04A 4PP2E 3C9EA 3CBJA 3KSEA 3S3RA 1PADA 5CHVA 1CB5A 3P5XA 2YJ8A
chains in the Genus database with same CATH topology
4W5BA 2PNSA 3HHAA 1MEGA 1AYUA 1ME3A 4C5PA 3LXSA 4BS6A 1TU6A 1U5IA 1CS8A 1CSBB 1XKGA 1BP4A 2HH5A 4B55A 5JH3A 2DZYA 4CDCB 4I07A 2GFOA 2WBFX 4GUZA 5A24A 1YT7A 3AI8A 3D6SA 1BY8A 4N79A 4I05A 4QBBA 1GECE 1Y08A 4YYSA 1Q6KA 1AIMA 1K3BB 4CDDB 2R6NA 1CPJA 2BDZA 4DMYA 2R9FA 2IBIA 1IWDA 4OELA 2DC9A 3BC3A 4HWYA 3KX1A 1MHWA 2FQ9A 5PADA 4MSXA 4BS5A 3P5WA 1QOLA 3I06A 3N3GA 3KFQA 1PPNA 2DCAA 4YYWA 4YYRA 1W5RA 2DJFB 3WXGA 3K8UA 5CVOB 4N8WA 4NV7A 2XU1A 4YYUA 2FYEA 3HHIA 2DC7A 1YVBA 1GCBA 2E03A 2AYOA 3F75A 5F02A 1ZIVA 2FTDA 3OF8A 2R9OA 3HD3A 3KKUA 4PI3A 3V6EA 3IHPA 1EF7A 2AUZA 3MORA 2XU3A 3V6CA 1PCIA 1GLOA 1A6RA 1AECA 3DF0A 2G8EA 1U9WA 2P0RA 4KLBA 3F5VA 1AU2A 1BQIA 2DCCA 2AU1A 1X9YA 2E01A 4FIPA 2H7JA 5CHTA 4BGFA 4W5CA 3IV2A 9PAPA 2VFCA 2CB5A 3MHSA 1DEUA 1CTEA 3WXEA 3P5VA 4AXLA 1GX3A 3NHEA 3QJ3A 1CQDA 2E02A 3RVXA 1ITOA 4MZSA 4WA6A 3H7DA 1KFUL 2NQDB 2JQGR 1EWOA 4BQVA 3MTNA 3OF9A 3H6SA 2F7DA 2P86A 4NV8A 4QRGA 4AXMA 3OVZA 3BPMA 3QSDA 1YK7A 4CDEB 2HXZA 1GMYA 4RY2A 1JQPA 3E1ZB 2DC6A 3KWBX 1QXPA 4MZOA 3PW3A 2F1GA 1AU3A 1F29A 2NQGA 3GCBA 4FJCA 3OISA 2Y5BA 1TLOA 3CH3X 3KWZA 2ARYA 1PPOA 1MDWA 4BSQA 2B1NA 2FRQA 1SNKA 1HUCB 2XU4A 8PCHA 7PCKA 4X6HA 4W4UA 4K7CA 3USVA 1NL6A 2AVWA 4CDFB 4YV8A 1MEMA 1SP4B 3IOQA 1NB5A 1EWLA 5K16A 4YYVA 1AU4A 4X6IA 1PXVA 2ATOA 2YJCA 1QDQA 2OULA 2AYNA 1FH0A 2VFBA 1NB3A 1CVZA 4G54A 2YJBA 1O0EA 2IPPB 4BPVA 4YVAA 1NLJA 1DF0A 1PPDA 2VHFA 2DCBA 3N3KA 2JQFR 1PIPA 5EGWA 3BOWA 1F2BA 2PADA 3BCNA 1BGOA 3QT4A 1STFE 5FPWA 3BPFA 1F2CA 3MHHA 2DC8A 2DJGB 4DMXA 2FO5A 3CBKA 3BWKA 1VJVA 4CZWA 2AUXA 3IMAA 4PADA 2OZ2A 1CJLA 3H89A 4X6JA 4P6EA 3IEJA 1THEA 2AS8A 3PDFA 5J94A 2G8JA 1S4VA 3HWNA 2G7YA 1F2AA 2OP3A 4OEMA 2VHSA 2XU5A 2HD5A 4P6GA 1KHQA 4XUIA 4Q8GA 1Y4HA 1KFXL 4N4ZA 1ZCMA 3WXFA 2PBHA 3LTWA 2Y6EA 1ME4A 1W4TA 2NQIA 2B1MA 3B79A 1M6DA 3LFYA 3H8CA 3S3QA 2R9NA 2R9MA 1E2TA 1PPPA 2E00A 4ZUXU 4Q8HA 3N4CA 3KW9A 1MS6A 1EWPA 2ACTA 5CVNB 6PADA 1TL9A 2O6XA 3I3TA 1YALA 1U9QX 2FRAA 3P5UA 2YJ2A 2AIMA 3ZUAA 3O0UA 1POPA 4PP1A 2DZZA 1KXRA 4FK5A 5JA7A 3K9MA 3IUTA 2FT2A 2GHUA 2NQAA 2BSZA 1VSNA 1MIRA 2G6DA 2HHNA 3O1GA 4QRVA 1ATKA 2YJ9A 3RVWA 2FUDA 2DCDA 1CV8A 2P7UA 3M99A 1PBHA 1YK8A 3TNXA 3ERVA 5EF4A 1W6FA 2C0YA 2R9CA 3CH2X 1U9VA 3H8BA 4YYQA 1AYWA 3PBHA 4QH6A 3PNRA 1PE6A 1AU0A 2BDLA 3D9WA 3RVVA 4XR7A 5CVMA 1ICFA 2PREA 4QRXA 1AYVA 2CIOA 1QMYA 1NQCA 1KHPA 1U9XA 3U8EA 3K24A 3OVXA 1NPZA 1EWMA 4I04A 4PP2E 3C9EA 3CBJA 3KSEA 3S3RA 1PADA 5CHVA 1CB5A 3P5XA 2YJ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4W5B A;  2PNS A;  3HHA A;  1MEG A;  1AYU A;  1ME3 A;  3LXS A;  4BS6 A;  1TU6 A;  1U5I A;  1CS8 A;  1CSB B;  1XKG A;  1BP4 A;  2HH5 A;  5JH3 A;  2DZY A;  4CDC B;  4I07 A;  2GFO A;  2WBF X;  5A24 A;  1YT7 A;  3AI8 A;  3D6S A;  1BY8 A;  4N79 A;  4I05 A;  4QBB A;  1GEC E;  1Y08 A;  4YYS A;  1Q6K A;  1AIM A;  1K3B B;  4CDD B;  2R6N A;  1CPJ A;  2BDZ A;  4DMY A;  2R9F A;  2IBI A;  1IWD A;  4OEL A;  2DC9 A;  3BC3 A;  4HWY A;  3KX1 A;  1MHW A;  2FQ9 A;  5PAD A;  4MSX A;  4BS5 A;  3P5W A;  1QOL A;  3I06 A;  3N3G A;  3KFQ A;  1PPN A;  2DCA A;  4YYW A;  4YYR A;  2DJF B;  3WXG A;  3K8U A;  5CVO B;  4N8W A;  2XU1 A;  4YYU A;  2FYE A;  3HHI A;  2DC7 A;  1YVB A;  1GCB A;  2E03 A;  2AYO A;  3F75 A;  5F02 A;  1ZIV A;  2FTD A;  3OF8 A;  2R9O A;  3HD3 A;  3KKU A;  4PI3 A;  3V6E A;  3IHP A;  1EF7 A;  2AUZ A;  3MOR A;  2XU3 A;  3V6C A;  1PCI A;  1GLO A;  1A6R A;  1AEC A;  3DF0 A;  2G8E A;  1U9W A;  2P0R A;  4KLB A;  3F5V A;  1AU2 A;  1BQI A;  2DCC A;  2AU1 A;  1X9Y A;  2E01 A;  4FIP A;  2H7J A;  5CHT A;  4W5C A;  3IV2 A;  9PAP A;  2CB5 A;  3MHS A;  1DEU A;  1CTE A;  3WXE A;  3P5V A;  4AXL A;  3NHE A;  3QJ3 A;  1CQD A;  2E02 A;  3RVX A;  1ITO A;  4MZS A;  4WA6 A;  3H7D A;  1KFU L;  2NQD B;  2JQG R;  1EWO A;  4BQV A;  3MTN A;  3OF9 A;  3H6S A;  2F7D A;  2P86 A;  4AXM A;  4QRG A;  3OVZ A;  3BPM A;  3QSD A;  1YK7 A;  4CDE B;  2HXZ A;  1GMY A;  4RY2 A;  1JQP A;  3E1Z B;  2DC6 A;  3KWB X;  1QXP A;  4MZO A;  3PW3 A;  2F1G A;  1AU3 A;  1F29 A;  2NQG A;  3GCB A;  4FJC A;  3OIS A;  2Y5B A;  1TLO A;  3CH3 X;  3KWZ A;  2ARY A;  1PPO A;  1MDW A;  4BSQ A;  2B1N A;  2FRQ A;  1SNK A;  1HUC B;  2XU4 A;  8PCH A;  7PCK A;  4X6H A;  4W4U A;  4K7C A;  3USV A;  1NL6 A;  2AVW A;  4CDF B;  4YV8 A;  1SP4 B;  1MEM A;  3IOQ A;  1NB5 A;  1EWL A;  5K16 A;  4YYV A;  1AU4 A;  4X6I A;  1PXV A;  2ATO A;  2YJC A;  1QDQ A;  2OUL A;  2AYN A;  1FH0 A;  1NB3 A;  1CVZ A;  4G54 A;  2YJB A;  1O0E A;  2IPP B;  4BPV A;  4YVA A;  1NLJ A;  1DF0 A;  1PPD A;  2VHF A;  2DCB A;  3N3K A;  2JQF R;  1PIP A;  5EGW A;  3BOW A;  1F2B A;  2PAD A;  3BCN A;  1BGO A;  3QT4 A;  1STF E;  5FPW A;  3BPF A;  1F2C A;  3MHH A;  2DC8 A;  2DJG B;  4DMX A;  2FO5 A;  3CBK A;  3BWK A;  1VJV A;  4CZW A;  2AUX A;  3IMA A;  4PAD A;  2OZ2 A;  1CJL A;  3H89 A;  4X6J A;  4P6E A;  3IEJ A;  1THE A;  2AS8 A;  3PDF A;  2G8J A;  5J94 A;  1S4V A;  3HWN A;  2G7Y A;  1F2A A;  2OP3 A;  4OEM A;  2VHS A;  2XU5 A;  2HD5 A;  4P6G A;  1KHQ A;  4XUI A;  4Q8G A;  1Y4H A;  1KFX L;  4N4Z A;  1ZCM A;  3WXF A;  2PBH A;  2Y6E A;  1ME4 A;  2NQI A;  2B1M A;  3B79 A;  1M6D A;  3LFY A;  3H8C A;  3S3Q A;  2R9N A;  2R9M A;  1PPP A;  2E00 A;  4ZUX U;  4Q8H A;  3N4C A;  3KW9 A;  1MS6 A;  1EWP A;  2ACT A;  5CVN B;  6PAD A;  1TL9 A;  2O6X A;  3I3T A;  1YAL A;  1U9Q X;  2FRA A;  3P5U A;  2YJ2 A;  2AIM A;  3ZUA A;  3O0U A;  1POP A;  4PP1 A;  2DZZ A;  1KXR A;  4FK5 A;  5JA7 A;  3K9M A;  3IUT A;  2FT2 A;  2GHU A;  2NQA A;  1VSN A;  1MIR A;  2G6D A;  2HHN A;  3O1G A;  4QRV A;  1ATK A;  2YJ9 A;  3RVW A;  2FUD A;  2DCD A;  1CV8 A;  2P7U A;  3M99 A;  1PBH A;  1YK8 A;  3TNX A;  3ERV A;  5EF4 A;  2C0Y A;  2R9C A;  3CH2 X;  1U9V A;  3H8B A;  4YYQ A;  1AYW A;  3PBH A;  4QH6 A;  3PNR A;  1PE6 A;  1AU0 A;  2BDL A;  3RVV A;  4XR7 A;  5CVM A;  1ICF A;  2PRE A;  1AYV A;  2CIO A;  4QRX A;  1QMY A;  1NQC A;  1KHP A;  1U9X A;  3U8E A;  3K24 A;  3OVX A;  1NPZ A;  1EWM A;  4I04 A;  4PP2 E;  3C9E A;  3CBJ A;  3KSE A;  3S3R A;  1PAD A;  5CHV A;  1CB5 A;  3P5X A;  2YJ8 A; 
#chains in the Genus database with same CATH topology
 4M0W A;  4W5B A;  2PNS A;  3HHA A;  1MEG A;  1AYU A;  1ME3 A;  3LXS A;  4BS6 A;  1TU6 A;  3O65 A;  1U5I A;  5KO3 A;  1CS8 A;  1CSB B;  1XKG A;  1BP4 A;  2HH5 A;  3PRM A;  5JH3 A;  2DZY A;  4CDC B;  4I07 A;  2GFO A;  2WBF X;  5A24 A;  1YT7 A;  3AI8 A;  3D6S A;  1BY8 A;  4N79 A;  4D8E A;  4I05 A;  4QBB A;  2UZJ A;  1GEC E;  1Y08 A;  4YYS A;  4OW0 A;  1Q6K A;  1AIM A;  5EZQ A;  3PHU A;  1K3B B;  4CDD B;  2R6N A;  4RF0 A;  1CPJ A;  2BDZ A;  4DMY A;  2R9F A;  2IBI A;  1IWD A;  4OEL A;  3W30 A;  2J7Q A;  2Z84 A;  2DC9 A;  3BC3 A;  4HWY A;  3KX1 A;  1MHW A;  2FQ9 A;  5PAD A;  3TRK A;  4MSX A;  4BS5 A;  3P5W A;  1QOL A;  3I06 A;  3N3G A;  3KFQ A;  1PPN A;  2DCA A;  4YYW A;  4YYR A;  5JZE A;  4A5U A;  2DJF B;  3WXG A;  3K8U A;  5CVO B;  4N8W A;  4IP3 A;  2XU1 A;  4YYU A;  2FYE A;  3HHI A;  2DC7 A;  1YVB A;  1GCB A;  2E03 A;  2AYO A;  3BBA A;  3F75 A;  5F02 A;  1ZIV A;  2FTD A;  3OF8 A;  2R9O A;  3BB7 A;  3HD3 A;  3KKU A;  4PI3 A;  3V6E A;  2HWK A;  3IHP A;  1EF7 A;  2AUZ A;  3MOR A;  2XU3 A;  3V6C A;  1PCI A;  4WUR A;  4RNA A;  3MJ5 A;  1GLO A;  1A6R A;  4P16 A;  1AEC A;  4HXD B;  3DF0 A;  2G8E A;  1U9W A;  2P0R A;  4IUM A;  4KLB A;  3F5V A;  1AU2 A;  1BQI A;  3PHX A;  2DCC A;  4PT5 A;  2AU1 A;  3MTV A;  5E6J A;  1X9Y A;  4FIP A;  2E01 A;  2H7J A;  5CHT A;  4W5C A;  3IV2 A;  9PAP A;  2JTC A;  2CB5 A;  3MHS A;  4BOP A;  1DEU A;  1CTE A;  3WXE A;  3P5V A;  4AXL A;  3NHE A;  3QJ3 A;  1CQD A;  2E02 A;  3RVX A;  1ITO A;  4MZS A;  4WA6 A;  4BOS A;  4D8B A;  3H7D A;  1KFU L;  2NQD B;  2JQG R;  1EWO A;  4BQV A;  3MTN A;  3OF9 A;  3H6S A;  2F7D A;  2P86 A;  4AXM A;  4QRG A;  3OVZ A;  3BPM A;  3QSD A;  1YK7 A;  4CDE B;  2HXZ A;  4OVZ B;  1GMY A;  4RY2 A;  1JQP A;  3E1Z B;  2DC6 A;  3KWB X;  1QXP A;  4MZO A;  3PW3 A;  4ZTB A;  2F1G A;  1AU3 A;  1F29 A;  2NQG A;  3GCB A;  4FJC A;  3OIS A;  1DKI A;  2Y5B A;  1TLO A;  3CH3 X;  3KWZ A;  2ARY A;  1PPO A;  1MDW A;  4BSQ A;  2B1N A;  2FRQ A;  1SNK A;  1HUC B;  2XU4 A;  8PCH A;  7PCK A;  3B21 A;  4X6H A;  4RF1 A;  4K7C A;  4W4U A;  3USV A;  1NL6 A;  2AVW A;  4CDF B;  4YV8 A;  1MEM A;  1SP4 B;  3MP2 A;  3IOQ A;  1NB5 A;  1EWL A;  5K16 A;  4YYV A;  1AU4 A;  4X6I A;  1PXV A;  2ATO A;  4BOU A;  2YJC A;  1QDQ A;  2OUL A;  2AYN A;  1FH0 A;  1NB3 A;  1CVZ A;  4G54 A;  2YJB A;  1O0E A;  2IPP B;  4BPV A;  4YVA A;  1NLJ A;  1YZB A;  3ZNH A;  1DF0 A;  1PPD A;  2VHF A;  2DCB A;  3N3K A;  2JQF R;  1PIP A;  5EGW A;  3BOW A;  1F2B A;  2PAD A;  3BCN A;  1BGO A;  3QT4 A;  1STF E;  5FPW A;  3BPF A;  4XZX A;  1F2C A;  3MHH A;  2DC8 A;  2DJG B;  4DMX A;  4D8I A;  2FO5 A;  3BY4 A;  3CBK A;  3BWK A;  4REZ A;  1VJV A;  2J7Q C;  4CZW A;  2AUX A;  3IMA A;  4PAD A;  2OZ2 A;  3TMP A;  1CJL A;  3H89 A;  4X6J A;  4P6E A;  3IEJ A;  1THE A;  2AS8 A;  3PDF A;  2G8J A;  5J94 A;  1S4V A;  3HWN A;  3E9S A;  2G7Y A;  3RNV A;  1F2A A;  2OP3 A;  4OEM A;  2VHS A;  2XU5 A;  2HD5 A;  4P6G A;  1KHQ A;  4XUI A;  3PT2 A;  5EZS A;  4Q8G A;  1Y4H A;  1KFX L;  4BOZ A;  4N4Z A;  1ZCM A;  3WXF A;  2PBH A;  2Y6E A;  1ME4 A;  2NQI A;  2B1M A;  3B79 A;  3OQC A;  1M6D A;  4BOQ A;  3LFY A;  3H8C A;  3S3Q A;  2R9N A;  2R9M A;  1PPP A;  2E00 A;  4ZUX U;  4Q8H A;  3N4C A;  3KW9 A;  1MS6 A;  4MI7 A;  1EWP A;  2ACT A;  5CVN B;  3PRP A;  6PAD A;  1TL9 A;  2O6X A;  3I3T A;  1YAL A;  1U9Q X;  2FRA A;  3P5U A;  2YJ2 A;  2AIM A;  3ZUA A;  3O0U A;  1POP A;  4PP1 A;  2DZZ A;  1KXR A;  4FK5 A;  5JA7 A;  3K9M A;  3IUT A;  4MM3 B;  2FT2 A;  2GHU A;  2FE8 A;  2DOS A;  2NQA A;  1VSN A;  1MIR A;  2G6D A;  2HHN A;  3O1G A;  4QRV A;  4GUA A;  2AGA A;  1ATK A;  3W31 A;  2YJ9 A;  3RVW A;  2FUD A;  2DCD A;  1CV8 A;  2P7U A;  3PSE A;  2BTW A;  3M99 A;  1PBH A;  1YK8 A;  3TNX A;  3ERV A;  2BU3 A;  5EF4 A;  2BTW B;  4OVZ A;  2C0Y A;  2R9C A;  3CH2 X;  1U9V A;  3H8B A;  4YYQ A;  3C0R A;  1AYW A;  3PBH A;  1PVJ A;  4QH6 A;  3PNR A;  1PE6 A;  1AU0 A;  2BDL A;  3RVV A;  4XR7 A;  3IFU A;  5CVM A;  3PHW A;  4R3D A;  1ICF A;  2PRE A;  1AYV A;  2CIO A;  4QRX A;  1QMY A;  1NQC A;  1UKF A;  2JRI A;  1KHP A;  1U9X A;  3U8E A;  3K24 A;  3OVX A;  1NPZ A;  1EWM A;  4RKX A;  4I04 A;  4PP2 E;  3C9E A;  3CBJ A;  3KSE A;  3S3R A;  1PAD A;  5CHV A;  1CB5 A;  3P5X A;  2YJ8 A; 
#chains in the Genus database with same CATH homology
 4W5B A;  2PNS A;  3HHA A;  1MEG A;  1AYU A;  1ME3 A;  4C5P A;  3LXS A;  4BS6 A;  1TU6 A;  1U5I A;  1CS8 A;  1CSB B;  1XKG A;  1BP4 A;  2HH5 A;  4B55 A;  5JH3 A;  2DZY A;  4CDC B;  4I07 A;  2GFO A;  2WBF X;  4GUZ A;  5A24 A;  1YT7 A;  3AI8 A;  3D6S A;  1BY8 A;  4N79 A;  4I05 A;  4QBB A;  1GEC E;  1Y08 A;  4YYS A;  1Q6K A;  1AIM A;  1K3B B;  4CDD B;  2R6N A;  1CPJ A;  2BDZ A;  4DMY A;  2R9F A;  2IBI A;  1IWD A;  4OEL A;  2DC9 A;  3BC3 A;  4HWY A;  3KX1 A;  1MHW A;  2FQ9 A;  5PAD A;  4MSX A;  4BS5 A;  3P5W A;  1QOL A;  3I06 A;  3N3G A;  3KFQ A;  1PPN A;  2DCA A;  4YYW A;  4YYR A;  1W5R A;  2DJF B;  3WXG A;  3K8U A;  5CVO B;  4N8W A;  4NV7 A;  2XU1 A;  4YYU A;  2FYE A;  3HHI A;  2DC7 A;  1YVB A;  1GCB A;  2E03 A;  2AYO A;  3F75 A;  5F02 A;  1ZIV A;  2FTD A;  3OF8 A;  2R9O A;  3HD3 A;  3KKU A;  4PI3 A;  3V6E A;  3IHP A;  1EF7 A;  2AUZ A;  3MOR A;  2XU3 A;  3V6C A;  1PCI A;  1GLO A;  1A6R A;  1AEC A;  3DF0 A;  2G8E A;  1U9W A;  2P0R A;  4KLB A;  3F5V A;  1AU2 A;  1BQI A;  2DCC A;  2AU1 A;  1X9Y A;  2E01 A;  4FIP A;  2H7J A;  5CHT A;  4BGF A;  4W5C A;  3IV2 A;  9PAP A;  2VFC A;  2CB5 A;  3MHS A;  1DEU A;  1CTE A;  3WXE A;  3P5V A;  4AXL A;  1GX3 A;  3NHE A;  3QJ3 A;  1CQD A;  2E02 A;  3RVX A;  1ITO A;  4MZS A;  4WA6 A;  3H7D A;  1KFU L;  2NQD B;  2JQG R;  1EWO A;  4BQV A;  3MTN A;  3OF9 A;  3H6S A;  2F7D A;  2P86 A;  4NV8 A;  4QRG A;  4AXM A;  3OVZ A;  3BPM A;  3QSD A;  1YK7 A;  4CDE B;  2HXZ A;  1GMY A;  4RY2 A;  1JQP A;  3E1Z B;  2DC6 A;  3KWB X;  1QXP A;  4MZO A;  3PW3 A;  2F1G A;  1AU3 A;  1F29 A;  2NQG A;  3GCB A;  4FJC A;  3OIS A;  2Y5B A;  1TLO A;  3CH3 X;  3KWZ A;  2ARY A;  1PPO A;  1MDW A;  4BSQ A;  2B1N A;  2FRQ A;  1SNK A;  1HUC B;  2XU4 A;  8PCH A;  7PCK A;  4X6H A;  4W4U A;  4K7C A;  3USV A;  1NL6 A;  2AVW A;  4CDF B;  4YV8 A;  1MEM A;  1SP4 B;  3IOQ A;  1NB5 A;  1EWL A;  5K16 A;  4YYV A;  1AU4 A;  4X6I A;  1PXV A;  2ATO A;  2YJC A;  1QDQ A;  2OUL A;  2AYN A;  1FH0 A;  2VFB A;  1NB3 A;  1CVZ A;  4G54 A;  2YJB A;  1O0E A;  2IPP B;  4BPV A;  4YVA A;  1NLJ A;  1DF0 A;  1PPD A;  2VHF A;  2DCB A;  3N3K A;  2JQF R;  1PIP A;  5EGW A;  3BOW A;  1F2B A;  2PAD A;  3BCN A;  1BGO A;  3QT4 A;  1STF E;  5FPW A;  3BPF A;  1F2C A;  3MHH A;  2DC8 A;  2DJG B;  4DMX A;  2FO5 A;  3CBK A;  3BWK A;  1VJV A;  4CZW A;  2AUX A;  3IMA A;  4PAD A;  2OZ2 A;  1CJL A;  3H89 A;  4X6J A;  4P6E A;  3IEJ A;  1THE A;  2AS8 A;  3PDF A;  5J94 A;  2G8J A;  1S4V A;  3HWN A;  2G7Y A;  1F2A A;  2OP3 A;  4OEM A;  2VHS A;  2XU5 A;  2HD5 A;  4P6G A;  1KHQ A;  4XUI A;  4Q8G A;  1Y4H A;  1KFX L;  4N4Z A;  1ZCM A;  3WXF A;  2PBH A;  3LTW A;  2Y6E A;  1ME4 A;  1W4T A;  2NQI A;  2B1M A;  3B79 A;  1M6D A;  3LFY A;  3H8C A;  3S3Q A;  2R9N A;  2R9M A;  1E2T A;  1PPP A;  2E00 A;  4ZUX U;  4Q8H A;  3N4C A;  3KW9 A;  1MS6 A;  1EWP A;  2ACT A;  5CVN B;  6PAD A;  1TL9 A;  2O6X A;  3I3T A;  1YAL A;  1U9Q X;  2FRA A;  3P5U A;  2YJ2 A;  2AIM A;  3ZUA A;  3O0U A;  1POP A;  4PP1 A;  2DZZ A;  1KXR A;  4FK5 A;  5JA7 A;  3K9M A;  3IUT A;  2FT2 A;  2GHU A;  2NQA A;  2BSZ A;  1VSN A;  1MIR A;  2G6D A;  2HHN A;  3O1G A;  4QRV A;  1ATK A;  2YJ9 A;  3RVW A;  2FUD A;  2DCD A;  1CV8 A;  2P7U A;  3M99 A;  1PBH A;  1YK8 A;  3TNX A;  3ERV A;  5EF4 A;  1W6F A;  2C0Y A;  2R9C A;  3CH2 X;  1U9V A;  3H8B A;  4YYQ A;  1AYW A;  3PBH A;  4QH6 A;  3PNR A;  1PE6 A;  1AU0 A;  2BDL A;  3D9W A;  3RVV A;  4XR7 A;  5CVM A;  1ICF A;  2PRE A;  4QRX A;  1AYV A;  2CIO A;  1QMY A;  1NQC A;  1KHP A;  1U9X A;  3U8E A;  3K24 A;  3OVX A;  1NPZ A;  1EWM A;  4I04 A;  4PP2 E;  3C9E A;  3CBJ A;  3KSE A;  3S3R A;  1PAD A;  5CHV A;  1CB5 A;  3P5X A;  2YJ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...