1YK7A

Cathepsin k complexed with a cyanopyrrolidine inhibitor
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
215
structure length
215
Chain Sequence
b'APDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cathepsin K
molecule tags Hydrolase
source organism Homo sapiens
publication title Novel and potent cyclic cyanamide-based cathepsin K inhibitors.
pubmed doi rcsb
total genus 61
structure length 215
sequence length 215
ec nomenclature ec 3.4.22.38: Cathepsin K.
pdb deposition date 2005-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1yk7A00
9PAPA 1GMYA 3RVVA 4QRXA 4KLBA 4W4UA 4YYUA 4BS5A 3CBJA 1PPNA 3GCBA 1QXPA 4N8WA 1EWMA 2ACTA 3CBKA 1A6RA 3IMAA 4FIPA 1CSBB 1K3BB 2ARYA 1EF7A 1PPDA 3HHIA 2DC6A 1F29A 1SP4B 3K8UA 4BS6A 2R9MA 2AIMA 2YJ8A 4MSXA 1CQDA 1CJLA 4P6GA 3ZUAA 1YVBA 2PADA 2E02A 4MZOA 4YYWA 3B79A 2NQIA 3I06A 1GCBA 1PBHA 3O1GA 2E00A 2HXZA 5EGWA 1Y4HA 1NB3A 3P5UA 3D6SA 1AYVA 1Q6KA 4BQVA 2JQFR 1CVZA 1GLOA 4OEMA 1BY8A 3V6EA 1VSNA 1CB5A 3PDFA 3BWKA 1YK7A 3PNRA 2HHNA 1EWLA 1U9QX 2NQGA 3P5VA 3E1ZB 1X9YA 1ME4A 1YALA 3OISA 4X6HA 3WXEA 4YYSA 2FT2A 4G54A 1QDQA 4CDFB 2CB5A 2DZYA 1YT7A 3H8BA 1MS6A 4W5BA 3V6CA 2E01A 2BDZA 4PI3A 4DMYA 2YJ9A 4K7CA 1QMYA 6PADA 2G7YA 1YK8A 4I05A 2OZ2A 1NB5A 1CV8A 1BP4A 2DC9A 2AYOA 2B1NA 1SNKA 1ICFA 3RVXA 4PP1A 1ATKA 2AS8A 2XU5A 3BC3A 3PW3A 4FK5A 2R9OA 2DC8A 5CHTA 5FPWA 2FTDA 1KFUL 2FYEA 4QBBA 1NPZA 1AU2A 4QH6A 2O6XA 4YV8A 5JA7A 3S3RA 1KXRA 1PXVA 3IOQA 4RY2A 3MHHA 1PE6A 3IUTA 1VJVA 1MHWA 4W5CA 4BSQA 4BPVA 2CIOA 1Y08A 3WXFA 3LFYA 1F2AA 3AI8A 4CDEB 4Q8HA 3MTNA 2F7DA 4XUIA 5K16A 2G8JA 2P86A 3KSEA 1PCIA 2H7JA 3K9MA 2DC7A 2R9CA 2FUDA 2HD5A 1BQIA 1EWPA 3M99A 2YJCA 1MDWA 3OF9A 3QJ3A 2B1MA 2BDLA 2C0YA 1THEA 2XU3A 1STFE 1ME3A 1QOLA 2AUZA 3QSDA 4AXLA 4X6IA 2OP3A 2FQ9A 1F2CA 4YYVA 5JH3A 3HHAA 3N4CA 3N3GA 4YVAA 1KHQA 1U9XA 4N4ZA 1EWOA 2R9NA 3H89A 3KFQA 1CPJA 3U8EA 2DCAA 2YJ2A 1AU4A 3PBHA 1AU0A 7PCKA 2G6DA 3F5VA 1XKGA 3OF8A 2G8EA 3KWZA 3OVZA 3H8CA 2P7UA 1AYUA 2WBFX 3H7DA 2VHFA 3MHSA 4YYQA 3DF0A 4MZSA 4PADA 1M6DA 1PPOA 5EF4A 4ZUXU 4CDCB 2PBHA 3BPFA 3IEJA 4Q8GA 3TNXA 1DEUA 2E03A 1BGOA 2F1GA 1MIRA 1ITOA 1AIMA 3C9EA 1PADA 4I07A 1MEGA 1PPPA 1NQCA 2Y5BA 4WA6A 4CZWA 1GECE 2DZZA 1NL6A 2Y6EA 1HUCB 3MORA 3P5WA 1U5IA 1F2BA 4FJCA 1S4VA 2DCDA 1AU3A 3KWBX 5CVOB 3KW9A 1U9WA 3KKUA 2JQGR 2IPPB 1TLOA 2DCCA 3S3QA 3IHPA 1JQPA 2ATOA 4AXMA 2GHUA 4XR7A 2FRAA 3I3TA 5CVMA 4X6JA 2PNSA 3H6SA 2PREA 1MEMA 5A24A 2AU1A 4PP2E 3BPMA 4P6EA 8PCHA 2XU4A 4DMXA 4HWYA 2AVWA 5CVNB 1CS8A 5CHVA 1IWDA 2DCBA 2OULA 3CH2X 2NQDB 2R6NA 1O0EA 4I04A 1ZCMA 2XU1A 3P5XA 3O0UA 1DF0A 3N3KA 1ZIVA 1KFXL 1PIPA 1CTEA 3OVXA 4CDDB 1KHPA 2DJFB 2IBIA 3K24A 4YYRA 2NQAA 2HH5A 1AYWA 3RVWA 2DJGB 2GFOA 5J94A 2FRQA 3CH3X 1AECA 3QT4A 3BOWA 1NLJA 3KX1A 2R9FA 4QRGA 4N79A 2AUXA 3F75A 1TU6A 3BCNA 3HD3A 3LXSA 2AYNA 3WXGA 2FO5A 5PADA 1TL9A 3USVA 3ERVA 1FH0A 1POPA 4QRVA 3IV2A 2P0RA 4OELA 2VHSA 3NHEA 1U9VA 3HWNA 2YJBA 5F02A
chains in the Genus database with same CATH superfamily
9PAPA 1GMYA 3RVVA 4BOPA 4QRXA 4KLBA 4ZTBA 4W4UA 4YYUA 4BS5A 3CBJA 1PPNA 3GCBA 1QXPA 4N8WA 1EWMA 2ACTA 3CBKA 1A6RA 3IMAA 4FIPA 4IUMA 1CSBB 1K3BB 4RF0A 2AGAA 1EF7A 2ARYA 1PPDA 3HHIA 2DC6A 1F29A 1SP4B 3K8UA 3RNVA 4BS6A 2R9MA 5JZEA 2AIMA 2YJ8A 4MSXA 1CQDA 1CJLA 4P6GA 3ZUAA 1YVBA 2PADA 3ZNHA 2E02A 4MZOA 4YYWA 3B79A 2J7QA 2NQIA 3I06A 1GCBA 2Z84A 1PBHA 3O1GA 2E00A 2HXZA 5EGWA 1Y4HA 1NB3A 3P5UA 3D6SA 1AYVA 3E9SA 2BTWA 1Q6KA 4BQVA 2JQFR 1CVZA 1GLOA 4OEMA 1BY8A 3V6EA 1VSNA 1CB5A 5EZQA 3MTVA 3PDFA 3C0RA 3PRPA 3BWKA 1YK7A 3PSEA 2JRIA 3PNRA 2HHNA 4D8BA 1EWLA 1U9QX 2NQGA 3P5VA 4GUAA 3E1ZB 1X9YA 1ME4A 4BOZA 1YALA 3OISA 4X6HA 3WXEA 4OW0A 4YYSA 2FT2A 4G54A 1QDQA 4CDFB 2CB5A 2DZYA 1YT7A 3H8BA 5EZSA 1MS6A 4W5BA 3V6CA 2E01A 2BDZA 4PI3A 2J7QC 4DMYA 2YJ9A 2DOSA 4K7CA 1QMYA 2BTWB 6PADA 2G7YA 4A5UA 1YK8A 2FE8A 4I05A 2OZ2A 1NB5A 3B21A 1CV8A 1BP4A 2DC9A 2AYOA 2B1NA 1SNKA 1ICFA 3RVXA 4PP1A 1ATKA 2AS8A 2XU5A 3BC3A 3PW3A 3W31A 4FK5A 2R9OA 4XZXA 2DC8A 5CHTA 5FPWA 2FTDA 1KFUL 2FYEA 4QBBA 1NPZA 1AU2A 4QH6A 2O6XA 4YV8A 5JA7A 3S3RA 1KXRA 1PXVA 3IOQA 4RY2A 3MHHA 4RF1A 1PE6A 3IUTA 1VJVA 1MHWA 4W5CA 4BSQA 4BPVA 2CIOA 1Y08A 3WXFA 3LFYA 5KO3A 1F2AA 3AI8A 4CDEB 4Q8HA 3MTNA 2F7DA 1DKIA 4XUIA 5K16A 3MP2A 2G8JA 2P86A 3PRMA 3KSEA 1PCIA 2H7JA 3K9MA 2DC7A 2R9CA 2FUDA 4HXDB 2HD5A 1BQIA 3OQCA 1EWPA 3M99A 2YJCA 1MDWA 3OF9A 3QJ3A 2B1MA 2BDLA 2C0YA 1THEA 3PHWA 2XU3A 1STFE 1ME3A 1QOLA 2AUZA 3QSDA 4AXLA 4X6IA 2OP3A 2FQ9A 1F2CA 4YYVA 5JH3A 3HHAA 3PHUA 2HWKA 3N4CA 3N3GA 4YVAA 1KHQA 1U9XA 3BY4A 4N4ZA 3BBAA 1EWOA 2R9NA 3H89A 3KFQA 1CPJA 3U8EA 2DCAA 2YJ2A 1AU4A 3PBHA 1AU0A 7PCKA 2UZJA 2G6DA 3F5VA 1XKGA 3OF8A 2G8EA 3KWZA 3OVZA 3H8CA 2P7UA 1AYUA 2WBFX 3H7DA 2VHFA 3MHSA 3PHXA 4YYQA 3DF0A 4MZSA 4PADA 1M6DA 4BOUA 1PPOA 5EF4A 4ZUXU 4CDCB 2PBHA 3BPFA 3IEJA 4BOSA 4Q8GA 3TNXA 2JTCA 1DEUA 4M0WA 4P16A 2E03A 1BGOA 2F1GA 1MIRA 1ITOA 1AIMA 3C9EA 1PADA 3IFUA 4I07A 1MEGA 1PPPA 1NQCA 2Y5BA 4WA6A 4CZWA 1GECE 4WURA 4IP3A 4BOQA 2DZZA 3TMPA 1NL6A 2Y6EA 1HUCB 3MORA 3P5WA 1U5IA 3TRKA 4R3DA 1F2BA 4FJCA 1S4VA 1UKFA 2DCDA 1AU3A 3KWBX 5CVOB 3KW9A 3PT2A 2BU3A 1U9WA 3KKUA 2JQGR 2IPPB 1TLOA 2DCCA 3S3QA 3IHPA 1JQPA 2ATOA 4AXMA 2GHUA 4XR7A 2FRAA 3I3TA 5CVMA 4X6JA 2PNSA 3H6SA 2PREA 1MEMA 5A24A 2AU1A 4PP2E 4RKXA 3BPMA 4P6EA 8PCHA 2XU4A 4OVZB 4DMXA 4HWYA 1YZBA 2AVWA 5CVNB 1CS8A 5CHVA 1IWDA 2DCBA 2OULA 3CH2X 2NQDB 2R6NA 3MJ5A 1O0EA 4I04A 1ZCMA 2XU1A 3P5XA 3O0UA 1DF0A 4RNAA 3N3KA 1ZIVA 1KFXL 1PIPA 1PVJA 1CTEA 3O65A 3OVXA 4CDDB 1KHPA 2DJFB 2IBIA 3K24A 4YYRA 2NQAA 2HH5A 1AYWA 3RVWA 2DJGB 2GFOA 3W30A 5J94A 4OVZA 2FRQA 3CH3X 1AECA 4MI7A 3QT4A 3BOWA 1NLJA 3KX1A 2R9FA 4QRGA 4N79A 2AUXA 4D8IA 3F75A 1TU6A 3BCNA 3HD3A 3LXSA 2AYNA 4PT5A 3WXGA 5E6JA 2FO5A 5PADA 1TL9A 3USVA 3ERVA 3BB7A 4REZA 1FH0A 1POPA 4QRVA 3IV2A 4D8EA 4MM3B 2P0RA 4OELA 2VHSA 3NHEA 1U9VA 3HWNA 2YJBA 5F02A
chains in the Genus database with same CATH topology
9PAPA 1GMYA 3RVVA 4QRXA 4KLBA 4W4UA 4YYUA 4BS5A 3CBJA 1PPNA 3GCBA 1QXPA 4N8WA 1EWMA 2ACTA 3CBKA 1A6RA 3IMAA 4FIPA 1CSBB 1K3BB 2ARYA 1EF7A 1PPDA 3HHIA 4C5PA 2DC6A 1F29A 1SP4B 3K8UA 4BS6A 2R9MA 2AIMA 2YJ8A 4MSXA 1CQDA 1CJLA 4P6GA 3ZUAA 1YVBA 2PADA 2E02A 4MZOA 4YYWA 3B79A 2NQIA 3I06A 1GCBA 1PBHA 3O1GA 2E00A 2HXZA 5EGWA 1Y4HA 1NB3A 3P5UA 3D6SA 1AYVA 1Q6KA 4BQVA 2JQFR 1CVZA 1GLOA 4OEMA 1BY8A 3V6EA 1VSNA 1CB5A 3PDFA 3BWKA 1YK7A 3PNRA 2HHNA 1EWLA 1U9QX 2NQGA 3P5VA 3E1ZB 1X9YA 1ME4A 1YALA 3OISA 4X6HA 3WXEA 4YYSA 2FT2A 4G54A 1QDQA 4BGFA 4CDFB 2CB5A 2DZYA 1YT7A 3H8BA 1MS6A 4W5BA 3V6CA 2E01A 2BDZA 4PI3A 4DMYA 2YJ9A 4K7CA 1QMYA 6PADA 2G7YA 1YK8A 4I05A 2OZ2A 1NB5A 1CV8A 1BP4A 2DC9A 2AYOA 2B1NA 1SNKA 1ICFA 3RVXA 4PP1A 1ATKA 2AS8A 2XU5A 3BC3A 3PW3A 4FK5A 2R9OA 2DC8A 5CHTA 5FPWA 2FTDA 1KFUL 2FYEA 4QBBA 1NPZA 1AU2A 4QH6A 2O6XA 4NV8A 4YV8A 5JA7A 3S3RA 1KXRA 1PXVA 3IOQA 4RY2A 3MHHA 1PE6A 3IUTA 1VJVA 1MHWA 4W5CA 4BSQA 4BPVA 2CIOA 1Y08A 3WXFA 3LFYA 1F2AA 2VFBA 3AI8A 4CDEB 4Q8HA 3MTNA 2F7DA 4XUIA 5K16A 2G8JA 2P86A 3KSEA 1GX3A 1PCIA 2H7JA 3K9MA 2DC7A 2R9CA 2FUDA 2HD5A 1BQIA 1EWPA 3M99A 2YJCA 1MDWA 3OF9A 3QJ3A 2B1MA 2BDLA 2C0YA 1THEA 1W6FA 2XU3A 1STFE 1ME3A 1QOLA 2AUZA 3QSDA 4AXLA 4X6IA 2OP3A 3D9WA 2FQ9A 1F2CA 4YYVA 5JH3A 3HHAA 4NV7A 3N4CA 3N3GA 1W4TA 4YVAA 1KHQA 1U9XA 4N4ZA 1EWOA 2R9NA 3H89A 3KFQA 1CPJA 3U8EA 2DCAA 2YJ2A 1AU4A 3PBHA 1AU0A 7PCKA 2G6DA 3F5VA 1XKGA 2VFCA 3OF8A 2G8EA 3KWZA 3OVZA 3H8CA 2P7UA 1AYUA 2WBFX 3H7DA 2VHFA 3MHSA 4YYQA 3DF0A 4MZSA 4PADA 1M6DA 1PPOA 5EF4A 4ZUXU 4CDCB 2PBHA 3BPFA 3IEJA 4Q8GA 3TNXA 1DEUA 2E03A 1BGOA 2F1GA 1MIRA 1ITOA 1AIMA 3C9EA 1PADA 4I07A 1MEGA 1PPPA 1NQCA 2Y5BA 4WA6A 4CZWA 1GECE 2DZZA 1NL6A 2Y6EA 1HUCB 3MORA 3P5WA 1U5IA 1F2BA 4FJCA 1S4VA 2DCDA 1AU3A 3KWBX 5CVOB 3KW9A 1U9WA 3KKUA 2JQGR 2IPPB 1TLOA 2DCCA 3LTWA 3S3QA 3IHPA 1JQPA 2ATOA 4AXMA 2GHUA 4B55A 4XR7A 2FRAA 3I3TA 5CVMA 4X6JA 2PNSA 3H6SA 1E2TA 2PREA 1MEMA 5A24A 2AU1A 4PP2E 3BPMA 4P6EA 8PCHA 2XU4A 4DMXA 4HWYA 2AVWA 5CVNB 1CS8A 5CHVA 1IWDA 2DCBA 2OULA 3CH2X 2NQDB 2R6NA 1O0EA 4I04A 1ZCMA 2XU1A 3P5XA 3O0UA 2BSZA 1DF0A 3N3KA 1ZIVA 1KFXL 1PIPA 1CTEA 3OVXA 4CDDB 1KHPA 2DJFB 2IBIA 3K24A 4YYRA 2NQAA 2HH5A 1AYWA 3RVWA 2DJGB 2GFOA 5J94A 2FRQA 3CH3X 1AECA 3QT4A 3BOWA 1NLJA 3KX1A 2R9FA 4GUZA 4QRGA 4N79A 2AUXA 3F75A 1TU6A 3BCNA 3HD3A 3LXSA 2AYNA 3WXGA 2FO5A 5PADA 1TL9A 3USVA 3ERVA 1FH0A 1POPA 1W5RA 4QRVA 3IV2A 2P0RA 4OELA 2VHSA 3NHEA 1U9VA 3HWNA 2YJBA 5F02A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 9PAP A;  1GMY A;  3RVV A;  4QRX A;  4KLB A;  4W4U A;  4YYU A;  4BS5 A;  3CBJ A;  1PPN A;  3GCB A;  1QXP A;  4N8W A;  1EWM A;  2ACT A;  3CBK A;  1A6R A;  3IMA A;  4FIP A;  1CSB B;  1K3B B;  2ARY A;  1EF7 A;  1PPD A;  3HHI A;  2DC6 A;  1F29 A;  1SP4 B;  3K8U A;  4BS6 A;  2R9M A;  2AIM A;  2YJ8 A;  4MSX A;  1CQD A;  1CJL A;  4P6G A;  3ZUA A;  1YVB A;  2PAD A;  2E02 A;  4MZO A;  4YYW A;  3B79 A;  2NQI A;  3I06 A;  1GCB A;  1PBH A;  3O1G A;  2E00 A;  2HXZ A;  5EGW A;  1Y4H A;  1NB3 A;  3P5U A;  3D6S A;  1AYV A;  1Q6K A;  4BQV A;  2JQF R;  1CVZ A;  1GLO A;  4OEM A;  1BY8 A;  3V6E A;  1VSN A;  1CB5 A;  3PDF A;  3BWK A;  1YK7 A;  3PNR A;  2HHN A;  1EWL A;  1U9Q X;  2NQG A;  3P5V A;  3E1Z B;  1X9Y A;  1ME4 A;  1YAL A;  3OIS A;  4X6H A;  3WXE A;  4YYS A;  2FT2 A;  4G54 A;  1QDQ A;  4CDF B;  2CB5 A;  2DZY A;  1YT7 A;  3H8B A;  1MS6 A;  4W5B A;  3V6C A;  2E01 A;  2BDZ A;  4PI3 A;  4DMY A;  2YJ9 A;  4K7C A;  1QMY A;  6PAD A;  2G7Y A;  1YK8 A;  4I05 A;  2OZ2 A;  1NB5 A;  1CV8 A;  1BP4 A;  2DC9 A;  2AYO A;  2B1N A;  1SNK A;  1ICF A;  3RVX A;  4PP1 A;  1ATK A;  2AS8 A;  2XU5 A;  3BC3 A;  3PW3 A;  4FK5 A;  2R9O A;  2DC8 A;  5CHT A;  5FPW A;  2FTD A;  1KFU L;  2FYE A;  4QBB A;  1NPZ A;  1AU2 A;  4QH6 A;  2O6X A;  4YV8 A;  5JA7 A;  3S3R A;  1KXR A;  1PXV A;  3IOQ A;  4RY2 A;  3MHH A;  1PE6 A;  3IUT A;  1VJV A;  1MHW A;  4W5C A;  4BSQ A;  4BPV A;  2CIO A;  1Y08 A;  3WXF A;  3LFY A;  1F2A A;  3AI8 A;  4CDE B;  4Q8H A;  3MTN A;  2F7D A;  4XUI A;  5K16 A;  2G8J A;  2P86 A;  3KSE A;  1PCI A;  2H7J A;  3K9M A;  2DC7 A;  2R9C A;  2FUD A;  2HD5 A;  1BQI A;  1EWP A;  3M99 A;  2YJC A;  1MDW A;  3OF9 A;  3QJ3 A;  2B1M A;  2BDL A;  2C0Y A;  1THE A;  2XU3 A;  1STF E;  1ME3 A;  1QOL A;  2AUZ A;  3QSD A;  4AXL A;  4X6I A;  2OP3 A;  2FQ9 A;  1F2C A;  4YYV A;  5JH3 A;  3HHA A;  3N4C A;  3N3G A;  4YVA A;  1KHQ A;  1U9X A;  4N4Z A;  1EWO A;  2R9N A;  3H89 A;  3KFQ A;  1CPJ A;  3U8E A;  2DCA A;  2YJ2 A;  1AU4 A;  3PBH A;  1AU0 A;  7PCK A;  2G6D A;  3F5V A;  1XKG A;  3OF8 A;  2G8E A;  3KWZ A;  3OVZ A;  3H8C A;  2P7U A;  1AYU A;  2WBF X;  3H7D A;  2VHF A;  3MHS A;  4YYQ A;  3DF0 A;  4MZS A;  4PAD A;  1M6D A;  1PPO A;  5EF4 A;  4ZUX U;  4CDC B;  2PBH A;  3BPF A;  3IEJ A;  4Q8G A;  3TNX A;  1DEU A;  2E03 A;  1BGO A;  2F1G A;  1MIR A;  1ITO A;  1AIM A;  3C9E A;  1PAD A;  4I07 A;  1MEG A;  1PPP A;  1NQC A;  2Y5B A;  4WA6 A;  4CZW A;  1GEC E;  2DZZ A;  1NL6 A;  2Y6E A;  1HUC B;  3MOR A;  3P5W A;  1U5I A;  1F2B A;  4FJC A;  1S4V A;  2DCD A;  1AU3 A;  3KWB X;  5CVO B;  3KW9 A;  1U9W A;  3KKU A;  2JQG R;  2IPP B;  1TLO A;  2DCC A;  3S3Q A;  3IHP A;  1JQP A;  2ATO A;  4AXM A;  2GHU A;  4XR7 A;  2FRA A;  3I3T A;  5CVM A;  4X6J A;  2PNS A;  3H6S A;  2PRE A;  1MEM A;  5A24 A;  2AU1 A;  4PP2 E;  3BPM A;  4P6E A;  8PCH A;  2XU4 A;  4DMX A;  4HWY A;  2AVW A;  5CVN B;  1CS8 A;  5CHV A;  1IWD A;  2DCB A;  2OUL A;  3CH2 X;  2NQD B;  2R6N A;  1O0E A;  4I04 A;  1ZCM A;  2XU1 A;  3P5X A;  3O0U A;  1DF0 A;  3N3K A;  1ZIV A;  1KFX L;  1PIP A;  1CTE A;  3OVX A;  4CDD B;  1KHP A;  2DJF B;  2IBI A;  3K24 A;  4YYR A;  2NQA A;  2HH5 A;  1AYW A;  3RVW A;  2DJG B;  2GFO A;  5J94 A;  2FRQ A;  3CH3 X;  1AEC A;  3QT4 A;  3BOW A;  1NLJ A;  3KX1 A;  2R9F A;  4QRG A;  4N79 A;  2AUX A;  3F75 A;  1TU6 A;  3BCN A;  3HD3 A;  3LXS A;  2AYN A;  3WXG A;  2FO5 A;  5PAD A;  1TL9 A;  3USV A;  3ERV A;  1FH0 A;  1POP A;  4QRV A;  3IV2 A;  2P0R A;  4OEL A;  2VHS A;  3NHE A;  1U9V A;  3HWN A;  2YJB A;  5F02 A; 
#chains in the Genus database with same CATH topology
 9PAP A;  1GMY A;  3RVV A;  4BOP A;  4QRX A;  4KLB A;  4ZTB A;  4W4U A;  4YYU A;  4BS5 A;  3CBJ A;  1PPN A;  3GCB A;  1QXP A;  4N8W A;  1EWM A;  2ACT A;  3CBK A;  1A6R A;  3IMA A;  4FIP A;  4IUM A;  1CSB B;  1K3B B;  4RF0 A;  2AGA A;  1EF7 A;  2ARY A;  1PPD A;  3HHI A;  2DC6 A;  1F29 A;  1SP4 B;  3K8U A;  3RNV A;  4BS6 A;  2R9M A;  5JZE A;  2AIM A;  2YJ8 A;  4MSX A;  1CQD A;  1CJL A;  4P6G A;  3ZUA A;  1YVB A;  2PAD A;  3ZNH A;  2E02 A;  4MZO A;  4YYW A;  3B79 A;  2J7Q A;  2NQI A;  3I06 A;  1GCB A;  2Z84 A;  1PBH A;  3O1G A;  2E00 A;  2HXZ A;  5EGW A;  1Y4H A;  1NB3 A;  3P5U A;  3D6S A;  1AYV A;  3E9S A;  2BTW A;  1Q6K A;  4BQV A;  2JQF R;  1CVZ A;  1GLO A;  4OEM A;  1BY8 A;  3V6E A;  1VSN A;  1CB5 A;  5EZQ A;  3MTV A;  3PDF A;  3C0R A;  3PRP A;  3BWK A;  1YK7 A;  3PSE A;  2JRI A;  3PNR A;  2HHN A;  4D8B A;  1EWL A;  1U9Q X;  2NQG A;  3P5V A;  4GUA A;  3E1Z B;  1X9Y A;  1ME4 A;  4BOZ A;  1YAL A;  3OIS A;  4X6H A;  3WXE A;  4OW0 A;  4YYS A;  2FT2 A;  4G54 A;  1QDQ A;  4CDF B;  2CB5 A;  2DZY A;  1YT7 A;  3H8B A;  5EZS A;  1MS6 A;  4W5B A;  3V6C A;  2E01 A;  2BDZ A;  4PI3 A;  2J7Q C;  4DMY A;  2YJ9 A;  2DOS A;  4K7C A;  1QMY A;  2BTW B;  6PAD A;  2G7Y A;  4A5U A;  1YK8 A;  2FE8 A;  4I05 A;  2OZ2 A;  1NB5 A;  3B21 A;  1CV8 A;  1BP4 A;  2DC9 A;  2AYO A;  2B1N A;  1SNK A;  1ICF A;  3RVX A;  4PP1 A;  1ATK A;  2AS8 A;  2XU5 A;  3BC3 A;  3PW3 A;  3W31 A;  4FK5 A;  2R9O A;  4XZX A;  2DC8 A;  5CHT A;  5FPW A;  2FTD A;  1KFU L;  2FYE A;  4QBB A;  1NPZ A;  1AU2 A;  4QH6 A;  2O6X A;  4YV8 A;  5JA7 A;  3S3R A;  1KXR A;  1PXV A;  3IOQ A;  4RY2 A;  3MHH A;  4RF1 A;  1PE6 A;  3IUT A;  1VJV A;  1MHW A;  4W5C A;  4BSQ A;  4BPV A;  2CIO A;  1Y08 A;  3WXF A;  3LFY A;  5KO3 A;  1F2A A;  3AI8 A;  4CDE B;  4Q8H A;  3MTN A;  2F7D A;  1DKI A;  4XUI A;  5K16 A;  3MP2 A;  2G8J A;  2P86 A;  3PRM A;  3KSE A;  1PCI A;  2H7J A;  3K9M A;  2DC7 A;  2R9C A;  2FUD A;  4HXD B;  2HD5 A;  1BQI A;  3OQC A;  1EWP A;  3M99 A;  2YJC A;  1MDW A;  3OF9 A;  3QJ3 A;  2B1M A;  2BDL A;  2C0Y A;  1THE A;  3PHW A;  2XU3 A;  1STF E;  1ME3 A;  1QOL A;  2AUZ A;  3QSD A;  4AXL A;  4X6I A;  2OP3 A;  2FQ9 A;  1F2C A;  4YYV A;  5JH3 A;  3HHA A;  3PHU A;  2HWK A;  3N4C A;  3N3G A;  4YVA A;  1KHQ A;  1U9X A;  3BY4 A;  4N4Z A;  3BBA A;  1EWO A;  2R9N A;  3H89 A;  3KFQ A;  1CPJ A;  3U8E A;  2DCA A;  2YJ2 A;  1AU4 A;  3PBH A;  1AU0 A;  7PCK A;  2UZJ A;  2G6D A;  3F5V A;  1XKG A;  3OF8 A;  2G8E A;  3KWZ A;  3OVZ A;  3H8C A;  2P7U A;  1AYU A;  2WBF X;  3H7D A;  2VHF A;  3MHS A;  3PHX A;  4YYQ A;  3DF0 A;  4MZS A;  4PAD A;  1M6D A;  4BOU A;  1PPO A;  5EF4 A;  4ZUX U;  4CDC B;  2PBH A;  3BPF A;  3IEJ A;  4BOS A;  4Q8G A;  3TNX A;  2JTC A;  1DEU A;  4M0W A;  4P16 A;  2E03 A;  1BGO A;  2F1G A;  1MIR A;  1ITO A;  1AIM A;  3C9E A;  1PAD A;  3IFU A;  4I07 A;  1MEG A;  1PPP A;  1NQC A;  2Y5B A;  4WA6 A;  4CZW A;  1GEC E;  4WUR A;  4IP3 A;  4BOQ A;  2DZZ A;  3TMP A;  1NL6 A;  2Y6E A;  1HUC B;  3MOR A;  3P5W A;  1U5I A;  3TRK A;  4R3D A;  1F2B A;  4FJC A;  1S4V A;  1UKF A;  2DCD A;  1AU3 A;  3KWB X;  5CVO B;  3KW9 A;  3PT2 A;  2BU3 A;  1U9W A;  3KKU A;  2JQG R;  2IPP B;  1TLO A;  2DCC A;  3S3Q A;  3IHP A;  1JQP A;  2ATO A;  4AXM A;  2GHU A;  4XR7 A;  2FRA A;  3I3T A;  5CVM A;  4X6J A;  2PNS A;  3H6S A;  2PRE A;  1MEM A;  5A24 A;  2AU1 A;  4PP2 E;  4RKX A;  3BPM A;  4P6E A;  8PCH A;  2XU4 A;  4OVZ B;  4DMX A;  4HWY A;  1YZB A;  2AVW A;  5CVN B;  1CS8 A;  5CHV A;  1IWD A;  2DCB A;  2OUL A;  3CH2 X;  2NQD B;  2R6N A;  3MJ5 A;  1O0E A;  4I04 A;  1ZCM A;  2XU1 A;  3P5X A;  3O0U A;  1DF0 A;  4RNA A;  3N3K A;  1ZIV A;  1KFX L;  1PIP A;  1PVJ A;  1CTE A;  3O65 A;  3OVX A;  4CDD B;  1KHP A;  2DJF B;  2IBI A;  3K24 A;  4YYR A;  2NQA A;  2HH5 A;  1AYW A;  3RVW A;  2DJG B;  2GFO A;  3W30 A;  5J94 A;  4OVZ A;  2FRQ A;  3CH3 X;  1AEC A;  4MI7 A;  3QT4 A;  3BOW A;  1NLJ A;  3KX1 A;  2R9F A;  4QRG A;  4N79 A;  2AUX A;  4D8I A;  3F75 A;  1TU6 A;  3BCN A;  3HD3 A;  3LXS A;  2AYN A;  4PT5 A;  3WXG A;  5E6J A;  2FO5 A;  5PAD A;  1TL9 A;  3USV A;  3ERV A;  3BB7 A;  4REZ A;  1FH0 A;  1POP A;  4QRV A;  3IV2 A;  4D8E A;  4MM3 B;  2P0R A;  4OEL A;  2VHS A;  3NHE A;  1U9V A;  3HWN A;  2YJB A;  5F02 A; 
#chains in the Genus database with same CATH homology
 9PAP A;  1GMY A;  3RVV A;  4QRX A;  4KLB A;  4W4U A;  4YYU A;  4BS5 A;  3CBJ A;  1PPN A;  3GCB A;  1QXP A;  4N8W A;  1EWM A;  2ACT A;  3CBK A;  1A6R A;  3IMA A;  4FIP A;  1CSB B;  1K3B B;  2ARY A;  1EF7 A;  1PPD A;  3HHI A;  4C5P A;  2DC6 A;  1F29 A;  1SP4 B;  3K8U A;  4BS6 A;  2R9M A;  2AIM A;  2YJ8 A;  4MSX A;  1CQD A;  1CJL A;  4P6G A;  3ZUA A;  1YVB A;  2PAD A;  2E02 A;  4MZO A;  4YYW A;  3B79 A;  2NQI A;  3I06 A;  1GCB A;  1PBH A;  3O1G A;  2E00 A;  2HXZ A;  5EGW A;  1Y4H A;  1NB3 A;  3P5U A;  3D6S A;  1AYV A;  1Q6K A;  4BQV A;  2JQF R;  1CVZ A;  1GLO A;  4OEM A;  1BY8 A;  3V6E A;  1VSN A;  1CB5 A;  3PDF A;  3BWK A;  1YK7 A;  3PNR A;  2HHN A;  1EWL A;  1U9Q X;  2NQG A;  3P5V A;  3E1Z B;  1X9Y A;  1ME4 A;  1YAL A;  3OIS A;  4X6H A;  3WXE A;  4YYS A;  2FT2 A;  4G54 A;  1QDQ A;  4BGF A;  4CDF B;  2CB5 A;  2DZY A;  1YT7 A;  3H8B A;  1MS6 A;  4W5B A;  3V6C A;  2E01 A;  2BDZ A;  4PI3 A;  4DMY A;  2YJ9 A;  4K7C A;  1QMY A;  6PAD A;  2G7Y A;  1YK8 A;  4I05 A;  2OZ2 A;  1NB5 A;  1CV8 A;  1BP4 A;  2DC9 A;  2AYO A;  2B1N A;  1SNK A;  1ICF A;  3RVX A;  4PP1 A;  1ATK A;  2AS8 A;  2XU5 A;  3BC3 A;  3PW3 A;  4FK5 A;  2R9O A;  2DC8 A;  5CHT A;  5FPW A;  2FTD A;  1KFU L;  2FYE A;  4QBB A;  1NPZ A;  1AU2 A;  4QH6 A;  2O6X A;  4NV8 A;  4YV8 A;  5JA7 A;  3S3R A;  1KXR A;  1PXV A;  3IOQ A;  4RY2 A;  3MHH A;  1PE6 A;  3IUT A;  1VJV A;  1MHW A;  4W5C A;  4BSQ A;  4BPV A;  2CIO A;  1Y08 A;  3WXF A;  3LFY A;  1F2A A;  2VFB A;  3AI8 A;  4CDE B;  4Q8H A;  3MTN A;  2F7D A;  4XUI A;  5K16 A;  2G8J A;  2P86 A;  3KSE A;  1GX3 A;  1PCI A;  2H7J A;  3K9M A;  2DC7 A;  2R9C A;  2FUD A;  2HD5 A;  1BQI A;  1EWP A;  3M99 A;  2YJC A;  1MDW A;  3OF9 A;  3QJ3 A;  2B1M A;  2BDL A;  2C0Y A;  1THE A;  1W6F A;  2XU3 A;  1STF E;  1ME3 A;  1QOL A;  2AUZ A;  3QSD A;  4AXL A;  4X6I A;  2OP3 A;  3D9W A;  2FQ9 A;  1F2C A;  4YYV A;  5JH3 A;  3HHA A;  4NV7 A;  3N4C A;  3N3G A;  1W4T A;  4YVA A;  1KHQ A;  1U9X A;  4N4Z A;  1EWO A;  2R9N A;  3H89 A;  3KFQ A;  1CPJ A;  3U8E A;  2DCA A;  2YJ2 A;  1AU4 A;  3PBH A;  1AU0 A;  7PCK A;  2G6D A;  3F5V A;  1XKG A;  2VFC A;  3OF8 A;  2G8E A;  3KWZ A;  3OVZ A;  3H8C A;  2P7U A;  1AYU A;  2WBF X;  3H7D A;  2VHF A;  3MHS A;  4YYQ A;  3DF0 A;  4MZS A;  4PAD A;  1M6D A;  1PPO A;  5EF4 A;  4ZUX U;  4CDC B;  2PBH A;  3BPF A;  3IEJ A;  4Q8G A;  3TNX A;  1DEU A;  2E03 A;  1BGO A;  2F1G A;  1MIR A;  1ITO A;  1AIM A;  3C9E A;  1PAD A;  4I07 A;  1MEG A;  1PPP A;  1NQC A;  2Y5B A;  4WA6 A;  4CZW A;  1GEC E;  2DZZ A;  1NL6 A;  2Y6E A;  1HUC B;  3MOR A;  3P5W A;  1U5I A;  1F2B A;  4FJC A;  1S4V A;  2DCD A;  1AU3 A;  3KWB X;  5CVO B;  3KW9 A;  1U9W A;  3KKU A;  2JQG R;  2IPP B;  1TLO A;  2DCC A;  3LTW A;  3S3Q A;  3IHP A;  1JQP A;  2ATO A;  4AXM A;  2GHU A;  4B55 A;  4XR7 A;  2FRA A;  3I3T A;  5CVM A;  4X6J A;  2PNS A;  3H6S A;  1E2T A;  2PRE A;  1MEM A;  5A24 A;  2AU1 A;  4PP2 E;  3BPM A;  4P6E A;  8PCH A;  2XU4 A;  4DMX A;  4HWY A;  2AVW A;  5CVN B;  1CS8 A;  5CHV A;  1IWD A;  2DCB A;  2OUL A;  3CH2 X;  2NQD B;  2R6N A;  1O0E A;  4I04 A;  1ZCM A;  2XU1 A;  3P5X A;  3O0U A;  2BSZ A;  1DF0 A;  3N3K A;  1ZIV A;  1KFX L;  1PIP A;  1CTE A;  3OVX A;  4CDD B;  1KHP A;  2DJF B;  2IBI A;  3K24 A;  4YYR A;  2NQA A;  2HH5 A;  1AYW A;  3RVW A;  2DJG B;  2GFO A;  5J94 A;  2FRQ A;  3CH3 X;  1AEC A;  3QT4 A;  3BOW A;  1NLJ A;  3KX1 A;  2R9F A;  4GUZ A;  4QRG A;  4N79 A;  2AUX A;  3F75 A;  1TU6 A;  3BCN A;  3HD3 A;  3LXS A;  2AYN A;  3WXG A;  2FO5 A;  5PAD A;  1TL9 A;  3USV A;  3ERV A;  1FH0 A;  1POP A;  1W5R A;  4QRV A;  3IV2 A;  2P0R A;  4OEL A;  2VHS A;  3NHE A;  1U9V A;  3HWN A;  2YJB A;  5F02 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...