1AU0A

Crystal structure of the cysteine protease human cathepsin k in complex with a covalent symmetric diacylaminomethyl ketone inhibitor
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
215
structure length
215
Chain Sequence
APDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CATHEPSIN K
publication title Structure and Design of Potent and Selective Cathepsin K Inhibitors
pubmed rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 59
structure length 215
sequence length 215
ec nomenclature ec 3.4.22.38: Cathepsin K.
pdb deposition date 1997-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1au0A00
1TU6A 1ME3A 1AU2A 3WXEA 4YYRA 3IV2A 1YT7A 2JQFR 4K7CA 4FK5A 1AU0A 2NQAA 3OF8A 2P0RA 5K16A 2PBHA 4PP2E 3PDFA 2B1MA 1AYWA 2NQGA 3PNRA 4DMXA 4CDDB 4WA6A 1F29A 3HWNA 2XU3A 1U9VA 1YALA 1PPNA 2AYOA 3OVZA 4PADA 3IHPA 2AUXA 2NQIA 4YYWA 5CVNB 3CBKA 4Q8GA 2DZZA 2DC6A 3F5VA 3MTNA 4HWYA 2PNSA 2E03A 2YJCA 2C0YA 3N3KA 1BY8A 2HH5A 5CVOB 1NQCA 3PW3A 3S3RA 9PAPA 4P6EA 3O0UA 3N4CA 3RVXA 1X9YA 8PCHA 1CB5A 4X6JA 1KFUL 2CB5A 2R9FA 3HHIA 2BDLA 5JA7A 2G8EA 4AXMA 4X6HA 1FH0A 2YJ8A 5A24A 2XU5A 1HUCB 2ACTA 3QSDA 3TNXA 2GFOA 3C9EA 3RVVA 3O1GA 1MIRA 1CS8A 2Y6EA 3DF0A 3S3QA 1AYVA 4W5CA 3E1ZB 4KLBA 1MEGA 4QRGA 2YJ9A 4X6IA 4BSQA 4YYVA 2DCAA 3H89A 3H7DA 5CVMA 2Y5BA 4QRXA 4BQVA 4YYSA 3V6CA 1PPDA 1S4VA 4MSXA 2FTDA 4BS5A 4YV8A 2PADA 1PBHA 1F2BA 2G6DA 3ERVA 4CZWA 2YJ2A 3LFYA 4MZSA 1ICFA 2JQGR 1ME4A 2O6XA 1TLOA 1YK8A 1ITOA 3K9MA 2FRAA 3ZUAA 2R9OA 3P5WA 1XKGA 4P6GA 1QOLA 5JH3A 1EWPA 3P5UA 3QJ3A 3CH3X 1EF7A 4RY2A 1O0EA 4XUIA 1MEMA 2F1GA 3HHAA 2AYNA 3IUTA 3USVA 4YYQA 3K24A 1CQDA 5J94A 1MDWA 3KKUA 3P5XA 1CTEA 2FUDA 1CSBB 4OELA 2AIMA 2HXZA 2E01A 1PE6A 4PP1A 3KWBX 3KWZA 1NLJA 2F7DA 3WXGA 1Q6KA 3I3TA 2G7YA 3K8UA 3N3GA 1IWDA 3MHHA 1KHPA 4YYUA 2FT2A 1GCBA 1SP4B 3B79A 2ARYA 2R9NA 4CDFB 1AIMA 1SNKA 5FPWA 1F2CA 2DC9A 3CH2X 1CV8A 1KHQA 2VHSA 2E02A 2DJGB 2DJFB 1BQIA 2AVWA 1POPA 4I05A 1PPPA 2HD5A 3IMAA 2P86A 1Y08A 3PBHA 2OP3A 1BGOA 4Q8HA 1VJVA 4PI3A 2DCCA 1JQPA 2XU4A 1VSNA 3OISA 2NQDB 1EWMA 2P7UA 3MHSA 4QBBA 4I07A 3HD3A 3H8BA 3IEJA 3BC3A 2OZ2A 3LXSA 3BOWA 4BPVA 4ZUXU 1PCIA 3MORA 1QDQA 4W4UA 1STFE 3H6SA 1NB5A 1K3BB 4YVAA 2DC8A 4N4ZA 3GCBA 2DCBA 1EWOA 1YK7A 7PCKA 1DF0A 2FRQA 3QT4A 1BP4A 2G8JA 5CHVA 3H8CA 5EGWA 1AU4A 3BWKA 1U9XA 3OF9A 2AS8A 2YJBA 4FIPA 1ATKA 1U5IA 2DZYA 3CBJA 1NL6A 4G54A 1U9QX 4N79A 1CJLA 4W5BA 2DC7A 1GMYA 4XR7A 4I04A 2R9CA 1Y4HA 3BPFA 1NB3A 5F02A 2AUZA 2WBFX 1DEUA 1AYUA 2E00A 2H7JA 1F2AA 3P5VA 2FYEA 4N8WA 2IBIA 1A6RA 4OEMA 3U8EA 1MS6A 2OULA 2XU1A 5PADA 3IOQA 1ZIVA 5CHTA 1MHWA 1QXPA 3KX1A 4MZOA 3F75A 3KSEA 3D6SA 1TL9A 2ATOA 3OVXA 4BS6A 3RVWA 1KXRA 3KW9A 1THEA 2IPPB 1AECA 1KFXL 1PPOA 2CIOA 4FJCA 1GLOA 1U9WA 5EF4A 1CVZA 1PIPA 2FQ9A 6PADA 2BDZA 4AXLA 2DCDA 2PREA 3V6EA 4QH6A 2HHNA 3I06A 1QMYA 1GECE 4DMYA 2B1NA 2R9MA 2AU1A 2R6NA 1AU3A 3BPMA 1CPJA 3WXFA 3NHEA 3BCNA 1EWLA 1NPZA 2GHUA 1PADA 2VHFA 4CDEB 4CDCB 3KFQA 1ZCMA 3M99A 1YVBA 1PXVA 1M6DA 4QRVA 2FO5A 3AI8A
chains in the Genus database with same CATH superfamily
1TU6A 1ME3A 1AU2A 3WXEA 4YYRA 3IV2A 1YT7A 2JQFR 4K7CA 4FK5A 1AU0A 2NQAA 3OF8A 2P0RA 5K16A 2PBHA 4PP2E 5E6JA 3PDFA 2B1MA 3MP2A 1AYWA 2NQGA 3PNRA 4IUMA 4DMXA 4CDDB 4WURA 4WA6A 1F29A 3HWNA 2XU3A 1DKIA 1U9VA 1YALA 1PPNA 4RNAA 2AYOA 3OVZA 4PADA 3IHPA 2AUXA 2NQIA 4YYWA 3B21A 5CVNB 3CBKA 4Q8GA 2DZZA 2DC6A 3F5VA 3MTNA 4HWYA 2PNSA 2E03A 2YJCA 2C0YA 3N3KA 1BY8A 2HH5A 5CVOB 1NQCA 3PW3A 3S3RA 9PAPA 3PHUA 4P6EA 2FE8A 3O0UA 3N4CA 3RVXA 1X9YA 8PCHA 4RF0A 1CB5A 4X6JA 1KFUL 2CB5A 2R9FA 3HHIA 2BDLA 5JA7A 2G8EA 4AXMA 3PHWA 4X6HA 1FH0A 2YJ8A 5A24A 2XU5A 1HUCB 2ACTA 3QSDA 3TNXA 2GFOA 3MTVA 1UKFA 4D8EA 3C9EA 3RVVA 3O1GA 1MIRA 4R3DA 1CS8A 2Y6EA 3DF0A 4RKXA 3S3QA 1AYVA 4W5CA 3E1ZB 4KLBA 1MEGA 4QRGA 4REZA 2BU3A 2YJ9A 4X6IA 4BSQA 4YYVA 2DCAA 3H89A 3H7DA 5CVMA 2Y5BA 4QRXA 4BQVA 4YYSA 3V6CA 1PPDA 1S4VA 4MSXA 2FTDA 4BS5A 4YV8A 2PADA 1PBHA 1F2BA 2G6DA 3ERVA 3W31A 4CZWA 2YJ2A 2HWKA 3LFYA 4MZSA 1ICFA 2JQGR 1ME4A 2O6XA 1TLOA 1YK8A 1ITOA 3K9MA 2FRAA 3ZUAA 2R9OA 4A5UA 3P5WA 1XKGA 2J7QC 4P6GA 2BTWB 4IP3A 1QOLA 5JH3A 1EWPA 3P5UA 3QJ3A 1PVJA 3CH3X 1EF7A 4RY2A 3TRKA 1O0EA 4XUIA 1YZBA 1MEMA 2F1GA 4OVZB 3HHAA 2AYNA 3IUTA 3USVA 4YYQA 3K24A 1CQDA 5J94A 1MDWA 3KKUA 3P5XA 4RF1A 3PHXA 1CTEA 2FUDA 1CSBB 4OELA 2AIMA 2HXZA 2E01A 1PE6A 3E9SA 4PP1A 3KWBX 3KWZA 1NLJA 2F7DA 5EZSA 1Q6KA 3WXGA 4MM3B 4P16A 3I3TA 2G7YA 3K8UA 3N3GA 1IWDA 3MHHA 1KHPA 4GUAA 4YYUA 2FT2A 1GCBA 1SP4B 3B79A 2ARYA 2R9NA 4CDFB 1AIMA 1SNKA 4BOZA 5FPWA 1F2CA 2DC9A 3CH2X 1CV8A 1KHQA 2VHSA 2UZJA 3W30A 2E02A 2DJGB 2DJFB 1BQIA 2AVWA 1POPA 4I05A 1PPPA 2HD5A 3IMAA 2P86A 3PSEA 3BB7A 1Y08A 3PBHA 4XZXA 3PRPA 2OP3A 3TMPA 1BGOA 4Q8HA 1VJVA 4PI3A 2DCCA 1JQPA 2XU4A 1VSNA 3OISA 4BOSA 2NQDB 1EWMA 2P7UA 3MHSA 4QBBA 4I07A 3HD3A 2BTWA 3H8BA 3IEJA 4M0WA 3BC3A 2OZ2A 3LXSA 2DOSA 3BOWA 4BPVA 4ZUXU 1PCIA 3MORA 1QDQA 4W4UA 1STFE 3H6SA 1NB5A 1K3BB 4YVAA 2DC8A 4N4ZA 3GCBA 4ZTBA 2DCBA 1EWOA 2JTCA 1YK7A 7PCKA 1DF0A 2J7QA 2FRQA 3QT4A 1BP4A 2G8JA 5CHVA 3H8CA 5EGWA 1AU4A 3BWKA 4MI7A 4D8BA 1U9XA 3OF9A 2AS8A 2YJBA 1ATKA 1U5IA 4FIPA 2DZYA 3CBJA 1NL6A 4G54A 1U9QX 4N79A 1CJLA 4W5BA 2DC7A 1GMYA 4XR7A 4I04A 2R9CA 1Y4HA 3BPFA 1NB3A 3BBAA 5F02A 2AUZA 2WBFX 1DEUA 1AYUA 2E00A 3IFUA 2H7JA 1F2AA 3P5VA 2FYEA 3PRMA 2Z84A 3PT2A 4N8WA 4BOUA 2IBIA 1A6RA 4OEMA 3U8EA 1MS6A 3MJ5A 2OULA 2XU1A 5PADA 3IOQA 1ZIVA 5CHTA 3ZNHA 4HXDB 1MHWA 1QXPA 5JZEA 3KX1A 4MZOA 3C0RA 3F75A 3KSEA 3D6SA 3BY4A 1TL9A 2ATOA 3OVXA 4BS6A 2AGAA 3RVWA 1KXRA 3KW9A 1THEA 2IPPB 1AECA 1KFXL 1PPOA 3OQCA 2CIOA 4FJCA 1GLOA 5EZQA 1U9WA 2JRIA 1CVZA 5EF4A 1PIPA 2FQ9A 6PADA 2BDZA 3RNVA 4BOQA 4AXLA 2DCDA 4BOPA 2PREA 3V6EA 4QH6A 2HHNA 3I06A 5KO3A 1QMYA 1GECE 4DMYA 2B1NA 2R9MA 2AU1A 2R6NA 4OVZA 1AU3A 4D8IA 3BPMA 1CPJA 4OW0A 3O65A 3WXFA 4PT5A 3NHEA 3BCNA 1EWLA 1NPZA 2GHUA 1PADA 2VHFA 4CDEB 4CDCB 3KFQA 1ZCMA 3M99A 1YVBA 1PXVA 1M6DA 4QRVA 2FO5A 3AI8A
chains in the Genus database with same CATH topology
1TU6A 1ME3A 1AU2A 3WXEA 4YYRA 3D9WA 3IV2A 1YT7A 2JQFR 4K7CA 4FK5A 1AU0A 2NQAA 3OF8A 2P0RA 5K16A 2PBHA 4PP2E 3PDFA 2B1MA 1AYWA 2NQGA 3PNRA 4DMXA 4CDDB 4WA6A 1F29A 3HWNA 2XU3A 1U9VA 1YALA 1PPNA 1W4TA 2AYOA 3OVZA 4PADA 3IHPA 2AUXA 2NQIA 4YYWA 5CVNB 3CBKA 4Q8GA 2DZZA 2DC6A 3F5VA 3MTNA 4HWYA 2PNSA 2E03A 2YJCA 2C0YA 3N3KA 1BY8A 2HH5A 5CVOB 1NQCA 3PW3A 3S3RA 9PAPA 4P6EA 3O0UA 3N4CA 3RVXA 1X9YA 4B55A 8PCHA 1CB5A 4X6JA 1KFUL 2CB5A 2R9FA 3HHIA 2BDLA 5JA7A 2G8EA 4AXMA 4X6HA 1FH0A 2YJ8A 5A24A 2XU5A 1HUCB 2ACTA 3QSDA 3TNXA 2GFOA 3C9EA 3RVVA 3O1GA 1MIRA 1CS8A 1E2TA 2Y6EA 3DF0A 3S3QA 1AYVA 4W5CA 3E1ZB 4KLBA 1MEGA 4QRGA 2YJ9A 4X6IA 4BSQA 4YYVA 2DCAA 3H89A 3H7DA 5CVMA 2Y5BA 4QRXA 4BQVA 4YYSA 3V6CA 1PPDA 1S4VA 4BGFA 4MSXA 2FTDA 4BS5A 4YV8A 2PADA 1PBHA 1F2BA 2G6DA 3ERVA 4CZWA 2YJ2A 3LFYA 4MZSA 1ICFA 2JQGR 1ME4A 2O6XA 1TLOA 1YK8A 1ITOA 3K9MA 2FRAA 3ZUAA 2R9OA 3P5WA 1XKGA 4P6GA 1QOLA 5JH3A 1EWPA 3P5UA 3QJ3A 3CH3X 1EF7A 4RY2A 1O0EA 4XUIA 1MEMA 2F1GA 3HHAA 2AYNA 3IUTA 3USVA 4YYQA 3K24A 1CQDA 5J94A 1MDWA 3KKUA 3P5XA 1CTEA 2FUDA 1CSBB 4OELA 2AIMA 2HXZA 2E01A 1PE6A 2VFBA 4PP1A 3KWBX 3KWZA 1NLJA 2F7DA 3WXGA 1Q6KA 3I3TA 2G7YA 3K8UA 3N3GA 1IWDA 3MHHA 1KHPA 4YYUA 2FT2A 1GCBA 1SP4B 3B79A 2ARYA 2R9NA 4CDFB 1AIMA 1GX3A 1SNKA 5FPWA 1F2CA 2DC9A 3CH2X 1CV8A 4GUZA 1KHQA 2VHSA 2E02A 2DJGB 2DJFB 1BQIA 2AVWA 1POPA 4I05A 1PPPA 2HD5A 3IMAA 2P86A 1Y08A 3PBHA 2OP3A 1BGOA 4Q8HA 1VJVA 4PI3A 2DCCA 1JQPA 2XU4A 1VSNA 3OISA 2NQDB 1EWMA 2P7UA 3MHSA 4QBBA 4I07A 3HD3A 3H8BA 3IEJA 3BC3A 2OZ2A 3LXSA 3BOWA 4BPVA 4ZUXU 1PCIA 2VFCA 3MORA 1QDQA 4W4UA 1STFE 3H6SA 1NB5A 1K3BB 4YVAA 2DC8A 4N4ZA 3GCBA 2DCBA 1EWOA 1YK7A 7PCKA 1DF0A 2FRQA 3QT4A 1BP4A 2G8JA 5CHVA 3H8CA 5EGWA 1AU4A 3BWKA 1W5RA 1W6FA 1U9XA 3OF9A 2AS8A 2YJBA 4FIPA 1ATKA 1U5IA 2DZYA 3CBJA 1NL6A 4G54A 1U9QX 4N79A 1CJLA 4W5BA 2DC7A 1GMYA 4XR7A 4NV7A 4I04A 2R9CA 1Y4HA 3BPFA 1NB3A 5F02A 2AUZA 2WBFX 1DEUA 1AYUA 2E00A 2H7JA 1F2AA 3P5VA 2FYEA 4N8WA 2IBIA 1A6RA 2BSZA 4OEMA 3U8EA 1MS6A 2OULA 2XU1A 5PADA 3IOQA 1ZIVA 5CHTA 1MHWA 1QXPA 3KX1A 4MZOA 3F75A 3KSEA 3D6SA 1TL9A 2ATOA 3OVXA 4BS6A 3LTWA 3RVWA 1KXRA 3KW9A 1THEA 4C5PA 2IPPB 1AECA 1KFXL 1PPOA 2CIOA 4FJCA 1GLOA 1U9WA 5EF4A 1CVZA 1PIPA 2FQ9A 6PADA 2BDZA 4AXLA 2DCDA 2PREA 3V6EA 4QH6A 2HHNA 3I06A 1QMYA 1GECE 4DMYA 2B1NA 2R9MA 2AU1A 4NV8A 2R6NA 1AU3A 3BPMA 1CPJA 3WXFA 3NHEA 3BCNA 1EWLA 1NPZA 2GHUA 1PADA 2VHFA 4CDEB 4CDCB 3KFQA 1ZCMA 3M99A 1YVBA 1PXVA 1M6DA 4QRVA 2FO5A 3AI8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TU6 A;  1ME3 A;  1AU2 A;  3WXE A;  4YYR A;  3IV2 A;  1YT7 A;  2JQF R;  4K7C A;  4FK5 A;  1AU0 A;  2NQA A;  3OF8 A;  2P0R A;  5K16 A;  2PBH A;  4PP2 E;  3PDF A;  2B1M A;  1AYW A;  2NQG A;  3PNR A;  4DMX A;  4CDD B;  4WA6 A;  1F29 A;  3HWN A;  2XU3 A;  1U9V A;  1YAL A;  1PPN A;  2AYO A;  3OVZ A;  4PAD A;  3IHP A;  2AUX A;  2NQI A;  4YYW A;  5CVN B;  3CBK A;  4Q8G A;  2DZZ A;  2DC6 A;  3F5V A;  3MTN A;  4HWY A;  2PNS A;  2E03 A;  2YJC A;  2C0Y A;  3N3K A;  1BY8 A;  2HH5 A;  5CVO B;  1NQC A;  3PW3 A;  3S3R A;  9PAP A;  4P6E A;  3O0U A;  3N4C A;  3RVX A;  1X9Y A;  8PCH A;  1CB5 A;  4X6J A;  1KFU L;  2CB5 A;  2R9F A;  3HHI A;  2BDL A;  5JA7 A;  2G8E A;  4AXM A;  4X6H A;  1FH0 A;  2YJ8 A;  5A24 A;  2XU5 A;  1HUC B;  2ACT A;  3QSD A;  3TNX A;  2GFO A;  3C9E A;  3RVV A;  3O1G A;  1MIR A;  1CS8 A;  2Y6E A;  3DF0 A;  3S3Q A;  1AYV A;  4W5C A;  3E1Z B;  4KLB A;  1MEG A;  4QRG A;  2YJ9 A;  4X6I A;  4BSQ A;  4YYV A;  2DCA A;  3H89 A;  3H7D A;  5CVM A;  2Y5B A;  4QRX A;  4BQV A;  4YYS A;  3V6C A;  1PPD A;  1S4V A;  4MSX A;  2FTD A;  4BS5 A;  4YV8 A;  2PAD A;  1PBH A;  1F2B A;  2G6D A;  3ERV A;  4CZW A;  2YJ2 A;  3LFY A;  4MZS A;  1ICF A;  2JQG R;  1ME4 A;  2O6X A;  1TLO A;  1YK8 A;  1ITO A;  3K9M A;  2FRA A;  3ZUA A;  2R9O A;  3P5W A;  1XKG A;  4P6G A;  1QOL A;  5JH3 A;  1EWP A;  3P5U A;  3QJ3 A;  3CH3 X;  1EF7 A;  4RY2 A;  1O0E A;  4XUI A;  1MEM A;  2F1G A;  3HHA A;  2AYN A;  3IUT A;  3USV A;  4YYQ A;  3K24 A;  1CQD A;  5J94 A;  1MDW A;  3KKU A;  3P5X A;  1CTE A;  2FUD A;  1CSB B;  4OEL A;  2AIM A;  2HXZ A;  2E01 A;  1PE6 A;  4PP1 A;  3KWB X;  3KWZ A;  1NLJ A;  2F7D A;  3WXG A;  1Q6K A;  3I3T A;  2G7Y A;  3K8U A;  3N3G A;  1IWD A;  3MHH A;  1KHP A;  4YYU A;  2FT2 A;  1GCB A;  1SP4 B;  3B79 A;  2ARY A;  2R9N A;  4CDF B;  1AIM A;  1SNK A;  5FPW A;  1F2C A;  2DC9 A;  3CH2 X;  1CV8 A;  1KHQ A;  2VHS A;  2E02 A;  2DJG B;  2DJF B;  1BQI A;  2AVW A;  1POP A;  4I05 A;  1PPP A;  2HD5 A;  3IMA A;  2P86 A;  1Y08 A;  3PBH A;  2OP3 A;  1BGO A;  4Q8H A;  1VJV A;  4PI3 A;  2DCC A;  1JQP A;  2XU4 A;  1VSN A;  3OIS A;  2NQD B;  1EWM A;  2P7U A;  3MHS A;  4QBB A;  4I07 A;  3HD3 A;  3H8B A;  3IEJ A;  3BC3 A;  2OZ2 A;  3LXS A;  3BOW A;  4BPV A;  4ZUX U;  1PCI A;  3MOR A;  1QDQ A;  4W4U A;  1STF E;  3H6S A;  1NB5 A;  1K3B B;  4YVA A;  2DC8 A;  4N4Z A;  3GCB A;  2DCB A;  1EWO A;  1YK7 A;  7PCK A;  1DF0 A;  2FRQ A;  3QT4 A;  1BP4 A;  2G8J A;  5CHV A;  3H8C A;  5EGW A;  1AU4 A;  3BWK A;  1U9X A;  3OF9 A;  2AS8 A;  2YJB A;  4FIP A;  1ATK A;  1U5I A;  2DZY A;  3CBJ A;  1NL6 A;  4G54 A;  1U9Q X;  4N79 A;  1CJL A;  4W5B A;  2DC7 A;  1GMY A;  4XR7 A;  4I04 A;  2R9C A;  1Y4H A;  3BPF A;  1NB3 A;  5F02 A;  2AUZ A;  2WBF X;  1DEU A;  1AYU A;  2E00 A;  2H7J A;  1F2A A;  3P5V A;  2FYE A;  4N8W A;  2IBI A;  1A6R A;  4OEM A;  3U8E A;  1MS6 A;  2OUL A;  2XU1 A;  5PAD A;  3IOQ A;  1ZIV A;  5CHT A;  1MHW A;  1QXP A;  3KX1 A;  4MZO A;  3F75 A;  3KSE A;  3D6S A;  1TL9 A;  2ATO A;  3OVX A;  4BS6 A;  3RVW A;  1KXR A;  3KW9 A;  1THE A;  2IPP B;  1AEC A;  1KFX L;  1PPO A;  2CIO A;  4FJC A;  1GLO A;  1U9W A;  5EF4 A;  1CVZ A;  1PIP A;  2FQ9 A;  6PAD A;  2BDZ A;  4AXL A;  2DCD A;  2PRE A;  3V6E A;  4QH6 A;  2HHN A;  3I06 A;  1QMY A;  1GEC E;  4DMY A;  2B1N A;  2R9M A;  2AU1 A;  2R6N A;  1AU3 A;  3BPM A;  1CPJ A;  3WXF A;  3NHE A;  3BCN A;  1EWL A;  1NPZ A;  2GHU A;  1PAD A;  2VHF A;  4CDE B;  4CDC B;  3KFQ A;  1ZCM A;  3M99 A;  1YVB A;  1PXV A;  1M6D A;  4QRV A;  2FO5 A;  3AI8 A; 
#chains in the Genus database with same CATH topology
 1TU6 A;  1ME3 A;  1AU2 A;  3WXE A;  4YYR A;  3IV2 A;  1YT7 A;  2JQF R;  4K7C A;  4FK5 A;  1AU0 A;  2NQA A;  3OF8 A;  2P0R A;  5K16 A;  2PBH A;  4PP2 E;  5E6J A;  3PDF A;  2B1M A;  3MP2 A;  1AYW A;  2NQG A;  3PNR A;  4IUM A;  4DMX A;  4CDD B;  4WUR A;  4WA6 A;  1F29 A;  3HWN A;  2XU3 A;  1DKI A;  1U9V A;  1YAL A;  1PPN A;  4RNA A;  2AYO A;  3OVZ A;  4PAD A;  3IHP A;  2AUX A;  2NQI A;  4YYW A;  3B21 A;  5CVN B;  3CBK A;  4Q8G A;  2DZZ A;  2DC6 A;  3F5V A;  3MTN A;  4HWY A;  2PNS A;  2E03 A;  2YJC A;  2C0Y A;  3N3K A;  1BY8 A;  2HH5 A;  5CVO B;  1NQC A;  3PW3 A;  3S3R A;  9PAP A;  3PHU A;  4P6E A;  2FE8 A;  3O0U A;  3N4C A;  3RVX A;  1X9Y A;  8PCH A;  4RF0 A;  1CB5 A;  4X6J A;  1KFU L;  2CB5 A;  2R9F A;  3HHI A;  2BDL A;  5JA7 A;  2G8E A;  4AXM A;  3PHW A;  4X6H A;  1FH0 A;  2YJ8 A;  5A24 A;  2XU5 A;  1HUC B;  2ACT A;  3QSD A;  3TNX A;  2GFO A;  3MTV A;  1UKF A;  4D8E A;  3C9E A;  3RVV A;  3O1G A;  1MIR A;  4R3D A;  1CS8 A;  2Y6E A;  3DF0 A;  4RKX A;  3S3Q A;  1AYV A;  4W5C A;  3E1Z B;  4KLB A;  1MEG A;  4QRG A;  4REZ A;  2BU3 A;  2YJ9 A;  4X6I A;  4BSQ A;  4YYV A;  2DCA A;  3H89 A;  3H7D A;  5CVM A;  2Y5B A;  4QRX A;  4BQV A;  4YYS A;  3V6C A;  1PPD A;  1S4V A;  4MSX A;  2FTD A;  4BS5 A;  4YV8 A;  2PAD A;  1PBH A;  1F2B A;  2G6D A;  3ERV A;  3W31 A;  4CZW A;  2YJ2 A;  2HWK A;  3LFY A;  4MZS A;  1ICF A;  2JQG R;  1ME4 A;  2O6X A;  1TLO A;  1YK8 A;  1ITO A;  3K9M A;  2FRA A;  3ZUA A;  2R9O A;  4A5U A;  3P5W A;  1XKG A;  2J7Q C;  4P6G A;  2BTW B;  4IP3 A;  1QOL A;  5JH3 A;  1EWP A;  3P5U A;  3QJ3 A;  1PVJ A;  3CH3 X;  1EF7 A;  4RY2 A;  3TRK A;  1O0E A;  4XUI A;  1YZB A;  1MEM A;  2F1G A;  4OVZ B;  3HHA A;  2AYN A;  3IUT A;  3USV A;  4YYQ A;  3K24 A;  1CQD A;  5J94 A;  1MDW A;  3KKU A;  3P5X A;  4RF1 A;  3PHX A;  1CTE A;  2FUD A;  1CSB B;  4OEL A;  2AIM A;  2HXZ A;  2E01 A;  1PE6 A;  3E9S A;  4PP1 A;  3KWB X;  3KWZ A;  1NLJ A;  2F7D A;  5EZS A;  1Q6K A;  3WXG A;  4MM3 B;  4P16 A;  3I3T A;  2G7Y A;  3K8U A;  3N3G A;  1IWD A;  3MHH A;  1KHP A;  4GUA A;  4YYU A;  2FT2 A;  1GCB A;  1SP4 B;  3B79 A;  2ARY A;  2R9N A;  4CDF B;  1AIM A;  1SNK A;  4BOZ A;  5FPW A;  1F2C A;  2DC9 A;  3CH2 X;  1CV8 A;  1KHQ A;  2VHS A;  2UZJ A;  3W30 A;  2E02 A;  2DJG B;  2DJF B;  1BQI A;  2AVW A;  1POP A;  4I05 A;  1PPP A;  2HD5 A;  3IMA A;  2P86 A;  3PSE A;  3BB7 A;  1Y08 A;  3PBH A;  4XZX A;  3PRP A;  2OP3 A;  3TMP A;  1BGO A;  4Q8H A;  1VJV A;  4PI3 A;  2DCC A;  1JQP A;  2XU4 A;  1VSN A;  3OIS A;  4BOS A;  2NQD B;  1EWM A;  2P7U A;  3MHS A;  4QBB A;  4I07 A;  3HD3 A;  2BTW A;  3H8B A;  3IEJ A;  4M0W A;  3BC3 A;  2OZ2 A;  3LXS A;  2DOS A;  3BOW A;  4BPV A;  4ZUX U;  1PCI A;  3MOR A;  1QDQ A;  4W4U A;  1STF E;  3H6S A;  1NB5 A;  1K3B B;  4YVA A;  2DC8 A;  4N4Z A;  3GCB A;  4ZTB A;  2DCB A;  1EWO A;  2JTC A;  1YK7 A;  7PCK A;  1DF0 A;  2J7Q A;  2FRQ A;  3QT4 A;  1BP4 A;  2G8J A;  5CHV A;  3H8C A;  5EGW A;  1AU4 A;  3BWK A;  4MI7 A;  4D8B A;  1U9X A;  3OF9 A;  2AS8 A;  2YJB A;  1ATK A;  1U5I A;  4FIP A;  2DZY A;  3CBJ A;  1NL6 A;  4G54 A;  1U9Q X;  4N79 A;  1CJL A;  4W5B A;  2DC7 A;  1GMY A;  4XR7 A;  4I04 A;  2R9C A;  1Y4H A;  3BPF A;  1NB3 A;  3BBA A;  5F02 A;  2AUZ A;  2WBF X;  1DEU A;  1AYU A;  2E00 A;  3IFU A;  2H7J A;  1F2A A;  3P5V A;  2FYE A;  3PRM A;  2Z84 A;  3PT2 A;  4N8W A;  4BOU A;  2IBI A;  1A6R A;  4OEM A;  3U8E A;  1MS6 A;  3MJ5 A;  2OUL A;  2XU1 A;  5PAD A;  3IOQ A;  1ZIV A;  5CHT A;  3ZNH A;  4HXD B;  1MHW A;  1QXP A;  5JZE A;  3KX1 A;  4MZO A;  3C0R A;  3F75 A;  3KSE A;  3D6S A;  3BY4 A;  1TL9 A;  2ATO A;  3OVX A;  4BS6 A;  2AGA A;  3RVW A;  1KXR A;  3KW9 A;  1THE A;  2IPP B;  1AEC A;  1KFX L;  1PPO A;  3OQC A;  2CIO A;  4FJC A;  1GLO A;  5EZQ A;  1U9W A;  2JRI A;  1CVZ A;  5EF4 A;  1PIP A;  2FQ9 A;  6PAD A;  2BDZ A;  3RNV A;  4BOQ A;  4AXL A;  2DCD A;  4BOP A;  2PRE A;  3V6E A;  4QH6 A;  2HHN A;  3I06 A;  5KO3 A;  1QMY A;  1GEC E;  4DMY A;  2B1N A;  2R9M A;  2AU1 A;  2R6N A;  4OVZ A;  1AU3 A;  4D8I A;  3BPM A;  1CPJ A;  4OW0 A;  3O65 A;  3WXF A;  4PT5 A;  3NHE A;  3BCN A;  1EWL A;  1NPZ A;  2GHU A;  1PAD A;  2VHF A;  4CDE B;  4CDC B;  3KFQ A;  1ZCM A;  3M99 A;  1YVB A;  1PXV A;  1M6D A;  4QRV A;  2FO5 A;  3AI8 A; 
#chains in the Genus database with same CATH homology
 1TU6 A;  1ME3 A;  1AU2 A;  3WXE A;  4YYR A;  3D9W A;  3IV2 A;  1YT7 A;  2JQF R;  4K7C A;  4FK5 A;  1AU0 A;  2NQA A;  3OF8 A;  2P0R A;  5K16 A;  2PBH A;  4PP2 E;  3PDF A;  2B1M A;  1AYW A;  2NQG A;  3PNR A;  4DMX A;  4CDD B;  4WA6 A;  1F29 A;  3HWN A;  2XU3 A;  1U9V A;  1YAL A;  1PPN A;  1W4T A;  2AYO A;  3OVZ A;  4PAD A;  3IHP A;  2AUX A;  2NQI A;  4YYW A;  5CVN B;  3CBK A;  4Q8G A;  2DZZ A;  2DC6 A;  3F5V A;  3MTN A;  4HWY A;  2PNS A;  2E03 A;  2YJC A;  2C0Y A;  3N3K A;  1BY8 A;  2HH5 A;  5CVO B;  1NQC A;  3PW3 A;  3S3R A;  9PAP A;  4P6E A;  3O0U A;  3N4C A;  3RVX A;  1X9Y A;  4B55 A;  8PCH A;  1CB5 A;  4X6J A;  1KFU L;  2CB5 A;  2R9F A;  3HHI A;  2BDL A;  5JA7 A;  2G8E A;  4AXM A;  4X6H A;  1FH0 A;  2YJ8 A;  5A24 A;  2XU5 A;  1HUC B;  2ACT A;  3QSD A;  3TNX A;  2GFO A;  3C9E A;  3RVV A;  3O1G A;  1MIR A;  1CS8 A;  1E2T A;  2Y6E A;  3DF0 A;  3S3Q A;  1AYV A;  4W5C A;  3E1Z B;  4KLB A;  1MEG A;  4QRG A;  2YJ9 A;  4X6I A;  4BSQ A;  4YYV A;  2DCA A;  3H89 A;  3H7D A;  5CVM A;  2Y5B A;  4QRX A;  4BQV A;  4YYS A;  3V6C A;  1PPD A;  1S4V A;  4BGF A;  4MSX A;  2FTD A;  4BS5 A;  4YV8 A;  2PAD A;  1PBH A;  1F2B A;  2G6D A;  3ERV A;  4CZW A;  2YJ2 A;  3LFY A;  4MZS A;  1ICF A;  2JQG R;  1ME4 A;  2O6X A;  1TLO A;  1YK8 A;  1ITO A;  3K9M A;  2FRA A;  3ZUA A;  2R9O A;  3P5W A;  1XKG A;  4P6G A;  1QOL A;  5JH3 A;  1EWP A;  3P5U A;  3QJ3 A;  3CH3 X;  1EF7 A;  4RY2 A;  1O0E A;  4XUI A;  1MEM A;  2F1G A;  3HHA A;  2AYN A;  3IUT A;  3USV A;  4YYQ A;  3K24 A;  1CQD A;  5J94 A;  1MDW A;  3KKU A;  3P5X A;  1CTE A;  2FUD A;  1CSB B;  4OEL A;  2AIM A;  2HXZ A;  2E01 A;  1PE6 A;  2VFB A;  4PP1 A;  3KWB X;  3KWZ A;  1NLJ A;  2F7D A;  3WXG A;  1Q6K A;  3I3T A;  2G7Y A;  3K8U A;  3N3G A;  1IWD A;  3MHH A;  1KHP A;  4YYU A;  2FT2 A;  1GCB A;  1SP4 B;  3B79 A;  2ARY A;  2R9N A;  4CDF B;  1AIM A;  1GX3 A;  1SNK A;  5FPW A;  1F2C A;  2DC9 A;  3CH2 X;  1CV8 A;  4GUZ A;  1KHQ A;  2VHS A;  2E02 A;  2DJG B;  2DJF B;  1BQI A;  2AVW A;  1POP A;  4I05 A;  1PPP A;  2HD5 A;  3IMA A;  2P86 A;  1Y08 A;  3PBH A;  2OP3 A;  1BGO A;  4Q8H A;  1VJV A;  4PI3 A;  2DCC A;  1JQP A;  2XU4 A;  1VSN A;  3OIS A;  2NQD B;  1EWM A;  2P7U A;  3MHS A;  4QBB A;  4I07 A;  3HD3 A;  3H8B A;  3IEJ A;  3BC3 A;  2OZ2 A;  3LXS A;  3BOW A;  4BPV A;  4ZUX U;  1PCI A;  2VFC A;  3MOR A;  1QDQ A;  4W4U A;  1STF E;  3H6S A;  1NB5 A;  1K3B B;  4YVA A;  2DC8 A;  4N4Z A;  3GCB A;  2DCB A;  1EWO A;  1YK7 A;  7PCK A;  1DF0 A;  2FRQ A;  3QT4 A;  1BP4 A;  2G8J A;  5CHV A;  3H8C A;  5EGW A;  1AU4 A;  3BWK A;  1W5R A;  1W6F A;  1U9X A;  3OF9 A;  2AS8 A;  2YJB A;  4FIP A;  1ATK A;  1U5I A;  2DZY A;  3CBJ A;  1NL6 A;  4G54 A;  1U9Q X;  4N79 A;  1CJL A;  4W5B A;  2DC7 A;  1GMY A;  4XR7 A;  4NV7 A;  4I04 A;  2R9C A;  1Y4H A;  3BPF A;  1NB3 A;  5F02 A;  2AUZ A;  2WBF X;  1DEU A;  1AYU A;  2E00 A;  2H7J A;  1F2A A;  3P5V A;  2FYE A;  4N8W A;  2IBI A;  1A6R A;  2BSZ A;  4OEM A;  3U8E A;  1MS6 A;  2OUL A;  2XU1 A;  5PAD A;  3IOQ A;  1ZIV A;  5CHT A;  1MHW A;  1QXP A;  3KX1 A;  4MZO A;  3F75 A;  3KSE A;  3D6S A;  1TL9 A;  2ATO A;  3OVX A;  4BS6 A;  3LTW A;  3RVW A;  1KXR A;  3KW9 A;  1THE A;  4C5P A;  2IPP B;  1AEC A;  1KFX L;  1PPO A;  2CIO A;  4FJC A;  1GLO A;  1U9W A;  5EF4 A;  1CVZ A;  1PIP A;  2FQ9 A;  6PAD A;  2BDZ A;  4AXL A;  2DCD A;  2PRE A;  3V6E A;  4QH6 A;  2HHN A;  3I06 A;  1QMY A;  1GEC E;  4DMY A;  2B1N A;  2R9M A;  2AU1 A;  4NV8 A;  2R6N A;  1AU3 A;  3BPM A;  1CPJ A;  3WXF A;  3NHE A;  3BCN A;  1EWL A;  1NPZ A;  2GHU A;  1PAD A;  2VHF A;  4CDE B;  4CDC B;  3KFQ A;  1ZCM A;  3M99 A;  1YVB A;  1PXV A;  1M6D A;  4QRV A;  2FO5 A;  3AI8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...