1AU0A

Crystal structure of the cysteine protease human cathepsin k in complex with a covalent symmetric diacylaminomethyl ketone inhibitor
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
215
structure length
215
Chain Sequence
b'APDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CATHEPSIN K
publication title Structure and Design of Potent and Selective Cathepsin K Inhibitors
pubmed rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 59
structure length 215
sequence length 215
ec nomenclature ec 3.4.22.38: Cathepsin K.
pdb deposition date 1997-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1au0A00
3N3GA 3AI8A 3K8UA 3HD3A 1MEMA 4RY2A 2C0YA 2IPPB 3OF9A 4PI3A 3IMAA 1K3BB 1YK8A 3WXEA 3OISA 4YYUA 9PAPA 1NQCA 1BY8A 2DC9A 1GMYA 3I3TA 3P5WA 2XU5A 1CSBB 2YJ8A 1THEA 2YJCA 1KXRA 1EWMA 1QOLA 1ME4A 1MS6A 3MHSA 5F02A 3HHAA 2GFOA 2FT2A 2R9CA 1HUCB 1PCIA 2ACTA 3P5UA 1AU2A 2AYOA 3NHEA 1BGOA 2P0RA 3O0UA 2YJ2A 3KW9A 3CBKA 5J94A 1KFUL 1ICFA 4YV8A 3MORA 2P86A 4DMYA 3K24A 2CB5A 3BPMA 1KHPA 1CS8A 1TL9A 1YALA 1PPDA 2NQGA 3KX1A 3KWZA 1CV8A 1AU0A 4N4ZA 2NQIA 1MIRA 3H8BA 1VSNA 3S3QA 2G6DA 1GLOA 2E02A 1MDWA 2Y5BA 4CDFB 1Y4HA 2DCBA 1S4VA 2AIMA 1U9XA 3K9MA 5EGWA 2H7JA 2JQGR 2AUZA 1PXVA 4W4UA 2JQFR 2AVWA 2E01A 4CDEB 4XUIA 1QXPA 5JA7A 3DF0A 5CVOB 1NB5A 1EWOA 1PPNA 1POPA 2WBFX 1BQIA 1DEUA 1CJLA 3TNXA 1XKGA 2P7UA 1YVBA 1EWPA 3PW3A 1F2AA 2OP3A 1GCBA 1SNKA 3S3RA 3CH3X 2E00A 2FYEA 2OZ2A 2YJBA 3PBHA 2PADA 3LXSA 2DZYA 3OVZA 4I05A 2GHUA 4QRXA 4MZSA 3HHIA 1PBHA 2AU1A 1MEGA 2FO5A 1ME3A 2VHSA 4WA6A 2FQ9A 4BS6A 3KSEA 2YJ9A 2B1MA 1QMYA 4X6JA 2R9MA 4FIPA 1O0EA 5PADA 1U9WA 7PCKA 2FRAA 2XU4A 1KFXL 3KKUA 1IWDA 1NL6A 2AUXA 5JH3A 1PADA 3V6EA 1NLJA 2Y6EA 1JQPA 3LFYA 3OVXA 3CH2X 1STFE 1M6DA 2AYNA 8PCHA 3U8EA 2CIOA 4YYWA 4G54A 3ERVA 1SP4B 2ATOA 4W5BA 1Q6KA 4ZUXU 2G8EA 3H7DA 1EWLA 3RVXA 3V6CA 1CVZA 3KWBX 1PIPA 1F2CA 2DCAA 2R9FA 1AECA 2B1NA 1U5IA 1AYWA 4Q8HA 4QRVA 2BDLA 1DF0A 3WXFA 4BSQA 4I04A 4N8WA 2BDZA 1NPZA 1AYVA 1MHWA 4OEMA 1AU4A 2FUDA 4X6HA 2AS8A 1YK7A 3USVA 3B79A 1ATKA 4P6GA 4YYVA 2G7YA 2DC7A 3F5VA 1AIMA 4YVAA 2R6NA 5CHTA 1TLOA 3IHPA 3HWNA 1NB3A 3P5VA 3CBJA 2F1GA 3P5XA 3PNRA 3ZUAA 2HD5A 2PNSA 3H6SA 3PDFA 4FK5A 4KLBA 3C9EA 3I06A 2HXZA 5CHVA 4BQVA 3BOWA 4PP1A 5FPWA 3N4CA 5K16A 2DC6A 2DCCA 4MZOA 4YYQA 4FJCA 3N3KA 3F75A 2IBIA 5CVNB 2PREA 1ZIVA 3IEJA 4P6EA 3BC3A 1CPJA 4CDDB 3MHHA 4I07A 2R9OA 1AYUA 1Y08A 2XU1A 2DCDA 4OELA 2NQAA 4K7CA 2PBHA 4X6IA 4W5CA 1PPOA 3KFQA 2O6XA 3D6SA 3QJ3A 4QH6A 3H8CA 3H89A 3BPFA 1GECE 1FH0A 1BP4A 5CVMA 3M99A 2NQDB 4PP2E 2DJFB 1PPPA 1A6RA 1CB5A 4QRGA 2HH5A 2DZZA 2XU3A 2FRQA 3O1GA 3BWKA 3IOQA 5A24A 1AU3A 4XR7A 4N79A 1KHQA 4HWYA 3IV2A 4Q8GA 2DJGB 4AXLA 2FTDA 3BCNA 2E03A 4QBBA 6PADA 3E1ZB 1CTEA 1TU6A 4AXMA 2R9NA 4YYSA 1CQDA 3MTNA 2OULA 1F29A 4CZWA 2VHFA 2G8JA 3RVVA 4DMXA 4PADA 1VJVA 5EF4A 1PE6A 1X9YA 1QDQA 4YYRA 4BS5A 4MSXA 3QT4A 3GCBA 2ARYA 1EF7A 3WXGA 1F2BA 3IUTA 2F7DA 1ZCMA 4BPVA 2HHNA 3OF8A 3RVWA 1U9QX 1U9VA 1YT7A 3QSDA 1ITOA 4CDCB 2DC8A
chains in the Genus database with same CATH superfamily
3N3GA 3AI8A 4OVZA 3K8UA 3HD3A 3OQCA 4IP3A 1MEMA 4RY2A 2Z84A 2C0YA 2IPPB 3OF9A 4PI3A 3IMAA 1K3BB 1YK8A 3WXEA 3OISA 4YYUA 2BTWB 9PAPA 1NQCA 1BY8A 2DC9A 1GMYA 3I3TA 3P5WA 2XU5A 5KO3A 1CSBB 2YJ8A 3RNVA 1THEA 2YJCA 1KXRA 1EWMA 1QOLA 3TRKA 1ME4A 1MS6A 3MHSA 5F02A 3HHAA 2GFOA 2FT2A 2R9CA 1HUCB 1PCIA 2ACTA 3P5UA 1AU2A 2AYOA 3NHEA 1BGOA 2P0RA 3O0UA 2YJ2A 3KW9A 3CBKA 5J94A 1KFUL 1ICFA 4YV8A 3MORA 2P86A 3BB7A 4DMYA 3K24A 2CB5A 3BPMA 1KHPA 1CS8A 1TL9A 1YALA 1PPDA 2NQGA 3KX1A 1PVJA 3KWZA 1CV8A 1AU0A 3PSEA 3PRMA 4N4ZA 2NQIA 4GUAA 1MIRA 3H8BA 1VSNA 4RF0A 3S3QA 2G6DA 1GLOA 2E02A 1MDWA 2Y5BA 4CDFB 4OW0A 4XZXA 1Y4HA 2DCBA 1S4VA 2AIMA 1U9XA 3K9MA 5EGWA 2H7JA 2JQGR 2JRIA 2AUZA 1PXVA 4W4UA 2JQFR 2AVWA 2E01A 4CDEB 4XUIA 1QXPA 5JA7A 3DF0A 5CVOB 1NB5A 1EWOA 1PPNA 1POPA 2WBFX 1BQIA 5EZQA 1DEUA 1CJLA 3TNXA 1XKGA 2P7UA 1YVBA 1EWPA 3PW3A 1UKFA 2UZJA 1F2AA 3B21A 2OP3A 1GCBA 1SNKA 3S3RA 2BTWA 3MTVA 3CH3X 2E00A 2FYEA 2OZ2A 2YJBA 3PBHA 2PADA 3LXSA 2DZYA 4P16A 3OVZA 4I05A 2GHUA 3MJ5A 4QRXA 4MZSA 3HHIA 1PBHA 2AU1A 1MEGA 2FO5A 4BOSA 1ME3A 2VHSA 4WA6A 2FQ9A 4BS6A 3KSEA 2YJ9A 2B1MA 1QMYA 2DOSA 4RKXA 3IFUA 4X6JA 2R9MA 4FIPA 1O0EA 5PADA 4RF1A 1U9WA 2JTCA 7PCKA 2FRAA 2XU4A 3W30A 1KFXL 3KKUA 1IWDA 1NL6A 2AUXA 5JH3A 3MP2A 1PADA 3V6EA 4HXDB 1NLJA 2Y6EA 1JQPA 3LFYA 4RNAA 3OVXA 3CH2X 1STFE 1M6DA 2AYNA 8PCHA 3U8EA 2CIOA 4R3DA 4YYWA 4G54A 3ERVA 1SP4B 2ATOA 4W5BA 2FE8A 1Q6KA 5EZSA 4ZUXU 2G8EA 3H7DA 1EWLA 3RVXA 3V6CA 1CVZA 3KWBX 4IUMA 4A5UA 1PIPA 1F2CA 2DCAA 2R9FA 1AECA 2B1NA 2J7QA 1U5IA 4WURA 1AYWA 1YZBA 4Q8HA 4QRVA 2BDLA 1DF0A 3WXFA 2AGAA 4BOPA 1DKIA 3PHUA 3TMPA 3BBAA 4BSQA 4I04A 4N8WA 2BDZA 1NPZA 1AYVA 1MHWA 4OEMA 5E6JA 4ZTBA 1AU4A 2FUDA 4X6HA 3PRPA 2AS8A 3PHXA 1YK7A 3USVA 4REZA 3B79A 1ATKA 4MI7A 4P6GA 4YYVA 2G7YA 4D8IA 4D8EA 2DC7A 3C0RA 4BOZA 3F5VA 1AIMA 4YVAA 2R6NA 5CHTA 1TLOA 3IHPA 3HWNA 1NB3A 3P5VA 3CBJA 2F1GA 3P5XA 3PNRA 3ZUAA 2HD5A 2PNSA 2HWKA 3H6SA 3PDFA 4FK5A 4KLBA 3C9EA 3I06A 2J7QC 5JZEA 2HXZA 5CHVA 4BQVA 3BOWA 4PP1A 5FPWA 3N4CA 4BOUA 5K16A 2DC6A 2DCCA 4MZOA 4YYQA 4FJCA 3N3KA 3F75A 2IBIA 3BY4A 4OVZB 5CVNB 2PREA 1ZIVA 3IEJA 4P6EA 4BOQA 4MM3B 3BC3A 1CPJA 3E9SA 4CDDB 3MHHA 4I07A 2R9OA 1AYUA 1Y08A 2XU1A 2DCDA 4OELA 2NQAA 4K7CA 2PBHA 4X6IA 4W5CA 1PPOA 3KFQA 2O6XA 3D6SA 3QJ3A 4QH6A 3H8CA 3H89A 3BPFA 1GECE 1FH0A 1BP4A 5CVMA 3M99A 2NQDB 4PP2E 2DJFB 1PPPA 1A6RA 1CB5A 4QRGA 2HH5A 2DZZA 2XU3A 2FRQA 3O1GA 3BWKA 3IOQA 5A24A 1AU3A 4XR7A 4N79A 1KHQA 4HWYA 3IV2A 4Q8GA 2DJGB 4AXLA 2FTDA 3BCNA 2E03A 4QBBA 6PADA 3E1ZB 3PHWA 1CTEA 1TU6A 4AXMA 3W31A 2R9NA 4M0WA 4YYSA 1CQDA 3MTNA 2BU3A 2OULA 1F29A 4CZWA 2VHFA 2G8JA 3RVVA 4DMXA 4PADA 1VJVA 5EF4A 1PE6A 1X9YA 1QDQA 3PT2A 4YYRA 4BS5A 4MSXA 3QT4A 3GCBA 2ARYA 1EF7A 3WXGA 1F2BA 3IUTA 2F7DA 1ZCMA 4BPVA 3ZNHA 2HHNA 3OF8A 4PT5A 3RVWA 1U9QX 1U9VA 1YT7A 3QSDA 3O65A 1ITOA 4D8BA 4CDCB 2DC8A
chains in the Genus database with same CATH topology
3N3GA 3AI8A 3K8UA 3HD3A 1MEMA 4RY2A 2C0YA 2IPPB 3OF9A 4PI3A 3IMAA 1K3BB 1YK8A 3WXEA 3OISA 4YYUA 9PAPA 1NQCA 1BY8A 2DC9A 1GMYA 3I3TA 3P5WA 2XU5A 1CSBB 2YJ8A 1THEA 2YJCA 1KXRA 2VFCA 1EWMA 1QOLA 3LTWA 1ME4A 1MS6A 3MHSA 5F02A 3HHAA 2GFOA 2FT2A 2R9CA 1HUCB 1PCIA 2ACTA 3P5UA 1AU2A 2AYOA 3NHEA 1BGOA 2P0RA 3O0UA 2YJ2A 3KW9A 3CBKA 5J94A 2BSZA 1KFUL 1ICFA 4YV8A 3MORA 2P86A 4DMYA 3K24A 2CB5A 3BPMA 1KHPA 1CS8A 1TL9A 1YALA 1PPDA 2NQGA 3KX1A 3KWZA 1CV8A 1AU0A 4N4ZA 2NQIA 1MIRA 1W6FA 3H8BA 1VSNA 3S3QA 2G6DA 1GLOA 2E02A 1MDWA 2Y5BA 4CDFB 4B55A 1Y4HA 2DCBA 1S4VA 2AIMA 1U9XA 3K9MA 5EGWA 2H7JA 2JQGR 2AUZA 1PXVA 3D9WA 4W4UA 2JQFR 2AVWA 2E01A 4CDEB 4XUIA 1QXPA 5JA7A 3DF0A 5CVOB 1NB5A 1EWOA 1PPNA 1POPA 2WBFX 1BQIA 1DEUA 1CJLA 3TNXA 1XKGA 2P7UA 1YVBA 1EWPA 3PW3A 1F2AA 2OP3A 1GCBA 1SNKA 3S3RA 3CH3X 2E00A 2FYEA 2OZ2A 2YJBA 3PBHA 2PADA 3LXSA 2DZYA 3OVZA 4I05A 2GHUA 4QRXA 4MZSA 3HHIA 1PBHA 2AU1A 1MEGA 2FO5A 1ME3A 2VHSA 4WA6A 2FQ9A 4BS6A 3KSEA 2YJ9A 2B1MA 1GX3A 1QMYA 4C5PA 4X6JA 2R9MA 4GUZA 4FIPA 1O0EA 5PADA 1U9WA 7PCKA 2FRAA 2XU4A 1KFXL 3KKUA 1IWDA 4NV7A 1NL6A 2AUXA 5JH3A 1PADA 3V6EA 4BGFA 1NLJA 2Y6EA 1JQPA 3LFYA 3OVXA 3CH2X 1STFE 1M6DA 2AYNA 8PCHA 3U8EA 2CIOA 4YYWA 1W4TA 4G54A 3ERVA 1SP4B 2ATOA 4W5BA 1Q6KA 4ZUXU 2G8EA 3H7DA 1EWLA 3RVXA 3V6CA 1CVZA 3KWBX 1PIPA 1F2CA 2DCAA 2R9FA 1AECA 2B1NA 1U5IA 1AYWA 4Q8HA 1W5RA 4QRVA 2BDLA 1DF0A 3WXFA 4BSQA 4I04A 4N8WA 2BDZA 1NPZA 1AYVA 1MHWA 4OEMA 1AU4A 2FUDA 4X6HA 2AS8A 1YK7A 3USVA 3B79A 1ATKA 4P6GA 4YYVA 2G7YA 2DC7A 3F5VA 1AIMA 4YVAA 2R6NA 5CHTA 1TLOA 1E2TA 3IHPA 3HWNA 1NB3A 3P5VA 3CBJA 2F1GA 3P5XA 3PNRA 3ZUAA 2HD5A 2PNSA 3H6SA 3PDFA 4FK5A 4KLBA 3C9EA 3I06A 2HXZA 5CHVA 4BQVA 3BOWA 4PP1A 5FPWA 3N4CA 5K16A 2DC6A 2DCCA 4MZOA 4YYQA 4FJCA 3N3KA 3F75A 2IBIA 5CVNB 2PREA 1ZIVA 3IEJA 4P6EA 3BC3A 1CPJA 4CDDB 3MHHA 4I07A 2R9OA 1AYUA 1Y08A 2XU1A 2DCDA 4OELA 2NQAA 4K7CA 2PBHA 4X6IA 4W5CA 1PPOA 4NV8A 3KFQA 2O6XA 3D6SA 3QJ3A 4QH6A 3H8CA 3H89A 3BPFA 1GECE 1FH0A 1BP4A 5CVMA 3M99A 2NQDB 4PP2E 2DJFB 1PPPA 1A6RA 1CB5A 4QRGA 2HH5A 2DZZA 2XU3A 2FRQA 3O1GA 3BWKA 3IOQA 5A24A 1AU3A 4XR7A 4N79A 1KHQA 4HWYA 3IV2A 4Q8GA 2DJGB 4AXLA 2FTDA 3BCNA 2E03A 4QBBA 6PADA 3E1ZB 1CTEA 1TU6A 4AXMA 2R9NA 4YYSA 1CQDA 3MTNA 2OULA 1F29A 2VFBA 4CZWA 2VHFA 2G8JA 3RVVA 4DMXA 4PADA 1VJVA 5EF4A 1PE6A 1X9YA 1QDQA 4YYRA 4BS5A 4MSXA 3QT4A 3GCBA 2ARYA 1EF7A 3WXGA 1F2BA 3IUTA 2F7DA 1ZCMA 4BPVA 2HHNA 3OF8A 3RVWA 1U9QX 1U9VA 1YT7A 3QSDA 1ITOA 4CDCB 2DC8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N3G A;  3AI8 A;  3K8U A;  3HD3 A;  1MEM A;  4RY2 A;  2C0Y A;  2IPP B;  3OF9 A;  4PI3 A;  3IMA A;  1K3B B;  1YK8 A;  3WXE A;  3OIS A;  4YYU A;  9PAP A;  1NQC A;  1BY8 A;  2DC9 A;  1GMY A;  3I3T A;  3P5W A;  2XU5 A;  1CSB B;  2YJ8 A;  1THE A;  2YJC A;  1KXR A;  1EWM A;  1QOL A;  1ME4 A;  1MS6 A;  3MHS A;  5F02 A;  3HHA A;  2GFO A;  2FT2 A;  2R9C A;  1HUC B;  1PCI A;  2ACT A;  3P5U A;  1AU2 A;  2AYO A;  3NHE A;  1BGO A;  2P0R A;  3O0U A;  2YJ2 A;  3KW9 A;  3CBK A;  5J94 A;  1KFU L;  1ICF A;  4YV8 A;  3MOR A;  2P86 A;  4DMY A;  3K24 A;  2CB5 A;  3BPM A;  1KHP A;  1CS8 A;  1TL9 A;  1YAL A;  1PPD A;  2NQG A;  3KX1 A;  3KWZ A;  1CV8 A;  1AU0 A;  4N4Z A;  2NQI A;  1MIR A;  3H8B A;  1VSN A;  3S3Q A;  2G6D A;  1GLO A;  2E02 A;  1MDW A;  2Y5B A;  4CDF B;  1Y4H A;  2DCB A;  1S4V A;  2AIM A;  1U9X A;  3K9M A;  5EGW A;  2H7J A;  2JQG R;  2AUZ A;  1PXV A;  4W4U A;  2JQF R;  2AVW A;  2E01 A;  4CDE B;  4XUI A;  1QXP A;  5JA7 A;  3DF0 A;  5CVO B;  1NB5 A;  1EWO A;  1PPN A;  1POP A;  2WBF X;  1BQI A;  1DEU A;  1CJL A;  3TNX A;  1XKG A;  2P7U A;  1YVB A;  1EWP A;  3PW3 A;  1F2A A;  2OP3 A;  1GCB A;  1SNK A;  3S3R A;  3CH3 X;  2E00 A;  2FYE A;  2OZ2 A;  2YJB A;  3PBH A;  2PAD A;  3LXS A;  2DZY A;  3OVZ A;  4I05 A;  2GHU A;  4QRX A;  4MZS A;  3HHI A;  1PBH A;  2AU1 A;  1MEG A;  2FO5 A;  1ME3 A;  2VHS A;  4WA6 A;  2FQ9 A;  4BS6 A;  3KSE A;  2YJ9 A;  2B1M A;  1QMY A;  4X6J A;  2R9M A;  4FIP A;  1O0E A;  5PAD A;  1U9W A;  7PCK A;  2FRA A;  2XU4 A;  1KFX L;  3KKU A;  1IWD A;  1NL6 A;  2AUX A;  5JH3 A;  1PAD A;  3V6E A;  1NLJ A;  2Y6E A;  1JQP A;  3LFY A;  3OVX A;  3CH2 X;  1STF E;  1M6D A;  2AYN A;  8PCH A;  3U8E A;  2CIO A;  4YYW A;  4G54 A;  3ERV A;  1SP4 B;  2ATO A;  4W5B A;  1Q6K A;  4ZUX U;  2G8E A;  3H7D A;  1EWL A;  3RVX A;  3V6C A;  1CVZ A;  3KWB X;  1PIP A;  1F2C A;  2DCA A;  2R9F A;  1AEC A;  2B1N A;  1U5I A;  1AYW A;  4Q8H A;  4QRV A;  2BDL A;  1DF0 A;  3WXF A;  4BSQ A;  4I04 A;  4N8W A;  2BDZ A;  1NPZ A;  1AYV A;  1MHW A;  4OEM A;  1AU4 A;  2FUD A;  4X6H A;  2AS8 A;  1YK7 A;  3USV A;  3B79 A;  1ATK A;  4P6G A;  4YYV A;  2G7Y A;  2DC7 A;  3F5V A;  1AIM A;  4YVA A;  2R6N A;  5CHT A;  1TLO A;  3IHP A;  3HWN A;  1NB3 A;  3P5V A;  3CBJ A;  2F1G A;  3P5X A;  3PNR A;  3ZUA A;  2HD5 A;  2PNS A;  3H6S A;  3PDF A;  4FK5 A;  4KLB A;  3C9E A;  3I06 A;  2HXZ A;  5CHV A;  4BQV A;  3BOW A;  4PP1 A;  5FPW A;  3N4C A;  5K16 A;  2DC6 A;  2DCC A;  4MZO A;  4YYQ A;  4FJC A;  3N3K A;  3F75 A;  2IBI A;  5CVN B;  2PRE A;  1ZIV A;  3IEJ A;  4P6E A;  3BC3 A;  1CPJ A;  4CDD B;  3MHH A;  4I07 A;  2R9O A;  1AYU A;  1Y08 A;  2XU1 A;  2DCD A;  4OEL A;  2NQA A;  4K7C A;  2PBH A;  4X6I A;  4W5C A;  1PPO A;  3KFQ A;  2O6X A;  3D6S A;  3QJ3 A;  4QH6 A;  3H8C A;  3H89 A;  3BPF A;  1GEC E;  1FH0 A;  1BP4 A;  5CVM A;  3M99 A;  2NQD B;  4PP2 E;  2DJF B;  1PPP A;  1A6R A;  1CB5 A;  4QRG A;  2HH5 A;  2DZZ A;  2XU3 A;  2FRQ A;  3O1G A;  3BWK A;  3IOQ A;  5A24 A;  1AU3 A;  4XR7 A;  4N79 A;  1KHQ A;  4HWY A;  3IV2 A;  4Q8G A;  2DJG B;  4AXL A;  2FTD A;  3BCN A;  2E03 A;  4QBB A;  6PAD A;  3E1Z B;  1CTE A;  1TU6 A;  4AXM A;  2R9N A;  4YYS A;  1CQD A;  3MTN A;  2OUL A;  1F29 A;  4CZW A;  2VHF A;  2G8J A;  3RVV A;  4DMX A;  4PAD A;  1VJV A;  5EF4 A;  1PE6 A;  1X9Y A;  1QDQ A;  4YYR A;  4BS5 A;  4MSX A;  3QT4 A;  3GCB A;  2ARY A;  1EF7 A;  3WXG A;  1F2B A;  3IUT A;  2F7D A;  1ZCM A;  4BPV A;  2HHN A;  3OF8 A;  3RVW A;  1U9Q X;  1U9V A;  1YT7 A;  3QSD A;  1ITO A;  4CDC B;  2DC8 A; 
#chains in the Genus database with same CATH topology
 3N3G A;  3AI8 A;  4OVZ A;  3K8U A;  3HD3 A;  3OQC A;  4IP3 A;  1MEM A;  4RY2 A;  2Z84 A;  2C0Y A;  2IPP B;  3OF9 A;  4PI3 A;  3IMA A;  1K3B B;  1YK8 A;  3WXE A;  3OIS A;  4YYU A;  2BTW B;  9PAP A;  1NQC A;  1BY8 A;  2DC9 A;  1GMY A;  3I3T A;  3P5W A;  2XU5 A;  5KO3 A;  1CSB B;  2YJ8 A;  3RNV A;  1THE A;  2YJC A;  1KXR A;  1EWM A;  1QOL A;  3TRK A;  1ME4 A;  1MS6 A;  3MHS A;  5F02 A;  3HHA A;  2GFO A;  2FT2 A;  2R9C A;  1HUC B;  1PCI A;  2ACT A;  3P5U A;  1AU2 A;  2AYO A;  3NHE A;  1BGO A;  2P0R A;  3O0U A;  2YJ2 A;  3KW9 A;  3CBK A;  5J94 A;  1KFU L;  1ICF A;  4YV8 A;  3MOR A;  2P86 A;  3BB7 A;  4DMY A;  3K24 A;  2CB5 A;  3BPM A;  1KHP A;  1CS8 A;  1TL9 A;  1YAL A;  1PPD A;  2NQG A;  3KX1 A;  1PVJ A;  3KWZ A;  1CV8 A;  1AU0 A;  3PSE A;  3PRM A;  4N4Z A;  2NQI A;  4GUA A;  1MIR A;  3H8B A;  1VSN A;  4RF0 A;  3S3Q A;  2G6D A;  1GLO A;  2E02 A;  1MDW A;  2Y5B A;  4CDF B;  4OW0 A;  4XZX A;  1Y4H A;  2DCB A;  1S4V A;  2AIM A;  1U9X A;  3K9M A;  5EGW A;  2H7J A;  2JQG R;  2JRI A;  2AUZ A;  1PXV A;  4W4U A;  2JQF R;  2AVW A;  2E01 A;  4CDE B;  4XUI A;  1QXP A;  5JA7 A;  3DF0 A;  5CVO B;  1NB5 A;  1EWO A;  1PPN A;  1POP A;  2WBF X;  1BQI A;  5EZQ A;  1DEU A;  1CJL A;  3TNX A;  1XKG A;  2P7U A;  1YVB A;  1EWP A;  3PW3 A;  1UKF A;  2UZJ A;  1F2A A;  3B21 A;  2OP3 A;  1GCB A;  1SNK A;  3S3R A;  2BTW A;  3MTV A;  3CH3 X;  2E00 A;  2FYE A;  2OZ2 A;  2YJB A;  3PBH A;  2PAD A;  3LXS A;  2DZY A;  4P16 A;  3OVZ A;  4I05 A;  2GHU A;  3MJ5 A;  4QRX A;  4MZS A;  3HHI A;  1PBH A;  2AU1 A;  1MEG A;  2FO5 A;  4BOS A;  1ME3 A;  2VHS A;  4WA6 A;  2FQ9 A;  4BS6 A;  3KSE A;  2YJ9 A;  2B1M A;  1QMY A;  2DOS A;  4RKX A;  3IFU A;  4X6J A;  2R9M A;  4FIP A;  1O0E A;  5PAD A;  4RF1 A;  1U9W A;  2JTC A;  7PCK A;  2FRA A;  2XU4 A;  3W30 A;  1KFX L;  3KKU A;  1IWD A;  1NL6 A;  2AUX A;  5JH3 A;  3MP2 A;  1PAD A;  3V6E A;  4HXD B;  1NLJ A;  2Y6E A;  1JQP A;  3LFY A;  4RNA A;  3OVX A;  3CH2 X;  1STF E;  1M6D A;  2AYN A;  8PCH A;  3U8E A;  2CIO A;  4R3D A;  4YYW A;  4G54 A;  3ERV A;  1SP4 B;  2ATO A;  4W5B A;  2FE8 A;  1Q6K A;  5EZS A;  4ZUX U;  2G8E A;  3H7D A;  1EWL A;  3RVX A;  3V6C A;  1CVZ A;  3KWB X;  4IUM A;  4A5U A;  1PIP A;  1F2C A;  2DCA A;  2R9F A;  1AEC A;  2B1N A;  2J7Q A;  1U5I A;  4WUR A;  1AYW A;  1YZB A;  4Q8H A;  4QRV A;  2BDL A;  1DF0 A;  3WXF A;  2AGA A;  4BOP A;  1DKI A;  3PHU A;  3TMP A;  3BBA A;  4BSQ A;  4I04 A;  4N8W A;  2BDZ A;  1NPZ A;  1AYV A;  1MHW A;  4OEM A;  5E6J A;  4ZTB A;  1AU4 A;  2FUD A;  4X6H A;  3PRP A;  2AS8 A;  3PHX A;  1YK7 A;  3USV A;  4REZ A;  3B79 A;  1ATK A;  4MI7 A;  4P6G A;  4YYV A;  2G7Y A;  4D8I A;  4D8E A;  2DC7 A;  3C0R A;  4BOZ A;  3F5V A;  1AIM A;  4YVA A;  2R6N A;  5CHT A;  1TLO A;  3IHP A;  3HWN A;  1NB3 A;  3P5V A;  3CBJ A;  2F1G A;  3P5X A;  3PNR A;  3ZUA A;  2HD5 A;  2PNS A;  2HWK A;  3H6S A;  3PDF A;  4FK5 A;  4KLB A;  3C9E A;  3I06 A;  2J7Q C;  5JZE A;  2HXZ A;  5CHV A;  4BQV A;  3BOW A;  4PP1 A;  5FPW A;  3N4C A;  4BOU A;  5K16 A;  2DC6 A;  2DCC A;  4MZO A;  4YYQ A;  4FJC A;  3N3K A;  3F75 A;  2IBI A;  3BY4 A;  4OVZ B;  5CVN B;  2PRE A;  1ZIV A;  3IEJ A;  4P6E A;  4BOQ A;  4MM3 B;  3BC3 A;  1CPJ A;  3E9S A;  4CDD B;  3MHH A;  4I07 A;  2R9O A;  1AYU A;  1Y08 A;  2XU1 A;  2DCD A;  4OEL A;  2NQA A;  4K7C A;  2PBH A;  4X6I A;  4W5C A;  1PPO A;  3KFQ A;  2O6X A;  3D6S A;  3QJ3 A;  4QH6 A;  3H8C A;  3H89 A;  3BPF A;  1GEC E;  1FH0 A;  1BP4 A;  5CVM A;  3M99 A;  2NQD B;  4PP2 E;  2DJF B;  1PPP A;  1A6R A;  1CB5 A;  4QRG A;  2HH5 A;  2DZZ A;  2XU3 A;  2FRQ A;  3O1G A;  3BWK A;  3IOQ A;  5A24 A;  1AU3 A;  4XR7 A;  4N79 A;  1KHQ A;  4HWY A;  3IV2 A;  4Q8G A;  2DJG B;  4AXL A;  2FTD A;  3BCN A;  2E03 A;  4QBB A;  6PAD A;  3E1Z B;  3PHW A;  1CTE A;  1TU6 A;  4AXM A;  3W31 A;  2R9N A;  4M0W A;  4YYS A;  1CQD A;  3MTN A;  2BU3 A;  2OUL A;  1F29 A;  4CZW A;  2VHF A;  2G8J A;  3RVV A;  4DMX A;  4PAD A;  1VJV A;  5EF4 A;  1PE6 A;  1X9Y A;  1QDQ A;  3PT2 A;  4YYR A;  4BS5 A;  4MSX A;  3QT4 A;  3GCB A;  2ARY A;  1EF7 A;  3WXG A;  1F2B A;  3IUT A;  2F7D A;  1ZCM A;  4BPV A;  3ZNH A;  2HHN A;  3OF8 A;  4PT5 A;  3RVW A;  1U9Q X;  1U9V A;  1YT7 A;  3QSD A;  3O65 A;  1ITO A;  4D8B A;  4CDC B;  2DC8 A; 
#chains in the Genus database with same CATH homology
 3N3G A;  3AI8 A;  3K8U A;  3HD3 A;  1MEM A;  4RY2 A;  2C0Y A;  2IPP B;  3OF9 A;  4PI3 A;  3IMA A;  1K3B B;  1YK8 A;  3WXE A;  3OIS A;  4YYU A;  9PAP A;  1NQC A;  1BY8 A;  2DC9 A;  1GMY A;  3I3T A;  3P5W A;  2XU5 A;  1CSB B;  2YJ8 A;  1THE A;  2YJC A;  1KXR A;  2VFC A;  1EWM A;  1QOL A;  3LTW A;  1ME4 A;  1MS6 A;  3MHS A;  5F02 A;  3HHA A;  2GFO A;  2FT2 A;  2R9C A;  1HUC B;  1PCI A;  2ACT A;  3P5U A;  1AU2 A;  2AYO A;  3NHE A;  1BGO A;  2P0R A;  3O0U A;  2YJ2 A;  3KW9 A;  3CBK A;  5J94 A;  2BSZ A;  1KFU L;  1ICF A;  4YV8 A;  3MOR A;  2P86 A;  4DMY A;  3K24 A;  2CB5 A;  3BPM A;  1KHP A;  1CS8 A;  1TL9 A;  1YAL A;  1PPD A;  2NQG A;  3KX1 A;  3KWZ A;  1CV8 A;  1AU0 A;  4N4Z A;  2NQI A;  1MIR A;  1W6F A;  3H8B A;  1VSN A;  3S3Q A;  2G6D A;  1GLO A;  2E02 A;  1MDW A;  2Y5B A;  4CDF B;  4B55 A;  1Y4H A;  2DCB A;  1S4V A;  2AIM A;  1U9X A;  3K9M A;  5EGW A;  2H7J A;  2JQG R;  2AUZ A;  1PXV A;  3D9W A;  4W4U A;  2JQF R;  2AVW A;  2E01 A;  4CDE B;  4XUI A;  1QXP A;  5JA7 A;  3DF0 A;  5CVO B;  1NB5 A;  1EWO A;  1PPN A;  1POP A;  2WBF X;  1BQI A;  1DEU A;  1CJL A;  3TNX A;  1XKG A;  2P7U A;  1YVB A;  1EWP A;  3PW3 A;  1F2A A;  2OP3 A;  1GCB A;  1SNK A;  3S3R A;  3CH3 X;  2E00 A;  2FYE A;  2OZ2 A;  2YJB A;  3PBH A;  2PAD A;  3LXS A;  2DZY A;  3OVZ A;  4I05 A;  2GHU A;  4QRX A;  4MZS A;  3HHI A;  1PBH A;  2AU1 A;  1MEG A;  2FO5 A;  1ME3 A;  2VHS A;  4WA6 A;  2FQ9 A;  4BS6 A;  3KSE A;  2YJ9 A;  2B1M A;  1GX3 A;  1QMY A;  4C5P A;  4X6J A;  2R9M A;  4GUZ A;  4FIP A;  1O0E A;  5PAD A;  1U9W A;  7PCK A;  2FRA A;  2XU4 A;  1KFX L;  3KKU A;  1IWD A;  4NV7 A;  1NL6 A;  2AUX A;  5JH3 A;  1PAD A;  3V6E A;  4BGF A;  1NLJ A;  2Y6E A;  1JQP A;  3LFY A;  3OVX A;  3CH2 X;  1STF E;  1M6D A;  2AYN A;  8PCH A;  3U8E A;  2CIO A;  4YYW A;  1W4T A;  4G54 A;  3ERV A;  1SP4 B;  2ATO A;  4W5B A;  1Q6K A;  4ZUX U;  2G8E A;  3H7D A;  1EWL A;  3RVX A;  3V6C A;  1CVZ A;  3KWB X;  1PIP A;  1F2C A;  2DCA A;  2R9F A;  1AEC A;  2B1N A;  1U5I A;  1AYW A;  4Q8H A;  1W5R A;  4QRV A;  2BDL A;  1DF0 A;  3WXF A;  4BSQ A;  4I04 A;  4N8W A;  2BDZ A;  1NPZ A;  1AYV A;  1MHW A;  4OEM A;  1AU4 A;  2FUD A;  4X6H A;  2AS8 A;  1YK7 A;  3USV A;  3B79 A;  1ATK A;  4P6G A;  4YYV A;  2G7Y A;  2DC7 A;  3F5V A;  1AIM A;  4YVA A;  2R6N A;  5CHT A;  1TLO A;  1E2T A;  3IHP A;  3HWN A;  1NB3 A;  3P5V A;  3CBJ A;  2F1G A;  3P5X A;  3PNR A;  3ZUA A;  2HD5 A;  2PNS A;  3H6S A;  3PDF A;  4FK5 A;  4KLB A;  3C9E A;  3I06 A;  2HXZ A;  5CHV A;  4BQV A;  3BOW A;  4PP1 A;  5FPW A;  3N4C A;  5K16 A;  2DC6 A;  2DCC A;  4MZO A;  4YYQ A;  4FJC A;  3N3K A;  3F75 A;  2IBI A;  5CVN B;  2PRE A;  1ZIV A;  3IEJ A;  4P6E A;  3BC3 A;  1CPJ A;  4CDD B;  3MHH A;  4I07 A;  2R9O A;  1AYU A;  1Y08 A;  2XU1 A;  2DCD A;  4OEL A;  2NQA A;  4K7C A;  2PBH A;  4X6I A;  4W5C A;  1PPO A;  4NV8 A;  3KFQ A;  2O6X A;  3D6S A;  3QJ3 A;  4QH6 A;  3H8C A;  3H89 A;  3BPF A;  1GEC E;  1FH0 A;  1BP4 A;  5CVM A;  3M99 A;  2NQD B;  4PP2 E;  2DJF B;  1PPP A;  1A6R A;  1CB5 A;  4QRG A;  2HH5 A;  2DZZ A;  2XU3 A;  2FRQ A;  3O1G A;  3BWK A;  3IOQ A;  5A24 A;  1AU3 A;  4XR7 A;  4N79 A;  1KHQ A;  4HWY A;  3IV2 A;  4Q8G A;  2DJG B;  4AXL A;  2FTD A;  3BCN A;  2E03 A;  4QBB A;  6PAD A;  3E1Z B;  1CTE A;  1TU6 A;  4AXM A;  2R9N A;  4YYS A;  1CQD A;  3MTN A;  2OUL A;  1F29 A;  2VFB A;  4CZW A;  2VHF A;  2G8J A;  3RVV A;  4DMX A;  4PAD A;  1VJV A;  5EF4 A;  1PE6 A;  1X9Y A;  1QDQ A;  4YYR A;  4BS5 A;  4MSX A;  3QT4 A;  3GCB A;  2ARY A;  1EF7 A;  3WXG A;  1F2B A;  3IUT A;  2F7D A;  1ZCM A;  4BPV A;  2HHN A;  3OF8 A;  3RVW A;  1U9Q X;  1U9V A;  1YT7 A;  3QSD A;  1ITO A;  4CDC B;  2DC8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...