1AU0A

Crystal structure of the cysteine protease human cathepsin k in complex with a covalent symmetric diacylaminomethyl ketone inhibitor
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
215
structure length
215
Chain Sequence
APDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Design of Potent and Selective Cathepsin K Inhibitors
pubmed rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords CATHEPSIN K
total genus 59
structure length 215
sequence length 215
ec nomenclature ec 3.4.22.38: Cathepsin K.
pdb deposition date 1997-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1au0A00
2YJ2A 1YALA 4CZWA 4I05A 4N4ZA 2XU3A 2XU4A 2OP3A 4CDCB 1GCBA 1QDQA 3RVWA 1ME4A 3P5UA 3IV2A 4YYRA 3MTNA 1X9YA 1ZCMA 2AYNA 1CSBB 1AU0A 1AYVA 2DCAA 4I07A 3S3QA 5EF4A 4N8WA 4YYUA 2ARYA 3N3KA 3PNRA 2NQAA 4QH6A 4CDEB 2R9FA 1PCIA 3RVVA 1KFXL 1F2BA 1AYUA 2DCBA 4W4UA 4OELA 2FQ9A 2E02A 1AU3A 4Q8GA 4YVAA 1F2CA 4HWYA 4W5CA 3K8UA 2FO5A 2GHUA 1PADA 2P7UA 2ACTA 5CVOB 3QSDA 3OF8A 4I04A 1SNKA 2B1NA 1AECA 3TNXA 1QXPA 2P0RA 3WXFA 2NQIA 4BSQA 2C0YA 4YYQA 2AYOA 1BQIA 1Y08A 2FRAA 3OVXA 1YT7A 3K24A 2P86A 4XR7A 4P6EA 1CPJA 2R9OA 1AU4A 2G7YA 1KFUL 3CBJA 3E1ZB 1NB5A 2FYEA 5FPWA 2JQGR 1EWOA 1ZIVA 1PPNA 1CVZA 5CHVA 1O0EA 4BQVA 1U5IA 2XU5A 2HD5A 3P5WA 4AXMA 2JQFR 1CS8A 4MZOA 1MS6A 1SP4B 1PBHA 3HHIA 2VHFA 1DEUA 2G8EA 4RY2A 2R9MA 4CDDB 4QRXA 2E03A 3M99A 5F02A 2Y5BA 1BP4A 4YYWA 2DCCA 1NQCA 4YYSA 3ZUAA 4BS6A 1MEGA 2E00A 3BWKA 1AU2A 2G8JA 2IBIA 2Y6EA 3H89A 1FH0A 2PBHA 3USVA 4AXLA 2OULA 6PADA 2CB5A 1ATKA 1CQDA 1NL6A 3KWBX 2PREA 1QMYA 2AS8A 2E01A 3MORA 1Y4HA 3KKUA 3OISA 4DMYA 1MDWA 4PP2E 2DCDA 1ITOA 1F29A 4OEMA 3V6EA 3PDFA 3HHAA 1DF0A 2R9CA 2G6DA 2PNSA 4BPVA 2FRQA 4KLBA 1PXVA 3CH2X 5JH3A 5CVMA 1BGOA 2ATOA 2WBFX 3D6SA 3IEJA 1U9WA 2CIOA 2FT2A 3KFQA 1YVBA 4PI3A 1POPA 1ME3A 3O0UA 4QRVA 3BC3A 2DZZA 1PPPA 4XUIA 1CTEA 1JQPA 3GCBA 3F75A 2AIMA 1CV8A 1STFE 1ICFA 3P5XA 2XU1A 3H7DA 5J94A 1YK8A 3CBKA 1U9VA 3F5VA 4N79A 1VJVA 1CB5A 1TU6A 3IMAA 3MHHA 1TL9A 1EWMA 3AI8A 2DC8A 3H8CA 4X6HA 1MIRA 1PE6A 2IPPB 1S4VA 3CH3X 3B79A 2PADA 3H8BA 3S3RA 5JA7A 3QT4A 1U9XA 3DF0A 3OF9A 1PIPA 5EGWA 1YK7A 4YV8A 1EWLA 3KSEA 2AUZA 2DJGB 3BOWA 3P5VA 1EF7A 2NQGA 3I06A 1K3BB 4DMXA 3BPMA 2AVWA 2DJFB 2HHNA 2DC6A 1AYWA 3PW3A 3KX1A 2H7JA 4G54A 3WXGA 4X6JA 2HH5A 2YJ9A 2R6NA 3IOQA 2DC7A 4FJCA 1TLOA 4X6IA 3C9EA 4CDFB 1Q6KA 3BCNA 2HXZA 2F7DA 3WXEA 3U8EA 2VHSA 1NB3A 1M6DA 2DZYA 3N3GA 3IUTA 1GMYA 4WA6A 3O1GA 1MHWA 1THEA 4ZUXU 3PBHA 4MSXA 3I3TA 1VSNA 4Q8HA 4K7CA 3N4CA 3K9MA 1NLJA 2YJCA 4FK5A 1EWPA 2AUXA 3H6SA 2FUDA 3KWZA 3HD3A 7PCKA 1CJLA 4BS5A 3OVZA 4P6GA 3NHEA 1GLOA 1KXRA 9PAPA 3BPFA 1PPOA 2BDLA 5A24A 1QOLA 2YJBA 3RVXA 4YYVA 2OZ2A 1PPDA 2GFOA 2DC9A 1A6RA 1KHPA 1MEMA 4FIPA 2BDZA 4W5BA 5PADA 1U9QX 3QJ3A 4QBBA 2AU1A 4PADA 2O6XA 8PCHA 3IHPA 1HUCB 4QRGA 3ERVA 2FTDA 4PP1A 2F1GA 3HWNA 3LFYA 2YJ8A 3V6CA 2R9NA 1BY8A 1GECE 4MZSA 3LXSA 3MHSA 1XKGA 1KHQA 1NPZA 1F2AA 5CHTA 3KW9A 2B1MA 1AIMA 1IWDA 5K16A 5CVNB 2NQDB
chains in the Genus database with same CATH superfamily
2YJ2A 1YALA 4CZWA 4I05A 4D8EA 4N4ZA 2XU3A 2XU4A 2OP3A 4CDCB 3PHXA 1GCBA 1QDQA 3RVWA 1ME4A 3P5UA 3IV2A 4YYRA 4D8BA 3MTNA 1X9YA 1ZCMA 2AYNA 1CSBB 1UKFA 1AU0A 1AYVA 2DCAA 4I07A 3S3QA 3BY4A 5EF4A 4N8WA 4YYUA 2ARYA 3N3KA 3PNRA 2NQAA 4QH6A 4CDEB 2R9FA 1PCIA 3IFUA 3RVVA 1KFXL 1F2BA 1AYUA 2DCBA 4W4UA 2BTWB 4OELA 5KO3A 2FQ9A 2E02A 1AU3A 4Q8GA 4YVAA 1F2CA 4HWYA 4W5CA 3K8UA 2FO5A 2GHUA 3MJ5A 1PADA 2P7UA 2ACTA 5CVOB 3QSDA 3OF8A 4I04A 1SNKA 2B1NA 1AECA 3TNXA 1QXPA 2P0RA 3WXFA 5JZEA 2NQIA 3MTVA 2BU3A 4BSQA 4IUMA 2C0YA 4YYQA 2AYOA 1BQIA 1Y08A 2FRAA 3OVXA 4OVZA 1YT7A 3K24A 2P86A 4XR7A 4P6EA 1CPJA 2R9OA 1AU4A 2G7YA 1KFUL 3CBJA 3E1ZB 1NB5A 2FYEA 5FPWA 2JQGR 1EWOA 1ZIVA 1PPNA 1CVZA 5EZQA 2AGAA 4BOZA 4BOPA 5CHVA 1O0EA 4BQVA 2JRIA 1U5IA 2XU5A 2HD5A 3P5WA 4P16A 4AXMA 4RF1A 2JQFR 1CS8A 4MZOA 1MS6A 1SP4B 3PRPA 1PBHA 3HHIA 1YZBA 2VHFA 1DEUA 2G8EA 5EZSA 4RY2A 2R9MA 4CDDB 4QRXA 2E03A 3M99A 3PHUA 5F02A 2Y5BA 4REZA 1BP4A 4YYWA 2DCCA 3PHWA 1NQCA 4YYSA 3ZUAA 4BS6A 1MEGA 2E00A 3BWKA 1AU2A 2G8JA 2IBIA 2Y6EA 3H89A 1FH0A 2PBHA 3USVA 4AXLA 4RF0A 2OULA 4D8IA 3PSEA 6PADA 2CB5A 1ATKA 1CQDA 1NL6A 3KWBX 2PREA 1QMYA 2E01A 3MORA 1Y4HA 3KKUA 3OISA 4IP3A 4DMYA 2UZJA 1MDWA 4PP2E 2DCDA 1ITOA 1F29A 4OEMA 3V6EA 3PDFA 3HHAA 3OQCA 1DF0A 3E9SA 2R9CA 2G6DA 2PNSA 4M0WA 4OVZB 4BPVA 2FRQA 4KLBA 1PXVA 2FE8A 4RKXA 3CH2X 5JH3A 5CVMA 1BGOA 2ATOA 2JTCA 2WBFX 3D6SA 3IEJA 1U9WA 2CIOA 2FT2A 3KFQA 1YVBA 1POPA 1ME3A 4PI3A 4MI7A 3O0UA 4QRVA 3BC3A 4RNAA 2DZZA 2Z84A 3TRKA 4BOSA 1PPPA 4XUIA 4R3DA 1CTEA 1JQPA 3GCBA 3F75A 2AIMA 1CV8A 1STFE 1ICFA 3BB7A 3P5XA 2XU1A 3H7DA 5J94A 1YK8A 3CBKA 1U9VA 3F5VA 4N79A 1VJVA 1CB5A 1TU6A 3B21A 3IMAA 3W30A 3MHHA 1TL9A 1EWMA 3AI8A 2DC8A 3H8CA 4X6HA 1MIRA 1PE6A 2IPPB 1S4VA 3CH3X 3B79A 2PADA 3H8BA 3S3RA 5JA7A 3PRMA 3QT4A 1U9XA 3DF0A 4A5UA 3OF9A 1PIPA 3O65A 5EGWA 1YK7A 4YV8A 1EWLA 3KSEA 2AUZA 2DJGB 3BOWA 3P5VA 1EF7A 2NQGA 3I06A 1K3BB 4DMXA 3BPMA 2AVWA 2DJFB 2HHNA 2DC6A 1AYWA 3PW3A 3KX1A 3RNVA 2H7JA 3TMPA 4G54A 3WXGA 4X6JA 4GUAA 2HH5A 2YJ9A 2R6NA 3IOQA 2DC7A 4FJCA 1TLOA 4X6IA 3C9EA 4CDFB 1Q6KA 3BCNA 2HXZA 2F7DA 3W31A 3U8EA 3WXEA 2VHSA 1NB3A 1M6DA 2DZYA 3N3GA 3IUTA 1GMYA 2DOSA 4WA6A 4HXDB 3C0RA 3O1GA 1MHWA 4BOUA 1THEA 4ZUXU 3PBHA 4MSXA 3I3TA 5E6JA 4OW0A 1VSNA 4BOQA 4Q8HA 4K7CA 3BBAA 3N4CA 4XZXA 3K9MA 1NLJA 2YJCA 4FK5A 1EWPA 2AUXA 3H6SA 2FUDA 3KWZA 3HD3A 7PCKA 1CJLA 4BS5A 3OVZA 4P6GA 3NHEA 1GLOA 1KXRA 9PAPA 3BPFA 1PPOA 2BDLA 5A24A 2J7QA 1QOLA 2YJBA 3RVXA 4MM3B 4YYVA 2OZ2A 1PPDA 2GFOA 2DC9A 2BTWA 1A6RA 1KHPA 1MEMA 4FIPA 2BDZA 4W5BA 5PADA 2HWKA 1PVJA 1U9QX 3QJ3A 4QBBA 2J7QC 3ZNHA 5CVNB 2AU1A 4PADA 2O6XA 8PCHA 3IHPA 1HUCB 4QRGA 3ERVA 2FTDA 3MP2A 4PP1A 2F1GA 3HWNA 3LFYA 2YJ8A 3V6CA 2R9NA 3PT2A 1BY8A 1GECE 1DKIA 4MZSA 3LXSA 4WURA 3MHSA 1XKGA 1KHQA 1NPZA 1F2AA 5CHTA 4PT5A 3KW9A 4ZTBA 2B1MA 1AIMA 1IWDA 5K16A 2AS8A 2NQDB
chains in the Genus database with same CATH topology
2YJ2A 1YALA 4CZWA 4I05A 4N4ZA 1W5RA 2VFBA 2XU3A 2XU4A 2OP3A 4CDCB 1GCBA 1QDQA 3RVWA 1ME4A 3P5UA 3IV2A 4YYRA 3MTNA 1X9YA 1ZCMA 2AYNA 1CSBB 1AU0A 1AYVA 2DCAA 4I07A 3S3QA 4C5PA 5EF4A 4N8WA 4YYUA 2ARYA 3N3KA 3PNRA 2NQAA 4QH6A 4CDEB 2R9FA 1PCIA 3RVVA 1KFXL 1F2BA 1AYUA 2DCBA 4W4UA 4OELA 2FQ9A 2E02A 1AU3A 1E2TA 4Q8GA 4YVAA 1F2CA 4HWYA 4W5CA 3K8UA 2FO5A 2GHUA 3LTWA 1PADA 2P7UA 2ACTA 5CVOB 3QSDA 3OF8A 4I04A 1SNKA 2B1NA 1AECA 3TNXA 1QXPA 2P0RA 3WXFA 2NQIA 4BSQA 2C0YA 4YYQA 2AYOA 1BQIA 1Y08A 1W4TA 2FRAA 3OVXA 1GX3A 1YT7A 3K24A 2P86A 4XR7A 4P6EA 1CPJA 2R9OA 1AU4A 2G7YA 1KFUL 3CBJA 3E1ZB 1NB5A 2FYEA 5FPWA 2JQGR 1EWOA 1ZIVA 1PPNA 3D9WA 1CVZA 5CHVA 1O0EA 4BQVA 1U5IA 2XU5A 2HD5A 3P5WA 2BSZA 4AXMA 2JQFR 1CS8A 4MZOA 1MS6A 1SP4B 1PBHA 3HHIA 2VHFA 1DEUA 2G8EA 4RY2A 2R9MA 4CDDB 4QRXA 2E03A 3M99A 5F02A 2Y5BA 1BP4A 4YYWA 2DCCA 1NQCA 4YYSA 3ZUAA 4BS6A 1MEGA 2E00A 3BWKA 1AU2A 2G8JA 2IBIA 2Y6EA 3H89A 1FH0A 2PBHA 3USVA 4AXLA 2OULA 6PADA 2CB5A 1ATKA 1CQDA 1NL6A 3KWBX 2PREA 1QMYA 2AS8A 2E01A 3MORA 1Y4HA 3KKUA 3OISA 4DMYA 1MDWA 4PP2E 2DCDA 1ITOA 1F29A 4OEMA 3V6EA 3PDFA 3HHAA 1DF0A 2R9CA 2G6DA 2PNSA 4BPVA 2FRQA 4KLBA 1PXVA 4NV8A 3CH2X 5JH3A 5CVMA 1BGOA 2ATOA 2WBFX 3D6SA 3IEJA 1U9WA 2CIOA 2FT2A 3KFQA 1YVBA 4PI3A 1POPA 1ME3A 3O0UA 4QRVA 3BC3A 2DZZA 1PPPA 4XUIA 1CTEA 1JQPA 3GCBA 3F75A 2AIMA 1CV8A 1STFE 1ICFA 2VFCA 3P5XA 2XU1A 3H7DA 5J94A 1YK8A 3CBKA 1U9VA 3F5VA 4N79A 1VJVA 4NV7A 1CB5A 1TU6A 3IMAA 3MHHA 1TL9A 1EWMA 4BGFA 3AI8A 2DC8A 3H8CA 4X6HA 1MIRA 1PE6A 2IPPB 1S4VA 4B55A 3CH3X 3B79A 2PADA 3H8BA 3S3RA 5JA7A 3QT4A 1U9XA 3DF0A 3OF9A 1PIPA 5EGWA 1YK7A 4YV8A 1EWLA 3KSEA 2AUZA 2DJGB 3BOWA 3P5VA 1EF7A 2NQGA 3I06A 1K3BB 4DMXA 3BPMA 2AVWA 2DJFB 2HHNA 2DC6A 1AYWA 3PW3A 3KX1A 2H7JA 4G54A 4GUZA 3WXGA 4X6JA 2HH5A 2YJ9A 2R6NA 3IOQA 2DC7A 4FJCA 1TLOA 4X6IA 3C9EA 4CDFB 1Q6KA 3BCNA 2HXZA 2F7DA 3U8EA 3WXEA 2VHSA 1NB3A 1M6DA 2DZYA 3N3GA 3IUTA 1GMYA 4WA6A 3O1GA 1MHWA 1THEA 4ZUXU 3PBHA 4MSXA 3I3TA 1VSNA 4Q8HA 4K7CA 3N4CA 3K9MA 1NLJA 2YJCA 4FK5A 1EWPA 2AUXA 3H6SA 2FUDA 3KWZA 3HD3A 7PCKA 1CJLA 4BS5A 3OVZA 4P6GA 3NHEA 1GLOA 1KXRA 9PAPA 3BPFA 1PPOA 2BDLA 5A24A 1QOLA 2YJBA 3RVXA 4YYVA 2OZ2A 1PPDA 2GFOA 2DC9A 1A6RA 1KHPA 1MEMA 4FIPA 2BDZA 4W5BA 5PADA 1U9QX 3QJ3A 4QBBA 2AU1A 4PADA 2O6XA 8PCHA 3IHPA 1HUCB 4QRGA 3ERVA 2FTDA 4PP1A 2F1GA 3HWNA 3LFYA 2YJ8A 3V6CA 2R9NA 1BY8A 1GECE 4MZSA 3LXSA 3MHSA 1XKGA 1KHQA 1NPZA 1F2AA 5CHTA 1W6FA 3KW9A 2B1MA 1AIMA 1IWDA 5K16A 5CVNB 2NQDB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YJ2 A;  1YAL A;  4CZW A;  4I05 A;  4N4Z A;  2XU3 A;  2XU4 A;  2OP3 A;  4CDC B;  1GCB A;  1QDQ A;  3RVW A;  1ME4 A;  3P5U A;  3IV2 A;  4YYR A;  3MTN A;  1X9Y A;  1ZCM A;  2AYN A;  1CSB B;  1AU0 A;  1AYV A;  2DCA A;  4I07 A;  3S3Q A;  5EF4 A;  4N8W A;  4YYU A;  2ARY A;  3N3K A;  3PNR A;  2NQA A;  4QH6 A;  4CDE B;  2R9F A;  1PCI A;  3RVV A;  1KFX L;  1F2B A;  1AYU A;  2DCB A;  4W4U A;  4OEL A;  2FQ9 A;  2E02 A;  1AU3 A;  4Q8G A;  4YVA A;  1F2C A;  4HWY A;  4W5C A;  3K8U A;  2FO5 A;  2GHU A;  1PAD A;  2P7U A;  2ACT A;  5CVO B;  3QSD A;  3OF8 A;  4I04 A;  1SNK A;  2B1N A;  1AEC A;  3TNX A;  1QXP A;  2P0R A;  3WXF A;  2NQI A;  4BSQ A;  2C0Y A;  4YYQ A;  2AYO A;  1BQI A;  1Y08 A;  2FRA A;  3OVX A;  1YT7 A;  3K24 A;  2P86 A;  4XR7 A;  4P6E A;  1CPJ A;  2R9O A;  1AU4 A;  2G7Y A;  1KFU L;  3CBJ A;  3E1Z B;  1NB5 A;  2FYE A;  5FPW A;  2JQG R;  1EWO A;  1ZIV A;  1PPN A;  1CVZ A;  5CHV A;  1O0E A;  4BQV A;  1U5I A;  2XU5 A;  2HD5 A;  3P5W A;  4AXM A;  2JQF R;  1CS8 A;  4MZO A;  1MS6 A;  1SP4 B;  1PBH A;  3HHI A;  2VHF A;  1DEU A;  2G8E A;  4RY2 A;  2R9M A;  4CDD B;  4QRX A;  2E03 A;  3M99 A;  5F02 A;  2Y5B A;  1BP4 A;  4YYW A;  2DCC A;  1NQC A;  4YYS A;  3ZUA A;  4BS6 A;  1MEG A;  2E00 A;  3BWK A;  1AU2 A;  2G8J A;  2IBI A;  2Y6E A;  3H89 A;  1FH0 A;  2PBH A;  3USV A;  4AXL A;  2OUL A;  6PAD A;  2CB5 A;  1ATK A;  1CQD A;  1NL6 A;  3KWB X;  2PRE A;  1QMY A;  2AS8 A;  2E01 A;  3MOR A;  1Y4H A;  3KKU A;  3OIS A;  4DMY A;  1MDW A;  4PP2 E;  2DCD A;  1ITO A;  1F29 A;  4OEM A;  3V6E A;  3PDF A;  3HHA A;  1DF0 A;  2R9C A;  2G6D A;  2PNS A;  4BPV A;  2FRQ A;  4KLB A;  1PXV A;  3CH2 X;  5JH3 A;  5CVM A;  1BGO A;  2ATO A;  2WBF X;  3D6S A;  3IEJ A;  1U9W A;  2CIO A;  2FT2 A;  3KFQ A;  1YVB A;  4PI3 A;  1POP A;  1ME3 A;  3O0U A;  4QRV A;  3BC3 A;  2DZZ A;  1PPP A;  4XUI A;  1CTE A;  1JQP A;  3GCB A;  3F75 A;  2AIM A;  1CV8 A;  1STF E;  1ICF A;  3P5X A;  2XU1 A;  3H7D A;  5J94 A;  1YK8 A;  3CBK A;  1U9V A;  3F5V A;  4N79 A;  1VJV A;  1CB5 A;  1TU6 A;  3IMA A;  3MHH A;  1TL9 A;  1EWM A;  3AI8 A;  2DC8 A;  3H8C A;  4X6H A;  1MIR A;  1PE6 A;  2IPP B;  1S4V A;  3CH3 X;  3B79 A;  2PAD A;  3H8B A;  3S3R A;  5JA7 A;  3QT4 A;  1U9X A;  3DF0 A;  3OF9 A;  1PIP A;  5EGW A;  1YK7 A;  4YV8 A;  1EWL A;  3KSE A;  2AUZ A;  2DJG B;  3BOW A;  3P5V A;  1EF7 A;  2NQG A;  3I06 A;  1K3B B;  4DMX A;  3BPM A;  2AVW A;  2DJF B;  2HHN A;  2DC6 A;  1AYW A;  3PW3 A;  3KX1 A;  2H7J A;  4G54 A;  3WXG A;  4X6J A;  2HH5 A;  2YJ9 A;  2R6N A;  3IOQ A;  2DC7 A;  4FJC A;  1TLO A;  4X6I A;  3C9E A;  4CDF B;  1Q6K A;  3BCN A;  2HXZ A;  2F7D A;  3WXE A;  3U8E A;  2VHS A;  1NB3 A;  1M6D A;  2DZY A;  3N3G A;  3IUT A;  1GMY A;  4WA6 A;  3O1G A;  1MHW A;  1THE A;  4ZUX U;  3PBH A;  4MSX A;  3I3T A;  1VSN A;  4Q8H A;  4K7C A;  3N4C A;  3K9M A;  1NLJ A;  2YJC A;  4FK5 A;  1EWP A;  2AUX A;  3H6S A;  2FUD A;  3KWZ A;  3HD3 A;  7PCK A;  1CJL A;  4BS5 A;  3OVZ A;  4P6G A;  3NHE A;  1GLO A;  1KXR A;  9PAP A;  3BPF A;  1PPO A;  2BDL A;  5A24 A;  1QOL A;  2YJB A;  3RVX A;  4YYV A;  2OZ2 A;  1PPD A;  2GFO A;  2DC9 A;  1A6R A;  1KHP A;  1MEM A;  4FIP A;  2BDZ A;  4W5B A;  5PAD A;  1U9Q X;  3QJ3 A;  4QBB A;  2AU1 A;  4PAD A;  2O6X A;  8PCH A;  3IHP A;  1HUC B;  4QRG A;  3ERV A;  2FTD A;  4PP1 A;  2F1G A;  3HWN A;  3LFY A;  2YJ8 A;  3V6C A;  2R9N A;  1BY8 A;  1GEC E;  4MZS A;  3LXS A;  3MHS A;  1XKG A;  1KHQ A;  1NPZ A;  1F2A A;  5CHT A;  3KW9 A;  2B1M A;  1AIM A;  1IWD A;  5K16 A;  5CVN B;  2NQD B; 
#chains in the Genus database with same CATH topology
 2YJ2 A;  1YAL A;  4CZW A;  4I05 A;  4D8E A;  4N4Z A;  2XU3 A;  2XU4 A;  2OP3 A;  4CDC B;  3PHX A;  1GCB A;  1QDQ A;  3RVW A;  1ME4 A;  3P5U A;  3IV2 A;  4YYR A;  4D8B A;  3MTN A;  1X9Y A;  1ZCM A;  2AYN A;  1CSB B;  1UKF A;  1AU0 A;  1AYV A;  2DCA A;  4I07 A;  3S3Q A;  3BY4 A;  5EF4 A;  4N8W A;  4YYU A;  2ARY A;  3N3K A;  3PNR A;  2NQA A;  4QH6 A;  4CDE B;  2R9F A;  1PCI A;  3IFU A;  3RVV A;  1KFX L;  1F2B A;  1AYU A;  2DCB A;  4W4U A;  2BTW B;  4OEL A;  5KO3 A;  2FQ9 A;  2E02 A;  1AU3 A;  4Q8G A;  4YVA A;  1F2C A;  4HWY A;  4W5C A;  3K8U A;  2FO5 A;  2GHU A;  3MJ5 A;  1PAD A;  2P7U A;  2ACT A;  5CVO B;  3QSD A;  3OF8 A;  4I04 A;  1SNK A;  2B1N A;  1AEC A;  3TNX A;  1QXP A;  2P0R A;  3WXF A;  5JZE A;  2NQI A;  3MTV A;  2BU3 A;  4BSQ A;  4IUM A;  2C0Y A;  4YYQ A;  2AYO A;  1BQI A;  1Y08 A;  2FRA A;  3OVX A;  4OVZ A;  1YT7 A;  3K24 A;  2P86 A;  4XR7 A;  4P6E A;  1CPJ A;  2R9O A;  1AU4 A;  2G7Y A;  1KFU L;  3CBJ A;  3E1Z B;  1NB5 A;  2FYE A;  5FPW A;  2JQG R;  1EWO A;  1ZIV A;  1PPN A;  1CVZ A;  5EZQ A;  2AGA A;  4BOZ A;  4BOP A;  5CHV A;  1O0E A;  4BQV A;  2JRI A;  1U5I A;  2XU5 A;  2HD5 A;  3P5W A;  4P16 A;  4AXM A;  4RF1 A;  2JQF R;  1CS8 A;  4MZO A;  1MS6 A;  1SP4 B;  3PRP A;  1PBH A;  3HHI A;  1YZB A;  2VHF A;  1DEU A;  2G8E A;  5EZS A;  4RY2 A;  2R9M A;  4CDD B;  4QRX A;  2E03 A;  3M99 A;  3PHU A;  5F02 A;  2Y5B A;  4REZ A;  1BP4 A;  4YYW A;  2DCC A;  3PHW A;  1NQC A;  4YYS A;  3ZUA A;  4BS6 A;  1MEG A;  2E00 A;  3BWK A;  1AU2 A;  2G8J A;  2IBI A;  2Y6E A;  3H89 A;  1FH0 A;  2PBH A;  3USV A;  4AXL A;  4RF0 A;  2OUL A;  4D8I A;  3PSE A;  6PAD A;  2CB5 A;  1ATK A;  1CQD A;  1NL6 A;  3KWB X;  2PRE A;  1QMY A;  2E01 A;  3MOR A;  1Y4H A;  3KKU A;  3OIS A;  4IP3 A;  4DMY A;  2UZJ A;  1MDW A;  4PP2 E;  2DCD A;  1ITO A;  1F29 A;  4OEM A;  3V6E A;  3PDF A;  3HHA A;  3OQC A;  1DF0 A;  3E9S A;  2R9C A;  2G6D A;  2PNS A;  4M0W A;  4OVZ B;  4BPV A;  2FRQ A;  4KLB A;  1PXV A;  2FE8 A;  4RKX A;  3CH2 X;  5JH3 A;  5CVM A;  1BGO A;  2ATO A;  2JTC A;  2WBF X;  3D6S A;  3IEJ A;  1U9W A;  2CIO A;  2FT2 A;  3KFQ A;  1YVB A;  1POP A;  1ME3 A;  4PI3 A;  4MI7 A;  3O0U A;  4QRV A;  3BC3 A;  4RNA A;  2DZZ A;  2Z84 A;  3TRK A;  4BOS A;  1PPP A;  4XUI A;  4R3D A;  1CTE A;  1JQP A;  3GCB A;  3F75 A;  2AIM A;  1CV8 A;  1STF E;  1ICF A;  3BB7 A;  3P5X A;  2XU1 A;  3H7D A;  5J94 A;  1YK8 A;  3CBK A;  1U9V A;  3F5V A;  4N79 A;  1VJV A;  1CB5 A;  1TU6 A;  3B21 A;  3IMA A;  3W30 A;  3MHH A;  1TL9 A;  1EWM A;  3AI8 A;  2DC8 A;  3H8C A;  4X6H A;  1MIR A;  1PE6 A;  2IPP B;  1S4V A;  3CH3 X;  3B79 A;  2PAD A;  3H8B A;  3S3R A;  5JA7 A;  3PRM A;  3QT4 A;  1U9X A;  3DF0 A;  4A5U A;  3OF9 A;  1PIP A;  3O65 A;  5EGW A;  1YK7 A;  4YV8 A;  1EWL A;  3KSE A;  2AUZ A;  2DJG B;  3BOW A;  3P5V A;  1EF7 A;  2NQG A;  3I06 A;  1K3B B;  4DMX A;  3BPM A;  2AVW A;  2DJF B;  2HHN A;  2DC6 A;  1AYW A;  3PW3 A;  3KX1 A;  3RNV A;  2H7J A;  3TMP A;  4G54 A;  3WXG A;  4X6J A;  4GUA A;  2HH5 A;  2YJ9 A;  2R6N A;  3IOQ A;  2DC7 A;  4FJC A;  1TLO A;  4X6I A;  3C9E A;  4CDF B;  1Q6K A;  3BCN A;  2HXZ A;  2F7D A;  3W31 A;  3U8E A;  3WXE A;  2VHS A;  1NB3 A;  1M6D A;  2DZY A;  3N3G A;  3IUT A;  1GMY A;  2DOS A;  4WA6 A;  4HXD B;  3C0R A;  3O1G A;  1MHW A;  4BOU A;  1THE A;  4ZUX U;  3PBH A;  4MSX A;  3I3T A;  5E6J A;  4OW0 A;  1VSN A;  4BOQ A;  4Q8H A;  4K7C A;  3BBA A;  3N4C A;  4XZX A;  3K9M A;  1NLJ A;  2YJC A;  4FK5 A;  1EWP A;  2AUX A;  3H6S A;  2FUD A;  3KWZ A;  3HD3 A;  7PCK A;  1CJL A;  4BS5 A;  3OVZ A;  4P6G A;  3NHE A;  1GLO A;  1KXR A;  9PAP A;  3BPF A;  1PPO A;  2BDL A;  5A24 A;  2J7Q A;  1QOL A;  2YJB A;  3RVX A;  4MM3 B;  4YYV A;  2OZ2 A;  1PPD A;  2GFO A;  2DC9 A;  2BTW A;  1A6R A;  1KHP A;  1MEM A;  4FIP A;  2BDZ A;  4W5B A;  5PAD A;  2HWK A;  1PVJ A;  1U9Q X;  3QJ3 A;  4QBB A;  2J7Q C;  3ZNH A;  5CVN B;  2AU1 A;  4PAD A;  2O6X A;  8PCH A;  3IHP A;  1HUC B;  4QRG A;  3ERV A;  2FTD A;  3MP2 A;  4PP1 A;  2F1G A;  3HWN A;  3LFY A;  2YJ8 A;  3V6C A;  2R9N A;  3PT2 A;  1BY8 A;  1GEC E;  1DKI A;  4MZS A;  3LXS A;  4WUR A;  3MHS A;  1XKG A;  1KHQ A;  1NPZ A;  1F2A A;  5CHT A;  4PT5 A;  3KW9 A;  4ZTB A;  2B1M A;  1AIM A;  1IWD A;  5K16 A;  2AS8 A;  2NQD B; 
#chains in the Genus database with same CATH homology
 2YJ2 A;  1YAL A;  4CZW A;  4I05 A;  4N4Z A;  1W5R A;  2VFB A;  2XU3 A;  2XU4 A;  2OP3 A;  4CDC B;  1GCB A;  1QDQ A;  3RVW A;  1ME4 A;  3P5U A;  3IV2 A;  4YYR A;  3MTN A;  1X9Y A;  1ZCM A;  2AYN A;  1CSB B;  1AU0 A;  1AYV A;  2DCA A;  4I07 A;  3S3Q A;  4C5P A;  5EF4 A;  4N8W A;  4YYU A;  2ARY A;  3N3K A;  3PNR A;  2NQA A;  4QH6 A;  4CDE B;  2R9F A;  1PCI A;  3RVV A;  1KFX L;  1F2B A;  1AYU A;  2DCB A;  4W4U A;  4OEL A;  2FQ9 A;  2E02 A;  1AU3 A;  1E2T A;  4Q8G A;  4YVA A;  1F2C A;  4HWY A;  4W5C A;  3K8U A;  2FO5 A;  2GHU A;  3LTW A;  1PAD A;  2P7U A;  2ACT A;  5CVO B;  3QSD A;  3OF8 A;  4I04 A;  1SNK A;  2B1N A;  1AEC A;  3TNX A;  1QXP A;  2P0R A;  3WXF A;  2NQI A;  4BSQ A;  2C0Y A;  4YYQ A;  2AYO A;  1BQI A;  1Y08 A;  1W4T A;  2FRA A;  3OVX A;  1GX3 A;  1YT7 A;  3K24 A;  2P86 A;  4XR7 A;  4P6E A;  1CPJ A;  2R9O A;  1AU4 A;  2G7Y A;  1KFU L;  3CBJ A;  3E1Z B;  1NB5 A;  2FYE A;  5FPW A;  2JQG R;  1EWO A;  1ZIV A;  1PPN A;  3D9W A;  1CVZ A;  5CHV A;  1O0E A;  4BQV A;  1U5I A;  2XU5 A;  2HD5 A;  3P5W A;  2BSZ A;  4AXM A;  2JQF R;  1CS8 A;  4MZO A;  1MS6 A;  1SP4 B;  1PBH A;  3HHI A;  2VHF A;  1DEU A;  2G8E A;  4RY2 A;  2R9M A;  4CDD B;  4QRX A;  2E03 A;  3M99 A;  5F02 A;  2Y5B A;  1BP4 A;  4YYW A;  2DCC A;  1NQC A;  4YYS A;  3ZUA A;  4BS6 A;  1MEG A;  2E00 A;  3BWK A;  1AU2 A;  2G8J A;  2IBI A;  2Y6E A;  3H89 A;  1FH0 A;  2PBH A;  3USV A;  4AXL A;  2OUL A;  6PAD A;  2CB5 A;  1ATK A;  1CQD A;  1NL6 A;  3KWB X;  2PRE A;  1QMY A;  2AS8 A;  2E01 A;  3MOR A;  1Y4H A;  3KKU A;  3OIS A;  4DMY A;  1MDW A;  4PP2 E;  2DCD A;  1ITO A;  1F29 A;  4OEM A;  3V6E A;  3PDF A;  3HHA A;  1DF0 A;  2R9C A;  2G6D A;  2PNS A;  4BPV A;  2FRQ A;  4KLB A;  1PXV A;  4NV8 A;  3CH2 X;  5JH3 A;  5CVM A;  1BGO A;  2ATO A;  2WBF X;  3D6S A;  3IEJ A;  1U9W A;  2CIO A;  2FT2 A;  3KFQ A;  1YVB A;  4PI3 A;  1POP A;  1ME3 A;  3O0U A;  4QRV A;  3BC3 A;  2DZZ A;  1PPP A;  4XUI A;  1CTE A;  1JQP A;  3GCB A;  3F75 A;  2AIM A;  1CV8 A;  1STF E;  1ICF A;  2VFC A;  3P5X A;  2XU1 A;  3H7D A;  5J94 A;  1YK8 A;  3CBK A;  1U9V A;  3F5V A;  4N79 A;  1VJV A;  4NV7 A;  1CB5 A;  1TU6 A;  3IMA A;  3MHH A;  1TL9 A;  1EWM A;  4BGF A;  3AI8 A;  2DC8 A;  3H8C A;  4X6H A;  1MIR A;  1PE6 A;  2IPP B;  1S4V A;  4B55 A;  3CH3 X;  3B79 A;  2PAD A;  3H8B A;  3S3R A;  5JA7 A;  3QT4 A;  1U9X A;  3DF0 A;  3OF9 A;  1PIP A;  5EGW A;  1YK7 A;  4YV8 A;  1EWL A;  3KSE A;  2AUZ A;  2DJG B;  3BOW A;  3P5V A;  1EF7 A;  2NQG A;  3I06 A;  1K3B B;  4DMX A;  3BPM A;  2AVW A;  2DJF B;  2HHN A;  2DC6 A;  1AYW A;  3PW3 A;  3KX1 A;  2H7J A;  4G54 A;  4GUZ A;  3WXG A;  4X6J A;  2HH5 A;  2YJ9 A;  2R6N A;  3IOQ A;  2DC7 A;  4FJC A;  1TLO A;  4X6I A;  3C9E A;  4CDF B;  1Q6K A;  3BCN A;  2HXZ A;  2F7D A;  3U8E A;  3WXE A;  2VHS A;  1NB3 A;  1M6D A;  2DZY A;  3N3G A;  3IUT A;  1GMY A;  4WA6 A;  3O1G A;  1MHW A;  1THE A;  4ZUX U;  3PBH A;  4MSX A;  3I3T A;  1VSN A;  4Q8H A;  4K7C A;  3N4C A;  3K9M A;  1NLJ A;  2YJC A;  4FK5 A;  1EWP A;  2AUX A;  3H6S A;  2FUD A;  3KWZ A;  3HD3 A;  7PCK A;  1CJL A;  4BS5 A;  3OVZ A;  4P6G A;  3NHE A;  1GLO A;  1KXR A;  9PAP A;  3BPF A;  1PPO A;  2BDL A;  5A24 A;  1QOL A;  2YJB A;  3RVX A;  4YYV A;  2OZ2 A;  1PPD A;  2GFO A;  2DC9 A;  1A6R A;  1KHP A;  1MEM A;  4FIP A;  2BDZ A;  4W5B A;  5PAD A;  1U9Q X;  3QJ3 A;  4QBB A;  2AU1 A;  4PAD A;  2O6X A;  8PCH A;  3IHP A;  1HUC B;  4QRG A;  3ERV A;  2FTD A;  4PP1 A;  2F1G A;  3HWN A;  3LFY A;  2YJ8 A;  3V6C A;  2R9N A;  1BY8 A;  1GEC E;  4MZS A;  3LXS A;  3MHS A;  1XKG A;  1KHQ A;  1NPZ A;  1F2A A;  5CHT A;  1W6F A;  3KW9 A;  2B1M A;  1AIM A;  1IWD A;  5K16 A;  5CVN B;  2NQD B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...