3BBAA

Structure of active wild-type prevotella intermedia interpain a cysteine protease
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
246
structure length
246
Chain Sequence
VIKPDPSKYAAEVSTLLTTTWGQQMPYNKLLPKTKKGRLITGCVATATAQVLNYFKYPVRGIGSHTVHYPANDPSGTAISADFGNTTYDWANMKDNYSGNYTEAEANAVATLMLHCGVASEMQYGGPNEGSGAYMTDCAAGLRTYFGFTDAEYITRANYTDEQWMDIVFSELTKGHPLIYGGVSPGSMGQDAGHAFVIDGYNKAGLVSVNWGWNGDVDGYYKIDLLNPGNMYSFTAEQDMVRGVYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords interpain A
publication title A New Autocatalytic Activation Mechanism for Cysteine Proteases Revealed by Prevotella intermedia Interpain A
pubmed doi rcsb
source organism Prevotella intermedia
total genus 60
structure length 246
sequence length 246
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01640 Peptidase_C10 Peptidase C10 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.50 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 3bbaA00
4D8BA 3BB7A 1PVJA 4D8EA 2JTCA 3BBAA 4D8IA 2UZJA 1DKIA 4RKXA
chains in the Genus database with same CATH superfamily
3D6SA 4FIPA 4YYUA 2DJGB 1KHPA 1CS8A 2AU1A 4OEMA 3K9MA 3KWZA 1U5IA 5E6JA 1VJVA 3IUTA 3KX1A 1YT7A 1NLJA 3BY4A 1PE6A 2OP3A 3PBHA 2NQDB 2R9MA 5F02A 3O65A 3BB7A 1GLOA 3DF0A 3V6CA 3PRMA 2NQGA 1ME4A 3RNVA 2R9NA 3CH2X 3C9EA 1THEA 1BP4A 4RNAA 2YJBA 5EZSA 1KXRA 1GMYA 2B1MA 2IBIA 3V6EA 2GHUA 3TRKA 3K8UA 1PPOA 1F2AA 3KFQA 4BOPA 1M6DA 4YYSA 1EWLA 4AXLA 1Y08A 1PXVA 3PSEA 2PNSA 1U9XA 4XR7A 2FQ9A 2XU1A 3B21A 1KFXL 4PP2E 3NHEA 1AIMA 1MHWA 1YZBA 1F2CA 3H7DA 3IHPA 2F1GA 3OISA 1YK8A 3OVXA 4BSQA 2DCDA 3HWNA 4PI3A 1PCIA 3CBJA 8PCHA 4BOZA 5CVNB 2DC8A 4D8IA 3OF9A 4BS6A 3OQCA 3QSDA 1PPDA 5CHTA 2P7UA 3KSEA 2HHNA 4W4UA 4MSXA 3H6SA 4YYQA 3HHIA 2R6NA 5EGWA 2BU3A 2ACTA 2JQGR 3N4CA 2XU3A 1EWPA 3KWBX 3BBAA 2G8EA 3MHSA 1PVJA 3N3GA 1MEMA 1QMYA 4YYWA 3CBKA 2HH5A 2AIMA 1PBHA 2C0YA 2AS8A 4BOQA 1AECA 2DZZA 5K16A 5JZEA 2AYNA 4YVAA 3IMAA 1CQDA 1TU6A 1CJLA 4M0WA 2BTWB 2FO5A 3WXGA 4PADA 4WURA 1NB5A 1GECE 1QOLA 2R9OA 1K3BB 3BCNA 3KKUA 2AUZA 2HWKA 3MTNA 4ZUXU 3F5VA 1AYVA 2DC6A 2FUDA 2AVWA 1YALA 1IWDA 1MEGA 4IUMA 4ZTBA 1PADA 1DEUA 1AYWA 5A24A 4A5UA 3BOWA 3W30A 3O0UA 1U9WA 1YK7A 4MI7A 1SP4B 4BOSA 3PHXA 4YV8A 5CVOB 4DMXA 3MP2A 1DKIA 2JRIA 4BPVA 1ZCMA 3TNXA 2DC7A 3PW3A 4OVZB 1MIRA 2R9FA 2E00A 4X6JA 2FRAA 1CVZA 2IPPB 4RF0A 4PP1A 2R9CA 2Y6EA 3AI8A 1KFUL 3H89A 4IP3A 5CHVA 1TL9A 4YYRA 3IFUA 2Z84A 4OVZA 2NQIA 3RVWA 2F7DA 1NB3A 2UZJA 4BOUA 1NL6A 5KO3A 3GCBA 1CB5A 2FTDA 4XZXA 1Q6KA 4RKXA 2G7YA 4CDFB 1Y4HA 1AU3A 1MDWA 3B79A 2DC9A 4CDDB 2G8JA 4MZOA 3N3KA 3ZNHA 3U8EA 2WBFX 1CPJA 2FRQA 4N4ZA 1AU2A 3OVZA 3E9SA 2OZ2A 4Q8GA 2P0RA 4OELA 3KW9A 4X6HA 4QH6A 1VSNA 1GCBA 1O0EA 4CDEB 2YJCA 2E01A 2DCBA 3LFYA 3BC3A 5JH3A 2AYOA 4PT5A 1PPNA 3PRPA 2FT2A 2P86A 4K7CA 3RVXA 4Q8HA 2AGAA 4FK5A 2Y5BA 2AUXA 3CH3X 3S3QA 2DZYA 1YVBA 4CDCB 4D8BA 3P5WA 1POPA 3TMPA 4P16A 4QRVA 5CVMA 1ME3A 1NQCA 4I07A 3W31A 1U9VA 2FE8A 3BWKA 2XU4A 2DCAA 1X9YA 1MS6A 7PCKA 2PBHA 2B1NA 1TLOA 1BQIA 4BS5A 3MJ5A 1QDQA 3P5XA 3PDFA 1ZIVA 3ERVA 4R3DA 2OULA 1PIPA 2BTWA 2H7JA 2HXZA 1XKGA 3P5VA 4RF1A 1EF7A 1EWMA 2J7QC 4RY2A 2BDZA 4QRXA 3LXSA 1KHQA 1HUCB 1UKFA 4MM3B 3S3RA 3MHHA 4I04A 4X6IA 3PHUA 1CTEA 3PHWA 2XU5A 3I06A 2ATOA 3I3TA 1AU0A 2YJ9A 3P5UA 1SNKA 3BPMA 4N8WA 2YJ2A 3ZUAA 4HWYA 1S4VA 6PADA 3H8CA 4W5CA 3C0RA 4I05A 1AU4A 1STFE 1ICFA 2FYEA 5J94A 2VHFA 4P6GA 2HD5A 2CIOA 4MZSA 5EF4A 2PREA 2E03A 1F2BA 4QBBA 4WA6A 1AYUA 3BPFA 4AXMA 3HHAA 2J7QA 4DMYA 4P6EA 5EZQA 3M99A 2DCCA 4KLBA 4W5BA 2DJFB 3H8BA 1QXPA 4BQVA 9PAPA 2JQFR 1A6RA 4CZWA 2E02A 1DF0A 4FJCA 3WXFA 3QT4A 2DOSA 4YYVA 4HXDB 2PADA 5JA7A 2VHSA 3PNRA 3E1ZB 1BY8A 4REZA 3USVA 3MTVA 1JQPA 1CSBB 3WXEA 5FPWA 1F29A 3O1GA 2CB5A 4XUIA 1EWOA 2BDLA 4QRGA 3K24A 3IEJA 2G6DA 3F75A 3HD3A 4G54A 2NQAA 3RVVA 1PPPA 3OF8A 3IOQA 1U9QX 3MORA 1CV8A 2O6XA 4D8EA 4GUAA 2JTCA 4OW0A 4N79A 1BGOA 2GFOA 2YJ8A 1NPZA 1ATKA 3PT2A 1ITOA 1FH0A 5PADA 3QJ3A 2ARYA 3IV2A
chains in the Genus database with same CATH topology
3BBAA 3E9SA 3C0RA 5E6JA 1PVJA 3BY4A 4BOQA 3O65A 3BB7A 4PT5A 5JZEA 3PRMA 3PRPA 3RNVA 2AGAA 4M0WA 2BTWB 2J7QA 4RNAA 5EZQA 4WURA 5EZSA 2HWKA 4D8BA 3TMPA 4P16A 4IUMA 4ZTBA 3W31A 2DOSA 4HXDB 3TRKA 2FE8A 4A5UA 3W30A 4BOPA 4MI7A 4BOSA 3PHXA 4REZA 3MTVA 3PSEA 3B21A 3MP2A 1DKIA 2JRIA 3MJ5A 4R3DA 4OVZB 2BTWA 4RF0A 1YZBA 4RF1A 4IP3A 4OVZA 3IFUA 2Z84A 2J7QC 1UKFA 2UZJA 4MM3B 4BOZA 4BOUA 4D8EA 4GUAA 2JTCA 4OW0A 4D8IA 3PHUA 5KO3A 4XZXA 3OQCA 4RKXA 3PHWA 3PT2A 3ZNHA 2BU3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4D8B A;  3BB7 A;  1PVJ A;  4D8E A;  2JTC A;  3BBA A;  4D8I A;  2UZJ A;  1DKI A;  4RKX A; 
#chains in the Genus database with same CATH topology
 3D6S A;  4FIP A;  4YYU A;  2DJG B;  1KHP A;  1CS8 A;  2AU1 A;  4OEM A;  3K9M A;  3KWZ A;  1U5I A;  5E6J A;  1VJV A;  3IUT A;  3KX1 A;  1YT7 A;  1NLJ A;  3BY4 A;  1PE6 A;  2OP3 A;  3PBH A;  2NQD B;  2R9M A;  5F02 A;  3O65 A;  3BB7 A;  1GLO A;  3DF0 A;  3V6C A;  3PRM A;  2NQG A;  1ME4 A;  3RNV A;  2R9N A;  3CH2 X;  3C9E A;  1THE A;  1BP4 A;  4RNA A;  2YJB A;  5EZS A;  1KXR A;  1GMY A;  2B1M A;  2IBI A;  3V6E A;  2GHU A;  3TRK A;  3K8U A;  1PPO A;  1F2A A;  3KFQ A;  4BOP A;  1M6D A;  4YYS A;  1EWL A;  4AXL A;  1Y08 A;  1PXV A;  3PSE A;  2PNS A;  1U9X A;  4XR7 A;  2FQ9 A;  2XU1 A;  3B21 A;  1KFX L;  4PP2 E;  3NHE A;  1AIM A;  1MHW A;  1YZB A;  1F2C A;  3H7D A;  3IHP A;  2F1G A;  3OIS A;  1YK8 A;  3OVX A;  4BSQ A;  2DCD A;  3HWN A;  4PI3 A;  1PCI A;  3CBJ A;  8PCH A;  4BOZ A;  5CVN B;  2DC8 A;  4D8I A;  3OF9 A;  4BS6 A;  3OQC A;  3QSD A;  1PPD A;  5CHT A;  2P7U A;  3KSE A;  2HHN A;  4W4U A;  4MSX A;  3H6S A;  4YYQ A;  3HHI A;  2R6N A;  5EGW A;  2BU3 A;  2ACT A;  2JQG R;  3N4C A;  2XU3 A;  1EWP A;  3KWB X;  3BBA A;  2G8E A;  3MHS A;  1PVJ A;  3N3G A;  1MEM A;  1QMY A;  4YYW A;  3CBK A;  2HH5 A;  2AIM A;  1PBH A;  2C0Y A;  2AS8 A;  4BOQ A;  1AEC A;  2DZZ A;  5K16 A;  5JZE A;  2AYN A;  4YVA A;  3IMA A;  1CQD A;  1TU6 A;  1CJL A;  4M0W A;  2BTW B;  2FO5 A;  3WXG A;  4PAD A;  4WUR A;  1NB5 A;  1GEC E;  1QOL A;  2R9O A;  1K3B B;  3BCN A;  3KKU A;  2AUZ A;  2HWK A;  3MTN A;  4ZUX U;  3F5V A;  1AYV A;  2DC6 A;  2FUD A;  2AVW A;  1YAL A;  1IWD A;  1MEG A;  4IUM A;  4ZTB A;  1PAD A;  1DEU A;  1AYW A;  5A24 A;  4A5U A;  3BOW A;  3W30 A;  3O0U A;  1U9W A;  1YK7 A;  4MI7 A;  1SP4 B;  4BOS A;  3PHX A;  4YV8 A;  5CVO B;  4DMX A;  3MP2 A;  1DKI A;  2JRI A;  4BPV A;  1ZCM A;  3TNX A;  2DC7 A;  3PW3 A;  4OVZ B;  1MIR A;  2R9F A;  2E00 A;  4X6J A;  2FRA A;  1CVZ A;  2IPP B;  4RF0 A;  4PP1 A;  2R9C A;  2Y6E A;  3AI8 A;  1KFU L;  3H89 A;  4IP3 A;  5CHV A;  1TL9 A;  4YYR A;  3IFU A;  2Z84 A;  4OVZ A;  2NQI A;  3RVW A;  2F7D A;  1NB3 A;  2UZJ A;  4BOU A;  1NL6 A;  5KO3 A;  3GCB A;  1CB5 A;  2FTD A;  4XZX A;  1Q6K A;  4RKX A;  2G7Y A;  4CDF B;  1Y4H A;  1AU3 A;  1MDW A;  3B79 A;  2DC9 A;  4CDD B;  2G8J A;  4MZO A;  3N3K A;  3ZNH A;  3U8E A;  2WBF X;  1CPJ A;  2FRQ A;  4N4Z A;  1AU2 A;  3OVZ A;  3E9S A;  2OZ2 A;  4Q8G A;  2P0R A;  4OEL A;  3KW9 A;  4X6H A;  4QH6 A;  1VSN A;  1GCB A;  1O0E A;  4CDE B;  2YJC A;  2E01 A;  2DCB A;  3LFY A;  3BC3 A;  5JH3 A;  2AYO A;  4PT5 A;  1PPN A;  3PRP A;  2FT2 A;  2P86 A;  4K7C A;  3RVX A;  4Q8H A;  2AGA A;  4FK5 A;  2Y5B A;  2AUX A;  3CH3 X;  3S3Q A;  2DZY A;  1YVB A;  4CDC B;  4D8B A;  3P5W A;  1POP A;  3TMP A;  4P16 A;  4QRV A;  5CVM A;  1ME3 A;  1NQC A;  4I07 A;  3W31 A;  1U9V A;  2FE8 A;  3BWK A;  2XU4 A;  2DCA A;  1X9Y A;  1MS6 A;  7PCK A;  2PBH A;  2B1N A;  1TLO A;  1BQI A;  4BS5 A;  3MJ5 A;  1QDQ A;  3P5X A;  3PDF A;  1ZIV A;  3ERV A;  4R3D A;  2OUL A;  1PIP A;  2BTW A;  2H7J A;  2HXZ A;  1XKG A;  3P5V A;  4RF1 A;  1EF7 A;  1EWM A;  2J7Q C;  4RY2 A;  2BDZ A;  4QRX A;  3LXS A;  1KHQ A;  1HUC B;  1UKF A;  4MM3 B;  3S3R A;  3MHH A;  4I04 A;  4X6I A;  3PHU A;  1CTE A;  3PHW A;  2XU5 A;  3I06 A;  2ATO A;  3I3T A;  1AU0 A;  2YJ9 A;  3P5U A;  1SNK A;  3BPM A;  4N8W A;  2YJ2 A;  3ZUA A;  4HWY A;  1S4V A;  6PAD A;  3H8C A;  4W5C A;  3C0R A;  4I05 A;  1AU4 A;  1STF E;  1ICF A;  2FYE A;  5J94 A;  2VHF A;  4P6G A;  2HD5 A;  2CIO A;  4MZS A;  5EF4 A;  2PRE A;  2E03 A;  1F2B A;  4QBB A;  4WA6 A;  1AYU A;  3BPF A;  4AXM A;  3HHA A;  2J7Q A;  4DMY A;  4P6E A;  5EZQ A;  3M99 A;  2DCC A;  4KLB A;  4W5B A;  2DJF B;  3H8B A;  1QXP A;  4BQV A;  9PAP A;  2JQF R;  1A6R A;  4CZW A;  2E02 A;  1DF0 A;  4FJC A;  3WXF A;  3QT4 A;  2DOS A;  4YYV A;  4HXD B;  2PAD A;  5JA7 A;  2VHS A;  3PNR A;  3E1Z B;  1BY8 A;  4REZ A;  3USV A;  3MTV A;  1JQP A;  1CSB B;  3WXE A;  5FPW A;  1F29 A;  3O1G A;  2CB5 A;  4XUI A;  1EWO A;  2BDL A;  4QRG A;  3K24 A;  3IEJ A;  2G6D A;  3F75 A;  3HD3 A;  4G54 A;  2NQA A;  3RVV A;  1PPP A;  3OF8 A;  3IOQ A;  1U9Q X;  3MOR A;  1CV8 A;  2O6X A;  4D8E A;  4GUA A;  2JTC A;  4OW0 A;  4N79 A;  1BGO A;  2GFO A;  2YJ8 A;  1NPZ A;  1ATK A;  3PT2 A;  1ITO A;  1FH0 A;  5PAD A;  3QJ3 A;  2ARY A;  3IV2 A; 
#chains in the Genus database with same CATH homology
 3BBA A;  3E9S A;  3C0R A;  5E6J A;  1PVJ A;  3BY4 A;  4BOQ A;  3O65 A;  3BB7 A;  4PT5 A;  5JZE A;  3PRM A;  3PRP A;  3RNV A;  2AGA A;  4M0W A;  2BTW B;  2J7Q A;  4RNA A;  5EZQ A;  4WUR A;  5EZS A;  2HWK A;  4D8B A;  3TMP A;  4P16 A;  4IUM A;  4ZTB A;  3W31 A;  2DOS A;  4HXD B;  3TRK A;  2FE8 A;  4A5U A;  3W30 A;  4BOP A;  4MI7 A;  4BOS A;  3PHX A;  4REZ A;  3MTV A;  3PSE A;  3B21 A;  3MP2 A;  1DKI A;  2JRI A;  3MJ5 A;  4R3D A;  4OVZ B;  2BTW A;  4RF0 A;  1YZB A;  4RF1 A;  4IP3 A;  4OVZ A;  3IFU A;  2Z84 A;  2J7Q C;  1UKF A;  2UZJ A;  4MM3 B;  4BOZ A;  4BOU A;  4D8E A;  4GUA A;  2JTC A;  4OW0 A;  4D8I A;  3PHU A;  5KO3 A;  4XZX A;  3OQC A;  4RKX A;  3PHW A;  3PT2 A;  3ZNH A;  2BU3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...