3BBAA

Structure of active wild-type prevotella intermedia interpain a cysteine protease
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
246
structure length
246
Chain Sequence
VIKPDPSKYAAEVSTLLTTTWGQQMPYNKLLPKTKKGRLITGCVATATAQVLNYFKYPVRGIGSHTVHYPANDPSGTAISADFGNTTYDWANMKDNYSGNYTEAEANAVATLMLHCGVASEMQYGGPNEGSGAYMTDCAAGLRTYFGFTDAEYITRANYTDEQWMDIVFSELTKGHPLIYGGVSPGSMGQDAGHAFVIDGYNKAGLVSVNWGWNGDVDGYYKIDLLNPGNMYSFTAEQDMVRGVYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords interpain A
publication title A New Autocatalytic Activation Mechanism for Cysteine Proteases Revealed by Prevotella intermedia Interpain A
pubmed doi rcsb
source organism Prevotella intermedia
molecule tags Hydrolase
total genus 60
structure length 246
sequence length 246
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01640 Peptidase_C10 Peptidase C10 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.50 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 3bbaA00
2JTCA 2UZJA 3BBAA 4D8EA 4D8BA 4RKXA 3BB7A 1PVJA 4D8IA 1DKIA
chains in the Genus database with same CATH superfamily
1AU2A 2DC7A 3PNRA 1ME4A 4YYWA 1U9QX 3OF8A 1CS8A 3OVXA 1MS6A 2NQIA 2G6DA 5EZSA 4QRVA 2Y5BA 4YYQA 5JH3A 4I04A 2JQGR 1CJLA 1PPDA 2AS8A 1FH0A 2AYNA 2DJFB 3E9SA 2AUXA 3CBJA 2DC8A 2FE8A 4R3DA 3CH3X 2DOSA 1Y4HA 2FYEA 1EF7A 4PP2E 4AXMA 2DCAA 4I07A 1A6RA 2E01A 3K24A 3HWNA 1YT7A 3C9EA 3H6SA 1DEUA 1PPPA 3MTVA 5CVMA 2ARYA 2VHSA 3H8CA 3BPMA 4A5UA 1TLOA 3KWZA 3QJ3A 3OVZA 3CBKA 2JQFR 3AI8A 4YVAA 3OQCA 1KFXL 3N4CA 4QBBA 2R9OA 1GCBA 4HWYA 2HWKA 4PADA 3PRMA 4QRXA 4CDCB 2DC6A 1YALA 1PE6A 3IOQA 1THEA 1CVZA 2XU3A 3D6SA 3IUTA 2G8JA 3NHEA 4QRGA 4P16A 2DJGB 1GECE 1ATKA 1VSNA 1K3BB 4WA6A 1ME3A 4YV8A 2BTWA 3PBHA 4D8BA 8PCHA 3MJ5A 4OW0A 3IEJA 4AXLA 4MZOA 3TRKA 3OF9A 3F5VA 4X6HA 4BOUA 2YJ8A 1IWDA 1GMYA 1U9VA 2FRAA 1EWMA 5F02A 2AUZA 3USVA 2G8EA 1NQCA 2AGAA 1F2CA 9PAPA 5PADA 3ZNHA 1QXPA 4X6JA 3W30A 4BOPA 3M99A 4YYVA 4RY2A 1CV8A 2O6XA 3BPFA 1SNKA 2AIMA 2C0YA 1AECA 1PADA 3LFYA 2DZYA 3B79A 3BOWA 3V6CA 3HD3A 2DCCA 1EWLA 2B1MA 2H7JA 3RVVA 1BY8A 2ATOA 2OULA 4N79A 1YZBA 5CVOB 3H89A 3O0UA 3CH2X 1PIPA 2FRQA 1YVBA 3IMAA 2JRIA 3U8EA 5K16A 2FT2A 3HHIA 2R9FA 4MI7A 4CDDB 4YYRA 1QDQA 5J94A 2R9MA 2HXZA 4OEMA 1EWOA 1O0EA 2DZZA 2R6NA 1QOLA 1PPOA 3BBAA 3MHHA 1TL9A 2HHNA 4GUAA 3F75A 4OELA 3H7DA 4XR7A 4XZXA 4RF1A 1X9YA 1CQDA 1DF0A 1CTEA 2OP3A 3HHAA 2FTDA 3P5VA 3P5WA 1KFUL 4PP1A 5JZEA 4XUIA 1PVJA 2AVWA 4X6IA 1MIRA 4OVZA 1MEMA 3BY4A 3DF0A 3KFQA 3RNVA 3RVWA 3PDFA 3PT2A 1STFE 1QMYA 4W5CA 2FO5A 1AU3A 2AU1A 4Q8GA 3P5XA 1HUCB 1PBHA 4FIPA 3K8UA 2P86A 2R9CA 1BQIA 2UZJA 4P6GA 3KWBX 4BSQA 2IPPB 4I05A 1GLOA 1ITOA 1NB5A 2CB5A 3I3TA 3GCBA 2E00A 1NB3A 2YJ2A 1EWPA 2B1NA 7PCKA 5FPWA 4D8IA 2BDLA 2XU5A 3W31A 1F29A 1U9XA 2PADA 4WURA 3WXGA 4YYUA 3BC3A 3B21A 3RVXA 1NPZA 3PSEA 1CSBB 3N3GA 1VJVA 2E03A 4ZTBA 1KHPA 2PNSA 2YJ9A 2GFOA 2DC9A 2XU1A 5EZQA 2NQAA 1BGOA 1AU0A 1CPJA 3PW3A 1CB5A 5A24A 1ZCMA 3KKUA 1ZIVA 4D8EA 3WXEA 4BPVA 2YJCA 1MEGA 3IFUA 2Y6EA 4M0WA 1TU6A 3PHUA 4BOQA 4RF0A 1AYWA 3P5UA 4FJCA 4BOZA 2F1GA 1Y08A 2AYOA 1SP4B 4MM3B 3H8BA 3OISA 4PI3A 4ZUXU 2BDZA 2PREA 4KLBA 4P6EA 2BU3A 4HXDB 1F2AA 2NQGA 2P0RA 1NLJA 4MSXA 1JQPA 2HD5A 5E6JA 3PHXA 3KW9A 5EGWA 3KSEA 3MORA 4PT5A 4Q8HA 3BCNA 1F2BA 2GHUA 4BS6A 2FQ9A 4N4ZA 4CZWA 2E02A 2DCBA 1NL6A 3MHSA 4IP3A 1PPNA 3O65A 4K7CA 1MHWA 4N8WA 1U9WA 4CDEB 2R9NA 1KHQA 1AYUA 3QT4A 3S3RA 2XU4A 3BWKA 4BOSA 3S3QA 2FUDA 2VHFA 2WBFX 3BB7A 2F7DA 3LXSA 2J7QC 5CHVA 3N3KA 1M6DA 1S4VA 1U5IA 4YYSA 2HH5A 2OZ2A 4DMXA 1AIMA 4BQVA 4OVZB 5JA7A 1AYVA 4REZA 5EF4A 4QH6A 4RKXA 4BS5A 1PCIA 1XKGA 3I06A 3PHWA 2G7YA 1MDWA 3ERVA 3TNXA 2P7UA 3KX1A 1AU4A 1DKIA 5KO3A 3IHPA 2J7QA 1Q6KA 2CIOA 3QSDA 3E1ZB 1POPA 2NQDB 3V6EA 2YJBA 3C0RA 4IUMA 2BTWB 3ZUAA 4DMYA 3MTNA 3O1GA 4FK5A 2ACTA 3PRPA 3K9MA 3TMPA 1PXVA 1BP4A 2Z84A 1KXRA 1UKFA 6PADA 2JTCA 3IV2A 5CVNB 1YK7A 4RNAA 2DCDA 3WXFA 5CHTA 2IBIA 4W5BA 4CDFB 4MZSA 4W4UA 1ICFA 2PBHA 1YK8A 4G54A 3MP2A
chains in the Genus database with same CATH topology
4PT5A 5EZSA 2UZJA 2AGAA 4IP3A 3ZNHA 3O65A 3W30A 4BOPA 3E9SA 4BOSA 2FE8A 4R3DA 2DOSA 3BB7A 4D8IA 3W31A 4WURA 2J7QC 1YZBA 3B21A 3PSEA 4ZTBA 4OVZB 4REZA 3MTVA 4RKXA 2JRIA 4A5UA 5EZQA 3PHWA 4MI7A 3OQCA 1DKIA 5KO3A 2J7QA 3BBAA 4D8EA 2HWKA 4GUAA 3PRMA 3C0RA 4IUMA 4XZXA 2BTWB 4RF1A 3IFUA 4M0WA 3PRPA 3PHUA 4BOQA 4RF0A 3TMPA 4P16A 2Z84A 1UKFA 4BOZA 2JTCA 5JZEA 4MM3B 1PVJA 4RNAA 4OVZA 3BY4A 2BTWA 4D8BA 3MJ5A 4OW0A 2BU3A 4HXDB 3RNVA 3TRKA 3MP2A 5E6JA 3PT2A 4BOUA 3PHXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JTC A;  2UZJ A;  3BBA A;  4D8E A;  4D8B A;  4RKX A;  3BB7 A;  1PVJ A;  4D8I A;  1DKI A; 
#chains in the Genus database with same CATH topology
 1AU2 A;  2DC7 A;  3PNR A;  1ME4 A;  4YYW A;  1U9Q X;  3OF8 A;  1CS8 A;  3OVX A;  1MS6 A;  2NQI A;  2G6D A;  5EZS A;  4QRV A;  2Y5B A;  4YYQ A;  5JH3 A;  4I04 A;  2JQG R;  1CJL A;  1PPD A;  2AS8 A;  1FH0 A;  2AYN A;  2DJF B;  3E9S A;  2AUX A;  3CBJ A;  2DC8 A;  2FE8 A;  4R3D A;  3CH3 X;  2DOS A;  1Y4H A;  2FYE A;  1EF7 A;  4PP2 E;  4AXM A;  2DCA A;  4I07 A;  1A6R A;  2E01 A;  3K24 A;  3HWN A;  1YT7 A;  3C9E A;  3H6S A;  1DEU A;  1PPP A;  3MTV A;  5CVM A;  2ARY A;  2VHS A;  3H8C A;  3BPM A;  4A5U A;  1TLO A;  3KWZ A;  3QJ3 A;  3OVZ A;  3CBK A;  2JQF R;  3AI8 A;  4YVA A;  3OQC A;  1KFX L;  3N4C A;  4QBB A;  2R9O A;  1GCB A;  4HWY A;  2HWK A;  4PAD A;  3PRM A;  4QRX A;  4CDC B;  2DC6 A;  1YAL A;  1PE6 A;  3IOQ A;  1THE A;  1CVZ A;  2XU3 A;  3D6S A;  3IUT A;  2G8J A;  3NHE A;  4QRG A;  4P16 A;  2DJG B;  1GEC E;  1ATK A;  1VSN A;  1K3B B;  4WA6 A;  1ME3 A;  4YV8 A;  2BTW A;  3PBH A;  4D8B A;  8PCH A;  3MJ5 A;  4OW0 A;  3IEJ A;  4AXL A;  4MZO A;  3TRK A;  3OF9 A;  3F5V A;  4X6H A;  4BOU A;  2YJ8 A;  1IWD A;  1GMY A;  1U9V A;  2FRA A;  1EWM A;  5F02 A;  2AUZ A;  3USV A;  2G8E A;  1NQC A;  2AGA A;  1F2C A;  9PAP A;  5PAD A;  3ZNH A;  1QXP A;  4X6J A;  3W30 A;  4BOP A;  3M99 A;  4YYV A;  4RY2 A;  1CV8 A;  2O6X A;  3BPF A;  1SNK A;  2AIM A;  2C0Y A;  1AEC A;  1PAD A;  3LFY A;  2DZY A;  3B79 A;  3BOW A;  3V6C A;  3HD3 A;  2DCC A;  1EWL A;  2B1M A;  2H7J A;  3RVV A;  1BY8 A;  2ATO A;  2OUL A;  4N79 A;  1YZB A;  5CVO B;  3H89 A;  3O0U A;  3CH2 X;  1PIP A;  2FRQ A;  1YVB A;  3IMA A;  2JRI A;  3U8E A;  5K16 A;  2FT2 A;  3HHI A;  2R9F A;  4MI7 A;  4CDD B;  4YYR A;  1QDQ A;  5J94 A;  2R9M A;  2HXZ A;  4OEM A;  1EWO A;  1O0E A;  2DZZ A;  2R6N A;  1QOL A;  1PPO A;  3BBA A;  3MHH A;  1TL9 A;  2HHN A;  4GUA A;  3F75 A;  4OEL A;  3H7D A;  4XR7 A;  4XZX A;  4RF1 A;  1X9Y A;  1CQD A;  1DF0 A;  1CTE A;  2OP3 A;  3HHA A;  2FTD A;  3P5V A;  3P5W A;  1KFU L;  4PP1 A;  5JZE A;  4XUI A;  1PVJ A;  2AVW A;  4X6I A;  1MIR A;  4OVZ A;  1MEM A;  3BY4 A;  3DF0 A;  3KFQ A;  3RNV A;  3RVW A;  3PDF A;  3PT2 A;  1STF E;  1QMY A;  4W5C A;  2FO5 A;  1AU3 A;  2AU1 A;  4Q8G A;  3P5X A;  1HUC B;  1PBH A;  4FIP A;  3K8U A;  2P86 A;  2R9C A;  1BQI A;  2UZJ A;  4P6G A;  3KWB X;  4BSQ A;  2IPP B;  4I05 A;  1GLO A;  1ITO A;  1NB5 A;  2CB5 A;  3I3T A;  3GCB A;  2E00 A;  1NB3 A;  2YJ2 A;  1EWP A;  2B1N A;  7PCK A;  5FPW A;  4D8I A;  2BDL A;  2XU5 A;  3W31 A;  1F29 A;  1U9X A;  2PAD A;  4WUR A;  3WXG A;  4YYU A;  3BC3 A;  3B21 A;  3RVX A;  1NPZ A;  3PSE A;  1CSB B;  3N3G A;  1VJV A;  2E03 A;  4ZTB A;  1KHP A;  2PNS A;  2YJ9 A;  2GFO A;  2DC9 A;  2XU1 A;  5EZQ A;  2NQA A;  1BGO A;  1AU0 A;  1CPJ A;  3PW3 A;  1CB5 A;  5A24 A;  1ZCM A;  3KKU A;  1ZIV A;  4D8E A;  3WXE A;  4BPV A;  2YJC A;  1MEG A;  3IFU A;  2Y6E A;  4M0W A;  1TU6 A;  3PHU A;  4BOQ A;  4RF0 A;  1AYW A;  3P5U A;  4FJC A;  4BOZ A;  2F1G A;  1Y08 A;  2AYO A;  1SP4 B;  4MM3 B;  3H8B A;  3OIS A;  4PI3 A;  4ZUX U;  2BDZ A;  2PRE A;  4KLB A;  4P6E A;  2BU3 A;  4HXD B;  1F2A A;  2NQG A;  2P0R A;  1NLJ A;  4MSX A;  1JQP A;  2HD5 A;  5E6J A;  3PHX A;  3KW9 A;  5EGW A;  3KSE A;  3MOR A;  4PT5 A;  4Q8H A;  3BCN A;  1F2B A;  2GHU A;  4BS6 A;  2FQ9 A;  4N4Z A;  4CZW A;  2E02 A;  2DCB A;  1NL6 A;  3MHS A;  4IP3 A;  1PPN A;  3O65 A;  4K7C A;  1MHW A;  4N8W A;  1U9W A;  4CDE B;  2R9N A;  1KHQ A;  1AYU A;  3QT4 A;  3S3R A;  2XU4 A;  3BWK A;  4BOS A;  3S3Q A;  2FUD A;  2VHF A;  2WBF X;  3BB7 A;  2F7D A;  3LXS A;  2J7Q C;  5CHV A;  3N3K A;  1M6D A;  1S4V A;  1U5I A;  4YYS A;  2HH5 A;  2OZ2 A;  4DMX A;  1AIM A;  4BQV A;  4OVZ B;  5JA7 A;  1AYV A;  4REZ A;  5EF4 A;  4QH6 A;  4RKX A;  4BS5 A;  1PCI A;  1XKG A;  3I06 A;  3PHW A;  2G7Y A;  1MDW A;  3ERV A;  3TNX A;  2P7U A;  3KX1 A;  1AU4 A;  1DKI A;  5KO3 A;  3IHP A;  2J7Q A;  1Q6K A;  2CIO A;  3QSD A;  3E1Z B;  1POP A;  2NQD B;  3V6E A;  2YJB A;  3C0R A;  4IUM A;  2BTW B;  3ZUA A;  4DMY A;  3MTN A;  3O1G A;  4FK5 A;  2ACT A;  3PRP A;  3K9M A;  3TMP A;  1PXV A;  1BP4 A;  2Z84 A;  1KXR A;  1UKF A;  6PAD A;  2JTC A;  3IV2 A;  5CVN B;  1YK7 A;  4RNA A;  2DCD A;  3WXF A;  5CHT A;  2IBI A;  4W5B A;  4CDF B;  4MZS A;  4W4U A;  1ICF A;  2PBH A;  1YK8 A;  4G54 A;  3MP2 A; 
#chains in the Genus database with same CATH homology
 4PT5 A;  5EZS A;  2UZJ A;  2AGA A;  4IP3 A;  3ZNH A;  3O65 A;  3W30 A;  4BOP A;  3E9S A;  4BOS A;  2FE8 A;  4R3D A;  2DOS A;  3BB7 A;  4D8I A;  3W31 A;  4WUR A;  2J7Q C;  1YZB A;  3B21 A;  3PSE A;  4ZTB A;  4OVZ B;  4REZ A;  3MTV A;  4RKX A;  2JRI A;  4A5U A;  5EZQ A;  3PHW A;  4MI7 A;  3OQC A;  1DKI A;  5KO3 A;  2J7Q A;  3BBA A;  4D8E A;  2HWK A;  4GUA A;  3PRM A;  3C0R A;  4IUM A;  4XZX A;  2BTW B;  4RF1 A;  3IFU A;  4M0W A;  3PRP A;  3PHU A;  4BOQ A;  4RF0 A;  3TMP A;  4P16 A;  2Z84 A;  1UKF A;  4BOZ A;  2JTC A;  5JZE A;  4MM3 B;  1PVJ A;  4RNA A;  4OVZ A;  3BY4 A;  2BTW A;  4D8B A;  3MJ5 A;  4OW0 A;  2BU3 A;  4HXD B;  3RNV A;  3TRK A;  3MP2 A;  5E6J A;  3PT2 A;  4BOU A;  3PHX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...