3C0RA

Structure of ovarian tumor (otu) domain in complex with ubiquitin
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
175
structure length
175
Chain Sequence
RVLKSTEMSIGGSGENVLSVHPVLDDNSCLFHAIAYGIFKQDSVRDLREMVSKEVLNNPVKFNDAILDKPNKDYAQWILKMESWGGAIEIGIISDALAVAIYVVDIDAVKIEKFNEDKFDNYILILFNGIHYDSLTMNEFKTVFNKNQPESDDVLTAALQLASNLKQTGYSFNTH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle, hydrolase
molecule keywords Ubiquitin thioesterase OTU1
publication title Structural basis for ubiquitin recognition by the Otu1 ovarian tumor domain protein
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 50
structure length 175
sequence length 175
chains with identical sequence C
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2008-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02338 OTU OTU-like cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.80 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 3c0rA00
3PHWA 4HXDB 4BOQA 3ZNHA 4BOSA 4BOUA 4BOZA 3BY4A 5JZEA 3C0RA 3PSEA 3PRMA 3PHUA 3PRPA 3TMPA 3PHXA 4BOPA 3PT2A
chains in the Genus database with same CATH superfamily
1PVJA 2E01A 3OF9A 4MI7A 3IFUA 2IBIA 1M6DA 3CBKA 1QMYA 2C0YA 4DMYA 1VJVA 2ACTA 1BQIA 2AVWA 4I05A 5CVNB 3BWKA 2DC6A 4PADA 1KFXL 1Y08A 2G7YA 2ARYA 3KW9A 2DJFB 5JZEA 2DCCA 5E6JA 4WA6A 1A6RA 5K16A 3CH3X 4I07A 1CSBB 3IEJA 3MTVA 1POPA 3OF8A 3H8CA 1YZBA 2AUZA 4Q8HA 4Q8GA 3C0RA 1PCIA 1GCBA 3O65A 2AUXA 4N8WA 4BSQA 3WXFA 1YALA 1K3BB 4YYWA 3N3GA 2AS8A 3MHHA 2DCDA 4K7CA 9PAPA 3HD3A 2JQGR 1GLOA 2R9CA 4OVZB 2JQFR 2FT2A 1CV8A 2R6NA 3HHIA 1AIMA 4DMXA 3PRPA 4YYSA 4RKXA 2FRAA 4CDEB 2IPPB 4X6JA 2P0RA 1PPOA 3PDFA 3ZUAA 4D8BA 2NQIA 1YK7A 3TNXA 3PNRA 3RNVA 3PHWA 1EF7A 3BPFA 3H6SA 5EZSA 5FPWA 2YJ9A 3RVVA 1ZCMA 2DCBA 1MDWA 2FYEA 4CZWA 4X6HA 2DJGB 4QRXA 5A24A 1YK8A 3IV2A 4MZSA 4CDDB 3QJ3A 1O0EA 7PCKA 2DZZA 1IWDA 2NQAA 3O0UA 5PADA 4P16A 1EWLA 1AYWA 3V6CA 4BOZA 1U9VA 4FJCA 2XU3A 1PXVA 3P5UA 1ICFA 1KHPA 2WBFX 2FRQA 1NB3A 4RY2A 1EWPA 3PRMA 3H8BA 2OZ2A 2R9MA 1PE6A 3B21A 4RNAA 3ERVA 4FK5A 3TRKA 3F5VA 2AYNA 1F2AA 2FQ9A 1NPZA 4W5BA 1AU0A 3PSEA 1MEGA 3K24A 2B1MA 1BGOA 3PW3A 2BTWA 1CS8A 1PPDA 3KFQA 2AGAA 3P5WA 5KO3A 2DCAA 2XU5A 2HXZA 5CVMA 1YVBA 4D8IA 3OVZA 3BCNA 1EWMA 3LXSA 4YYVA 3B79A 3LFYA 5J94A 2DC9A 3PT2A 4BOUA 2GFOA 3W31A 1DF0A 1FH0A 1QOLA 5EGWA 1ITOA 2XU1A 3MJ5A 1F2CA 3H7DA 2XU4A 4IP3A 1DKIA 1CVZA 3DF0A 4CDCB 4BOPA 4M0WA 1ZIVA 1CB5A 2P7UA 4YYUA 2NQDB 3RVXA 1HUCB 1AYVA 1PIPA 2G8JA 4RF1A 1PADA 4IUMA 1MEMA 1MIRA 3HHAA 6PADA 1U9WA 1ME4A 1CJLA 2E02A 3V6EA 1UKFA 1NL6A 4RF0A 2F7DA 1F29A 4MM3B 4P6EA 3BB7A 3WXGA 4YYQA 3N4CA 2BTWB 1TL9A 2VHSA 1XKGA 3IUTA 3N3KA 2YJCA 2P86A 4MZOA 3TMPA 2AIMA 3F75A 3H89A 3BC3A 2HH5A 1KXRA 2PBHA 2DZYA 1CQDA 2DOSA 2BDZA 2PADA 1NQCA 1U9QX 1AYUA 2OULA 1S4VA 3KKUA 2NQGA 1Q6KA 1KFUL 3E9SA 3I06A 2Y5BA 1U5IA 3QSDA 3C9EA 3BPMA 3I3TA 1ME3A 3P5XA 2G6DA 4BS5A 2AYOA 1AU3A 1NB5A 3K8UA 2O6XA 2HWKA 2R9FA 3PBHA 2B1NA 1SP4B 4PI3A 4OW0A 2J7QC 1AECA 2Z84A 4KLBA 1YT7A 2YJ8A 4A5UA 4X6IA 1SNKA 1BP4A 1Y4HA 1BY8A 2PNSA 2J7QA 4QRGA 4QRVA 3MHSA 2GHUA 2G8EA 3QT4A 1QDQA 4QBBA 4BPVA 4YVAA 3MTNA 4G54A 3IOQA 4N4ZA 4HWYA 3OISA 2R9NA 2DC7A 2HHNA 1THEA 2E03A 5JH3A 2VHFA 3IHPA 4FIPA 4P6GA 2HD5A 3PHUA 3PHXA 1CTEA 2FO5A 5CVOB 3ZNHA 4PT5A 3OVXA 2H7JA 2FUDA 1U9XA 1JQPA 2E00A 4HXDB 3USVA 1GECE 5EZQA 3S3QA 1CPJA 2BDLA 1X9YA 2F1GA 4OEMA 1DEUA 2JRIA 3BY4A 1PPNA 4W4UA 3MORA 2CIOA 3AI8A 4QH6A 3MP2A 5CHVA 3K9MA 1AU4A 2DC8A 4WURA 3IMAA 3M99A 1MS6A 4W5CA 1F2BA 3OQCA 1MHWA 2JTCA 3W30A 4CDFB 4N79A 3KWZA 4BOQA 4MSXA 3O1GA 3D6SA 4ZUXU 1TU6A 4YV8A 2CB5A 3CBJA 4XZXA 1ATKA 4OELA 4D8EA 4GUAA 1PPPA 3RVWA 4BS6A 4AXLA 1NLJA 4PP1A 4BQVA 1VSNA 2R9OA 3BOWA 4R3DA 1KHQA 5CHTA 2UZJA 4REZA 2BU3A 1QXPA 4XR7A 1EWOA 2YJ2A 4ZTBA 2ATOA 2AU1A 4I04A 2OP3A 3P5VA 2Y6EA 3KX1A 4OVZA 3WXEA 5EF4A 4PP2E 3S3RA 2PREA 3KWBX 4AXMA 1AU2A 2FE8A 1GMYA 3CH2X 3NHEA 3KSEA 3E1ZB 2FTDA 2YJBA 4YYRA 5F02A 1PBHA 4BOSA 1TLOA 5JA7A 3BBAA 3HWNA 1STFE 3GCBA 4XUIA 3U8EA 8PCHA
chains in the Genus database with same CATH topology
1PVJA 5EZQA 4MI7A 2BTWB 3IFUA 3PRMA 2JRIA 3BY4A 3B21A 4RNAA 3TMPA 3TRKA 3MP2A 4WURA 2DOSA 5JZEA 3PSEA 5E6JA 2BTWA 3OQCA 2JTCA 3W30A 3MTVA 2AGAA 5KO3A 1YZBA 4BOQA 3E9SA 3C0RA 3O65A 4D8IA 4XZXA 4D8EA 4GUAA 4OVZB 2HWKA 3PT2A 4BOUA 4R3DA 4OW0A 3W31A 2J7QC 3PRPA 2Z84A 2UZJA 3MJ5A 4REZA 2BU3A 4RKXA 4A5UA 4IP3A 1DKIA 4D8BA 2J7QA 4ZTBA 4BOPA 4M0WA 3RNVA 3PHWA 4OVZA 4RF1A 4IUMA 5EZSA 2FE8A 3PHUA 3PHXA 3ZNHA 4BOSA 1UKFA 4RF0A 4PT5A 4MM3B 4P16A 4HXDB 3BB7A 3BBAA 4BOZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PHW A;  4HXD B;  4BOQ A;  3ZNH A;  4BOS A;  4BOU A;  4BOZ A;  3BY4 A;  5JZE A;  3C0R A;  3PSE A;  3PRM A;  3PHU A;  3PRP A;  3TMP A;  3PHX A;  4BOP A;  3PT2 A; 
#chains in the Genus database with same CATH topology
 1PVJ A;  2E01 A;  3OF9 A;  4MI7 A;  3IFU A;  2IBI A;  1M6D A;  3CBK A;  1QMY A;  2C0Y A;  4DMY A;  1VJV A;  2ACT A;  1BQI A;  2AVW A;  4I05 A;  5CVN B;  3BWK A;  2DC6 A;  4PAD A;  1KFX L;  1Y08 A;  2G7Y A;  2ARY A;  3KW9 A;  2DJF B;  5JZE A;  2DCC A;  5E6J A;  4WA6 A;  1A6R A;  5K16 A;  3CH3 X;  4I07 A;  1CSB B;  3IEJ A;  3MTV A;  1POP A;  3OF8 A;  3H8C A;  1YZB A;  2AUZ A;  4Q8H A;  4Q8G A;  3C0R A;  1PCI A;  1GCB A;  3O65 A;  2AUX A;  4N8W A;  4BSQ A;  3WXF A;  1YAL A;  1K3B B;  4YYW A;  3N3G A;  2AS8 A;  3MHH A;  2DCD A;  4K7C A;  9PAP A;  3HD3 A;  2JQG R;  1GLO A;  2R9C A;  4OVZ B;  2JQF R;  2FT2 A;  1CV8 A;  2R6N A;  3HHI A;  1AIM A;  4DMX A;  3PRP A;  4YYS A;  4RKX A;  2FRA A;  4CDE B;  2IPP B;  4X6J A;  2P0R A;  1PPO A;  3PDF A;  3ZUA A;  4D8B A;  2NQI A;  1YK7 A;  3TNX A;  3PNR A;  3RNV A;  3PHW A;  1EF7 A;  3BPF A;  3H6S A;  5EZS A;  5FPW A;  2YJ9 A;  3RVV A;  1ZCM A;  2DCB A;  1MDW A;  2FYE A;  4CZW A;  4X6H A;  2DJG B;  4QRX A;  5A24 A;  1YK8 A;  3IV2 A;  4MZS A;  4CDD B;  3QJ3 A;  1O0E A;  7PCK A;  2DZZ A;  1IWD A;  2NQA A;  3O0U A;  5PAD A;  4P16 A;  1EWL A;  1AYW A;  3V6C A;  4BOZ A;  1U9V A;  4FJC A;  2XU3 A;  1PXV A;  3P5U A;  1ICF A;  1KHP A;  2WBF X;  2FRQ A;  1NB3 A;  4RY2 A;  1EWP A;  3PRM A;  3H8B A;  2OZ2 A;  2R9M A;  1PE6 A;  3B21 A;  4RNA A;  3ERV A;  4FK5 A;  3TRK A;  3F5V A;  2AYN A;  1F2A A;  2FQ9 A;  1NPZ A;  4W5B A;  1AU0 A;  3PSE A;  1MEG A;  3K24 A;  2B1M A;  1BGO A;  3PW3 A;  2BTW A;  1CS8 A;  1PPD A;  3KFQ A;  2AGA A;  3P5W A;  5KO3 A;  2DCA A;  2XU5 A;  2HXZ A;  5CVM A;  1YVB A;  4D8I A;  3OVZ A;  3BCN A;  1EWM A;  3LXS A;  4YYV A;  3B79 A;  3LFY A;  5J94 A;  2DC9 A;  3PT2 A;  4BOU A;  2GFO A;  3W31 A;  1DF0 A;  1FH0 A;  1QOL A;  5EGW A;  1ITO A;  2XU1 A;  3MJ5 A;  1F2C A;  3H7D A;  2XU4 A;  4IP3 A;  1DKI A;  1CVZ A;  3DF0 A;  4CDC B;  4BOP A;  4M0W A;  1ZIV A;  1CB5 A;  2P7U A;  4YYU A;  2NQD B;  3RVX A;  1HUC B;  1AYV A;  1PIP A;  2G8J A;  4RF1 A;  1PAD A;  4IUM A;  1MEM A;  1MIR A;  3HHA A;  6PAD A;  1U9W A;  1ME4 A;  1CJL A;  2E02 A;  3V6E A;  1UKF A;  1NL6 A;  4RF0 A;  2F7D A;  1F29 A;  4MM3 B;  4P6E A;  3BB7 A;  3WXG A;  4YYQ A;  3N4C A;  2BTW B;  1TL9 A;  2VHS A;  1XKG A;  3IUT A;  3N3K A;  2YJC A;  2P86 A;  4MZO A;  3TMP A;  2AIM A;  3F75 A;  3H89 A;  3BC3 A;  2HH5 A;  1KXR A;  2PBH A;  2DZY A;  1CQD A;  2DOS A;  2BDZ A;  2PAD A;  1NQC A;  1U9Q X;  1AYU A;  2OUL A;  1S4V A;  3KKU A;  2NQG A;  1Q6K A;  1KFU L;  3E9S A;  3I06 A;  2Y5B A;  1U5I A;  3QSD A;  3C9E A;  3BPM A;  3I3T A;  1ME3 A;  3P5X A;  2G6D A;  4BS5 A;  2AYO A;  1AU3 A;  1NB5 A;  3K8U A;  2O6X A;  2HWK A;  2R9F A;  3PBH A;  2B1N A;  1SP4 B;  4PI3 A;  4OW0 A;  2J7Q C;  1AEC A;  2Z84 A;  4KLB A;  1YT7 A;  2YJ8 A;  4A5U A;  4X6I A;  1SNK A;  1BP4 A;  1Y4H A;  1BY8 A;  2PNS A;  2J7Q A;  4QRG A;  4QRV A;  3MHS A;  2GHU A;  2G8E A;  3QT4 A;  1QDQ A;  4QBB A;  4BPV A;  4YVA A;  3MTN A;  4G54 A;  3IOQ A;  4N4Z A;  4HWY A;  3OIS A;  2R9N A;  2DC7 A;  2HHN A;  1THE A;  2E03 A;  5JH3 A;  2VHF A;  3IHP A;  4FIP A;  4P6G A;  2HD5 A;  3PHU A;  3PHX A;  1CTE A;  2FO5 A;  5CVO B;  3ZNH A;  4PT5 A;  3OVX A;  2H7J A;  2FUD A;  1U9X A;  1JQP A;  2E00 A;  4HXD B;  3USV A;  1GEC E;  5EZQ A;  3S3Q A;  1CPJ A;  2BDL A;  1X9Y A;  2F1G A;  4OEM A;  1DEU A;  2JRI A;  3BY4 A;  1PPN A;  4W4U A;  3MOR A;  2CIO A;  3AI8 A;  4QH6 A;  3MP2 A;  5CHV A;  3K9M A;  1AU4 A;  2DC8 A;  4WUR A;  3IMA A;  3M99 A;  1MS6 A;  4W5C A;  1F2B A;  3OQC A;  1MHW A;  2JTC A;  3W30 A;  4CDF B;  4N79 A;  3KWZ A;  4BOQ A;  4MSX A;  3O1G A;  3D6S A;  4ZUX U;  1TU6 A;  4YV8 A;  2CB5 A;  3CBJ A;  4XZX A;  1ATK A;  4OEL A;  4D8E A;  4GUA A;  1PPP A;  3RVW A;  4BS6 A;  4AXL A;  1NLJ A;  4PP1 A;  4BQV A;  1VSN A;  2R9O A;  3BOW A;  4R3D A;  1KHQ A;  5CHT A;  2UZJ A;  4REZ A;  2BU3 A;  1QXP A;  4XR7 A;  1EWO A;  2YJ2 A;  4ZTB A;  2ATO A;  2AU1 A;  4I04 A;  2OP3 A;  3P5V A;  2Y6E A;  3KX1 A;  4OVZ A;  3WXE A;  5EF4 A;  4PP2 E;  3S3R A;  2PRE A;  3KWB X;  4AXM A;  1AU2 A;  2FE8 A;  1GMY A;  3CH2 X;  3NHE A;  3KSE A;  3E1Z B;  2FTD A;  2YJB A;  4YYR A;  5F02 A;  1PBH A;  4BOS A;  1TLO A;  5JA7 A;  3BBA A;  3HWN A;  1STF E;  3GCB A;  4XUI A;  3U8E A;  8PCH A; 
#chains in the Genus database with same CATH homology
 1PVJ A;  5EZQ A;  4MI7 A;  2BTW B;  3IFU A;  3PRM A;  2JRI A;  3BY4 A;  3B21 A;  4RNA A;  3TMP A;  3TRK A;  3MP2 A;  4WUR A;  2DOS A;  5JZE A;  3PSE A;  5E6J A;  2BTW A;  3OQC A;  2JTC A;  3W30 A;  3MTV A;  2AGA A;  5KO3 A;  1YZB A;  4BOQ A;  3E9S A;  3C0R A;  3O65 A;  4D8I A;  4XZX A;  4D8E A;  4GUA A;  4OVZ B;  2HWK A;  3PT2 A;  4BOU A;  4R3D A;  4OW0 A;  3W31 A;  2J7Q C;  3PRP A;  2Z84 A;  2UZJ A;  3MJ5 A;  4REZ A;  2BU3 A;  4RKX A;  4A5U A;  4IP3 A;  1DKI A;  4D8B A;  2J7Q A;  4ZTB A;  4BOP A;  4M0W A;  3RNV A;  3PHW A;  4OVZ A;  4RF1 A;  4IUM A;  5EZS A;  2FE8 A;  3PHU A;  3PHX A;  3ZNH A;  4BOS A;  1UKF A;  4RF0 A;  4PT5 A;  4MM3 B;  4P16 A;  4HXD B;  3BB7 A;  3BBA A;  4BOZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...