3C0RA

Structure of ovarian tumor (otu) domain in complex with ubiquitin
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
175
structure length
175
Chain Sequence
b'RVLKSTEMSIGGSGENVLSVHPVLDDNSCLFHAIAYGIFKQDSVRDLREMVSKEVLNNPVKFNDAILDKPNKDYAQWILKMESWGGAIEIGIISDALAVAIYVVDIDAVKIEKFNEDKFDNYILILFNGIHYDSLTMNEFKTVFNKNQPESDDVLTAALQLASNLKQTGYSFNTH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin thioesterase OTU1
publication title Structural basis for ubiquitin recognition by the Otu1 ovarian tumor domain protein
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Cell cycle, hydrolase
total genus 50
structure length 175
sequence length 175
chains with identical sequence C
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2008-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02338 OTU OTU-like cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.80 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 3c0rA00
3PRPA 4BOQA 3PRMA 3C0RA 3PSEA 3TMPA 5JZEA 3PHXA 4BOZA 3BY4A 3PHUA 3PHWA 4BOUA 3PT2A 4BOSA 4BOPA 3ZNHA 4HXDB
chains in the Genus database with same CATH superfamily
1POPA 1TL9A 2XU1A 3B21A 1GECE 4QRGA 2DZZA 3HWNA 3QSDA 3MJ5A 1DF0A 2WBFX 3M99A 2Y5BA 1AYWA 1SNKA 5EZQA 1ME3A 4MI7A 4QRXA 3OF8A 1DKIA 3KFQA 4OEMA 1NLJA 3KWZA 3I3TA 4W4UA 2Z84A 1ZIVA 2NQDB 4N8WA 1EWOA 2J7QA 2P0RA 4I05A 1Y4HA 3H7DA 5JH3A 1GCBA 1ATKA 2HXZA 1M6DA 3MTVA 4CDFB 3E1ZB 1KHQA 1EWMA 1PPNA 4MM3B 2AIMA 6PADA 2R9MA 1PPOA 1KXRA 1KFUL 3O0UA 2AS8A 3O1GA 2FT2A 2FRQA 2R6NA 1CV8A 3DF0A 2OULA 2E02A 2GHUA 2JQFR 2NQIA 1AECA 1JQPA 2YJ2A 3F5VA 1YVBA 4OVZA 2FQ9A 2HHNA 4FK5A 4BOPA 4XZXA 3PSEA 1A6RA 2CB5A 2B1MA 3BC3A 1PE6A 3BCNA 4D8IA 3RVWA 1GMYA 4BOSA 2YJCA 1VSNA 4OELA 3BY4A 1BP4A 2G6DA 4PT5A 1U9VA 3PRPA 4W5BA 3V6EA 4YYVA 2GFOA 2DOSA 2ARYA 2DCAA 2JRIA 1NB3A 3PHWA 3O65A 2OZ2A 3QJ3A 1PPPA 9PAPA 3OVXA 4GUAA 2DC6A 3PHUA 1QDQA 4RF1A 2FUDA 1UKFA 4D8EA 1U9QX 1QXPA 2AU1A 2HD5A 4BOQA 2JTCA 2PBHA 3HHAA 1PXVA 2BDZA 1Q6KA 2DJFB 4Q8GA 3IFUA 3W30A 1F2AA 1F29A 2YJ9A 3OQCA 2O6XA 3KX1A 4CDEB 2UZJA 3OVZA 4WA6A 5FPWA 4DMXA 2PNSA 1O0EA 3C0RA 4IUMA 4MSXA 1ME4A 2F7DA 1BQIA 2R9CA 2IBIA 1YK8A 2AYNA 3MORA 3IOQA 3TMPA 4OW0A 4YVAA 2PREA 2Y6EA 1YK7A 3AI8A 3KKUA 3IV2A 3W31A 4YYWA 2NQAA 2DC8A 2R9NA 1PBHA 1U5IA 2E00A 4BOUA 2BDLA 3P5VA 4YYSA 3RNVA 5EF4A 3HD3A 2FRAA 4D8BA 1VJVA 2DC7A 1PCIA 3PRMA 4W5CA 3WXGA 1EWPA 4QRVA 3H6SA 4K7CA 4R3DA 5EGWA 2AGAA 4QH6A 4MZOA 2XU5A 2DZYA 3IEJA 2AUXA 2YJBA 3PHXA 2AUZA 3PT2A 4BS5A 4PP1A 3ZUAA 3BBAA 2HH5A 3V6CA 7PCKA 3LXSA 1K3BB 3MTNA 3K9MA 3P5WA 1AU4A 4KLBA 2FO5A 4IP3A 3K24A 4Q8HA 1YALA 4PP2E 1CQDA 1PVJA 4FJCA 1ZCMA 4X6HA 1FH0A 4RKXA 2E01A 3I06A 1MIRA 4HXDB 4BSQA 3KW9A 1MEGA 1MHWA 3N3GA 4BS6A 2R9FA 4CZWA 2FE8A 4X6IA 3N3KA 3HHIA 4RF0A 1TLOA 1NL6A 3PW3A 3CBKA 2DJGB 2DCCA 5K16A 4CDCB 2OP3A 2R9OA 4ZUXU 1PPDA 1BY8A 4XUIA 1AYVA 2C0YA 1YT7A 3USVA 1AU2A 8PCHA 4WURA 1AU3A 4HWYA 1NPZA 2NQGA 2HWKA 4ZTBA 4PADA 4P16A 3TRKA 3ERVA 3C9EA 3PBHA 1QMYA 4P6EA 1X9YA 3IMAA 1AYUA 2F1GA 4A5UA 1BGOA 2FTDA 3H8BA 4CDDB 1QOLA 2AVWA 1U9WA 3S3RA 5J94A 1DEUA 1PADA 1SP4B 3WXEA 3F75A 4M0WA 3KWBX 2XU4A 2DCBA 1EF7A 3IHPA 4REZA 1YZBA 4N79A 5JZEA 4PI3A 3QT4A 1S4VA 1IWDA 2P7UA 3D6SA 3MHHA 5KO3A 2J7QC 2P86A 3BOWA 3H8CA 3ZNHA 2E03A 3U8EA 1ICFA 5CVNB 1STFE 1CJLA 3BWKA 1THEA 1NQCA 1CB5A 3WXFA 2ACTA 3CH3X 4RY2A 3N4CA 3PDFA 5PADA 1MS6A 2DC9A 1PIPA 1TU6A 1CVZA 5CHVA 3S3QA 4BOZA 2XU3A 5A24A 2CIOA 1NB5A 4N4ZA 2VHSA 2DCDA 1CPJA 3H89A 4YYUA 4RNAA 1KFXL 2VHFA 1Y08A 2BTWB 1HUCB 2BTWA 3OISA 5EZSA 2H7JA 4DMYA 3MP2A 1MDWA 2G8EA 1KHPA 2ATOA 4FIPA 4OVZB 2B1NA 3CH2X 5F02A 1U9XA 3NHEA 3OF9A 1EWLA 1F2CA 3BPMA 4I04A 2G8JA 4QBBA 4AXMA 2JQGR 1CTEA 2AYOA 1AIMA 2YJ8A 1CSBB 4XR7A 4BQVA 3GCBA 3P5XA 1F2BA 4AXLA 3LFYA 5CHTA 4BPVA 3IUTA 3RVXA 1XKGA 3P5UA 1MEMA 2FYEA 3MHSA 4X6JA 3B79A 1AU0A 3BB7A 2IPPB 2G7YA 1CS8A 2PADA 1GLOA 4MZSA 3TNXA 5CVOB 4YYQA 2BU3A 4I07A 3KSEA 4G54A 5CVMA 4YV8A 3PNRA 3BPFA 3RVVA 3E9SA 4P6GA 1ITOA 4YYRA 5E6JA 3K8UA 3CBJA 5JA7A
chains in the Genus database with same CATH topology
2DOSA 2JRIA 3PHWA 3B21A 3O65A 3MJ5A 4IP3A 4GUAA 3PHUA 4RF1A 5EZQA 1PVJA 1UKFA 4MI7A 4D8EA 4RKXA 1DKIA 4HXDB 4BOQA 2JTCA 4BOZA 2Z84A 3IFUA 3W30A 2J7QA 2FE8A 4RF0A 3OQCA 4RNAA 2BTWB 2BTWA 2UZJA 5EZSA 3MP2A 4IUMA 3C0RA 3TMPA 4OVZB 4WURA 3MTVA 4OW0A 2HWKA 4ZTBA 4P16A 3TRKA 4MM3B 3W31A 4BOUA 4A5UA 3RNVA 4D8BA 4OVZA 4BOPA 4XZXA 3PRMA 3PSEA 4M0WA 3BB7A 4R3DA 4D8IA 2AGAA 4REZA 1YZBA 4BOSA 2BU3A 5JZEA 3PHXA 3BY4A 3PT2A 4PT5A 3PRPA 3E9SA 3BBAA 5E6JA 5KO3A 2J7QC 3ZNHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PRP A;  4BOQ A;  3PRM A;  3C0R A;  3PSE A;  3TMP A;  5JZE A;  3PHX A;  4BOZ A;  3BY4 A;  3PHU A;  3PHW A;  4BOU A;  3PT2 A;  4BOS A;  4BOP A;  3ZNH A;  4HXD B; 
#chains in the Genus database with same CATH topology
 1POP A;  1TL9 A;  2XU1 A;  3B21 A;  1GEC E;  4QRG A;  2DZZ A;  3HWN A;  3QSD A;  3MJ5 A;  1DF0 A;  2WBF X;  3M99 A;  2Y5B A;  1AYW A;  1SNK A;  5EZQ A;  1ME3 A;  4MI7 A;  4QRX A;  3OF8 A;  1DKI A;  3KFQ A;  4OEM A;  1NLJ A;  3KWZ A;  3I3T A;  4W4U A;  2Z84 A;  1ZIV A;  2NQD B;  4N8W A;  1EWO A;  2J7Q A;  2P0R A;  4I05 A;  1Y4H A;  3H7D A;  5JH3 A;  1GCB A;  1ATK A;  2HXZ A;  1M6D A;  3MTV A;  4CDF B;  3E1Z B;  1KHQ A;  1EWM A;  1PPN A;  4MM3 B;  2AIM A;  6PAD A;  2R9M A;  1PPO A;  1KXR A;  1KFU L;  3O0U A;  2AS8 A;  3O1G A;  2FT2 A;  2FRQ A;  2R6N A;  1CV8 A;  3DF0 A;  2OUL A;  2E02 A;  2GHU A;  2JQF R;  2NQI A;  1AEC A;  1JQP A;  2YJ2 A;  3F5V A;  1YVB A;  4OVZ A;  2FQ9 A;  2HHN A;  4FK5 A;  4BOP A;  4XZX A;  3PSE A;  1A6R A;  2CB5 A;  2B1M A;  3BC3 A;  1PE6 A;  3BCN A;  4D8I A;  3RVW A;  1GMY A;  4BOS A;  2YJC A;  1VSN A;  4OEL A;  3BY4 A;  1BP4 A;  2G6D A;  4PT5 A;  1U9V A;  3PRP A;  4W5B A;  3V6E A;  4YYV A;  2GFO A;  2DOS A;  2ARY A;  2DCA A;  2JRI A;  1NB3 A;  3PHW A;  3O65 A;  2OZ2 A;  3QJ3 A;  1PPP A;  9PAP A;  3OVX A;  4GUA A;  2DC6 A;  3PHU A;  1QDQ A;  4RF1 A;  2FUD A;  1UKF A;  4D8E A;  1U9Q X;  1QXP A;  2AU1 A;  2HD5 A;  4BOQ A;  2JTC A;  2PBH A;  3HHA A;  1PXV A;  2BDZ A;  1Q6K A;  2DJF B;  4Q8G A;  3IFU A;  3W30 A;  1F2A A;  1F29 A;  2YJ9 A;  3OQC A;  2O6X A;  3KX1 A;  4CDE B;  2UZJ A;  3OVZ A;  4WA6 A;  5FPW A;  4DMX A;  2PNS A;  1O0E A;  3C0R A;  4IUM A;  4MSX A;  1ME4 A;  2F7D A;  1BQI A;  2R9C A;  2IBI A;  1YK8 A;  2AYN A;  3MOR A;  3IOQ A;  3TMP A;  4OW0 A;  4YVA A;  2PRE A;  2Y6E A;  1YK7 A;  3AI8 A;  3KKU A;  3IV2 A;  3W31 A;  4YYW A;  2NQA A;  2DC8 A;  2R9N A;  1PBH A;  1U5I A;  2E00 A;  4BOU A;  2BDL A;  3P5V A;  4YYS A;  3RNV A;  5EF4 A;  3HD3 A;  2FRA A;  4D8B A;  1VJV A;  2DC7 A;  1PCI A;  3PRM A;  4W5C A;  3WXG A;  1EWP A;  4QRV A;  3H6S A;  4K7C A;  4R3D A;  5EGW A;  2AGA A;  4QH6 A;  4MZO A;  2XU5 A;  2DZY A;  3IEJ A;  2AUX A;  2YJB A;  3PHX A;  2AUZ A;  3PT2 A;  4BS5 A;  4PP1 A;  3ZUA A;  3BBA A;  2HH5 A;  3V6C A;  7PCK A;  3LXS A;  1K3B B;  3MTN A;  3K9M A;  3P5W A;  1AU4 A;  4KLB A;  2FO5 A;  4IP3 A;  3K24 A;  4Q8H A;  1YAL A;  4PP2 E;  1CQD A;  1PVJ A;  4FJC A;  1ZCM A;  4X6H A;  1FH0 A;  4RKX A;  2E01 A;  3I06 A;  1MIR A;  4HXD B;  4BSQ A;  3KW9 A;  1MEG A;  1MHW A;  3N3G A;  4BS6 A;  2R9F A;  4CZW A;  2FE8 A;  4X6I A;  3N3K A;  3HHI A;  4RF0 A;  1TLO A;  1NL6 A;  3PW3 A;  3CBK A;  2DJG B;  2DCC A;  5K16 A;  4CDC B;  2OP3 A;  2R9O A;  4ZUX U;  1PPD A;  1BY8 A;  4XUI A;  1AYV A;  2C0Y A;  1YT7 A;  3USV A;  1AU2 A;  8PCH A;  4WUR A;  1AU3 A;  4HWY A;  1NPZ A;  2NQG A;  2HWK A;  4ZTB A;  4PAD A;  4P16 A;  3TRK A;  3ERV A;  3C9E A;  3PBH A;  1QMY A;  4P6E A;  1X9Y A;  3IMA A;  1AYU A;  2F1G A;  4A5U A;  1BGO A;  2FTD A;  3H8B A;  4CDD B;  1QOL A;  2AVW A;  1U9W A;  3S3R A;  5J94 A;  1DEU A;  1PAD A;  1SP4 B;  3WXE A;  3F75 A;  4M0W A;  3KWB X;  2XU4 A;  2DCB A;  1EF7 A;  3IHP A;  4REZ A;  1YZB A;  4N79 A;  5JZE A;  4PI3 A;  3QT4 A;  1S4V A;  1IWD A;  2P7U A;  3D6S A;  3MHH A;  5KO3 A;  2J7Q C;  2P86 A;  3BOW A;  3H8C A;  3ZNH A;  2E03 A;  3U8E A;  1ICF A;  5CVN B;  1STF E;  1CJL A;  3BWK A;  1THE A;  1NQC A;  1CB5 A;  3WXF A;  2ACT A;  3CH3 X;  4RY2 A;  3N4C A;  3PDF A;  5PAD A;  1MS6 A;  2DC9 A;  1PIP A;  1TU6 A;  1CVZ A;  5CHV A;  3S3Q A;  4BOZ A;  2XU3 A;  5A24 A;  2CIO A;  1NB5 A;  4N4Z A;  2VHS A;  2DCD A;  1CPJ A;  3H89 A;  4YYU A;  4RNA A;  1KFX L;  2VHF A;  1Y08 A;  2BTW B;  1HUC B;  2BTW A;  3OIS A;  5EZS A;  2H7J A;  4DMY A;  3MP2 A;  1MDW A;  2G8E A;  1KHP A;  2ATO A;  4FIP A;  4OVZ B;  2B1N A;  3CH2 X;  5F02 A;  1U9X A;  3NHE A;  3OF9 A;  1EWL A;  1F2C A;  3BPM A;  4I04 A;  2G8J A;  4QBB A;  4AXM A;  2JQG R;  1CTE A;  2AYO A;  1AIM A;  2YJ8 A;  1CSB B;  4XR7 A;  4BQV A;  3GCB A;  3P5X A;  1F2B A;  4AXL A;  3LFY A;  5CHT A;  4BPV A;  3IUT A;  3RVX A;  1XKG A;  3P5U A;  1MEM A;  2FYE A;  3MHS A;  4X6J A;  3B79 A;  1AU0 A;  3BB7 A;  2IPP B;  2G7Y A;  1CS8 A;  2PAD A;  1GLO A;  4MZS A;  3TNX A;  5CVO B;  4YYQ A;  2BU3 A;  4I07 A;  3KSE A;  4G54 A;  5CVM A;  4YV8 A;  3PNR A;  3BPF A;  3RVV A;  3E9S A;  4P6G A;  1ITO A;  4YYR A;  5E6J A;  3K8U A;  3CBJ A;  5JA7 A; 
#chains in the Genus database with same CATH homology
 2DOS A;  2JRI A;  3PHW A;  3B21 A;  3O65 A;  3MJ5 A;  4IP3 A;  4GUA A;  3PHU A;  4RF1 A;  5EZQ A;  1PVJ A;  1UKF A;  4MI7 A;  4D8E A;  4RKX A;  1DKI A;  4HXD B;  4BOQ A;  2JTC A;  4BOZ A;  2Z84 A;  3IFU A;  3W30 A;  2J7Q A;  2FE8 A;  4RF0 A;  3OQC A;  4RNA A;  2BTW B;  2BTW A;  2UZJ A;  5EZS A;  3MP2 A;  4IUM A;  3C0R A;  3TMP A;  4OVZ B;  4WUR A;  3MTV A;  4OW0 A;  2HWK A;  4ZTB A;  4P16 A;  3TRK A;  4MM3 B;  3W31 A;  4BOU A;  4A5U A;  3RNV A;  4D8B A;  4OVZ A;  4BOP A;  4XZX A;  3PRM A;  3PSE A;  4M0W A;  3BB7 A;  4R3D A;  4D8I A;  2AGA A;  4REZ A;  1YZB A;  4BOS A;  2BU3 A;  5JZE A;  3PHX A;  3BY4 A;  3PT2 A;  4PT5 A;  3PRP A;  3E9S A;  3BBA A;  5E6J A;  5KO3 A;  2J7Q C;  3ZNH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...