3C0RA

Structure of ovarian tumor (otu) domain in complex with ubiquitin
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
175
structure length
175
Chain Sequence
RVLKSTEMSIGGSGENVLSVHPVLDDNSCLFHAIAYGIFKQDSVRDLREMVSKEVLNNPVKFNDAILDKPNKDYAQWILKMESWGGAIEIGIISDALAVAIYVVDIDAVKIEKFNEDKFDNYILILFNGIHYDSLTMNEFKTVFNKNQPESDDVLTAALQLASNLKQTGYSFNTH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin thioesterase OTU1
publication title Structural basis for ubiquitin recognition by the Otu1 ovarian tumor domain protein
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Cell cycle, hydrolase
total genus 50
structure length 175
sequence length 175
chains with identical sequence C
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2008-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02338 OTU OTU-like cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.80 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 3c0rA00
3PHWA 4BOQA 3BY4A 3PSEA 4HXDB 4BOPA 3PT2A 3C0RA 3TMPA 3PHXA 3PRMA 4BOSA 5JZEA 3PRPA 3PHUA 3ZNHA 4BOZA 4BOUA
chains in the Genus database with same CATH superfamily
2GHUA 1TU6A 3O0UA 3BWKA 3QJ3A 3USVA 3PBHA 1EWMA 4X6JA 1X9YA 4RY2A 1MIRA 3U8EA 4RKXA 2NQDB 4YV8A 2YJBA 2FRAA 3NHEA 2DC6A 4IUMA 2J7QA 4OEMA 2BDLA 2PADA 4YYVA 2BTWB 2R9NA 3E9SA 4CZWA 4K7CA 1QOLA 4PI3A 3F5VA 3IFUA 3OVZA 4BOPA 2FO5A 4QRVA 2ARYA 3HWNA 4X6HA 5JA7A 2FTDA 4P16A 3TMPA 1IWDA 4AXMA 3E1ZB 4PADA 3KW9A 1CS8A 1JQPA 1QMYA 4N4ZA 1UKFA 3H6SA 5JH3A 2NQGA 4XR7A 4MSXA 3BBAA 3IHPA 1GECE 3RVVA 2YJ8A 2CIOA 3S3RA 1MDWA 1EWPA 4PP1A 3OF8A 2OZ2A 1S4VA 2JTCA 2Y5BA 4KLBA 1THEA 1NL6A 3AI8A 5CHVA 3D6SA 4RNAA 3V6CA 4HXDB 1U9XA 4Q8HA 1BGOA 5JZEA 7PCKA 2PREA 2FE8A 3BB7A 2CB5A 3K9MA 1VSNA 1EF7A 2AUXA 3OVXA 1TL9A 4N8WA 4A5UA 2AS8A 3KFQA 2DZYA 1HUCB 3CH2X 3N3GA 1KFXL 2C0YA 3O65A 1POPA 2P0RA 2R9CA 3HD3A 4FIPA 3HHIA 3BPMA 1M6DA 3K24A 4M0WA 3W30A 4ZUXU 5EZQA 1CSBB 2DC7A 2E03A 2ACTA 2FT2A 1PPDA 3LFYA 1YK8A 3F75A 2YJCA 2NQAA 3QSDA 3P5XA 4REZA 4YYRA 4YYQA 4FK5A 1XKGA 1CTEA 2AGAA 4OELA 2AYOA 4P6EA 1U9WA 3WXGA 2IPPB 1PPOA 2WBFX 2XU3A 4G54A 4AXLA 1PBHA 1FH0A 3BPFA 1ATKA 4MI7A 4I04A 3IOQA 2HWKA 4BOZA 1PCIA 1ME4A 1BY8A 2ATOA 4N79A 4CDEB 3CH3X 3W31A 2FUDA 1ZIVA 1PXVA 2UZJA 3DF0A 1PADA 4QH6A 5CHTA 1U9QX 5E6JA 3I06A 2XU1A 2HHNA 1PPNA 1TLOA 2JRIA 2DJGB 5F02A 3KWZA 1EWOA 4Q8GA 2VHFA 3TNXA 1GLOA 4DMYA 4BSQA 1NPZA 3PRPA 1ME3A 3IV2A 1YALA 1YVBA 3P5UA 2R9FA 2DOSA 4GUAA 3IUTA 5CVMA 1GMYA 1U5IA 1ICFA 4RF0A 5J94A 1AU0A 2F1GA 3P5VA 3KSEA 3CBJA 1KXRA 1AYVA 3OF9A 2E01A 2JQGR 4QBBA 3RNVA 4MZOA 2B1MA 2J7QC 2P7UA 3P5WA 2XU5A 1Y08A 4BOSA 2NQIA 1Y4HA 2R9MA 3BCNA 2DCDA 2O6XA 2DC8A 4W5CA 4WA6A 2Y6EA 2DZZA 9PAPA 4WURA 2JQFR 2DCCA 2VHSA 3C9EA 3OQCA 4PT5A 4I05A 2FYEA 3OISA 5EZSA 5EGWA 3MHSA 2GFOA 2HXZA 1SP4B 1DF0A 1PPPA 3GCBA 4CDDB 2BDZA 3H8CA 2HD5A 3IEJA 1K3BB 5CVOB 1STFE 1CVZA 1CB5A 1KHPA 2E00A 3S3QA 3RVWA 1MHWA 1MS6A 3CBKA 3PRMA 3I3TA 4BS5A 1PE6A 4BS6A 1AU4A 1PIPA 3V6EA 1KFUL 3HHAA 2BU3A 2AU1A 4P6GA 2AYNA 8PCHA 3ZUAA 5PADA 1Q6KA 4IP3A 2HH5A 3KX1A 4BOUA 3TRKA 2Z84A 3QT4A 3WXFA 4OVZA 2G6DA 3M99A 3PW3A 1QDQA 2G8JA 1NQCA 1F2AA 3PHXA 4X6IA 3LXSA 2DCAA 2FQ9A 2PNSA 3C0RA 1O0EA 1CQDA 1AECA 4MZSA 4QRGA 4BQVA 2OP3A 2XU4A 3MJ5A 4OW0A 3MORA 4CDFB 2AUZA 3O1GA 3KKUA 3H8BA 3PHUA 2H7JA 4QRXA 4XUIA 2YJ2A 5FPWA 1YK7A 5K16A 2AVWA 4ZTBA 4XZXA 3PHWA 1GCBA 6PADA 4RF1A 2DC9A 3H89A 1AYWA 4D8IA 4W4UA 2G8EA 4W5BA 2DCBA 4BPVA 5A24A 4MM3B 1AIMA 3B79A 3N3KA 3MTNA 4BOQA 2IBIA 2YJ9A 3MHHA 4D8EA 2E02A 3PNRA 3PDFA 4PP2E 1F2BA 3IMAA 1CJLA 3K8UA 4YYUA 2BTWA 3H7DA 1A6RA 3WXEA 3N4CA 2AIMA 4D8BA 2DJFB 4R3DA 1F29A 1BQIA 3ERVA 1CPJA 1U9VA 1NB5A 2R6NA 3B21A 2F7DA 4I07A 5KO3A 1NLJA 2OULA 1MEGA 4YYSA 1NB3A 4HWYA 1BP4A 2B1NA 5CVNB 1F2CA 3MTVA 2R9OA 1QXPA 4OVZB 4CDCB 1AU2A 1PVJA 4YVAA 3BC3A 1SNKA 5EF4A 1ITOA 3BY4A 1AYUA 1AU3A 1YT7A 1MEMA 2G7YA 3PT2A 1KHQA 2P86A 3ZNHA 1DEUA 3BOWA 1ZCMA 3KWBX 3RVXA 4DMXA 3PSEA 2PBHA 1DKIA 1EWLA 4YYWA 3MP2A 2FRQA 4FJCA 1CV8A 1YZBA 1VJVA
chains in the Genus database with same CATH topology
3RNVA 4ZTBA 4XZXA 2J7QC 3PHWA 4M0WA 3W30A 4BOSA 4RF1A 5EZQA 4D8IA 4WURA 4RKXA 4MM3B 4IUMA 2J7QA 3OQCA 4PT5A 5EZSA 2BTWB 3E9SA 4BOQA 4D8EA 3IFUA 4BOPA 4REZA 2BTWA 4D8BA 4P16A 2AGAA 3TMPA 4R3DA 3PRMA 3B21A 5KO3A 4MI7A 1UKFA 2HWKA 2BU3A 4BOZA 3BBAA 3MTVA 3W31A 4OVZB 2UZJA 1PVJA 4IP3A 4BOUA 2JTCA 3BY4A 2Z84A 3TRKA 3PT2A 4RNAA 4HXDB 3ZNHA 4OVZA 5E6JA 3PHXA 2JRIA 5JZEA 2FE8A 3BB7A 3PSEA 1DKIA 3C0RA 3PRPA 4A5UA 3MJ5A 4OW0A 2DOSA 4GUAA 3MP2A 3PHUA 4RF0A 3O65A 1YZBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PHW A;  4BOQ A;  3BY4 A;  3PSE A;  4HXD B;  4BOP A;  3PT2 A;  3C0R A;  3TMP A;  3PHX A;  3PRM A;  4BOS A;  5JZE A;  3PRP A;  3PHU A;  3ZNH A;  4BOZ A;  4BOU A; 
#chains in the Genus database with same CATH topology
 2GHU A;  1TU6 A;  3O0U A;  3BWK A;  3QJ3 A;  3USV A;  3PBH A;  1EWM A;  4X6J A;  1X9Y A;  4RY2 A;  1MIR A;  3U8E A;  4RKX A;  2NQD B;  4YV8 A;  2YJB A;  2FRA A;  3NHE A;  2DC6 A;  4IUM A;  2J7Q A;  4OEM A;  2BDL A;  2PAD A;  4YYV A;  2BTW B;  2R9N A;  3E9S A;  4CZW A;  4K7C A;  1QOL A;  4PI3 A;  3F5V A;  3IFU A;  3OVZ A;  4BOP A;  2FO5 A;  4QRV A;  2ARY A;  3HWN A;  4X6H A;  5JA7 A;  2FTD A;  4P16 A;  3TMP A;  1IWD A;  4AXM A;  3E1Z B;  4PAD A;  3KW9 A;  1CS8 A;  1JQP A;  1QMY A;  4N4Z A;  1UKF A;  3H6S A;  5JH3 A;  2NQG A;  4XR7 A;  4MSX A;  3BBA A;  3IHP A;  1GEC E;  3RVV A;  2YJ8 A;  2CIO A;  3S3R A;  1MDW A;  1EWP A;  4PP1 A;  3OF8 A;  2OZ2 A;  1S4V A;  2JTC A;  2Y5B A;  4KLB A;  1THE A;  1NL6 A;  3AI8 A;  5CHV A;  3D6S A;  4RNA A;  3V6C A;  4HXD B;  1U9X A;  4Q8H A;  1BGO A;  5JZE A;  7PCK A;  2PRE A;  2FE8 A;  3BB7 A;  2CB5 A;  3K9M A;  1VSN A;  1EF7 A;  2AUX A;  3OVX A;  1TL9 A;  4N8W A;  4A5U A;  2AS8 A;  3KFQ A;  2DZY A;  1HUC B;  3CH2 X;  3N3G A;  1KFX L;  2C0Y A;  3O65 A;  1POP A;  2P0R A;  2R9C A;  3HD3 A;  4FIP A;  3HHI A;  3BPM A;  1M6D A;  3K24 A;  4M0W A;  3W30 A;  4ZUX U;  5EZQ A;  1CSB B;  2DC7 A;  2E03 A;  2ACT A;  2FT2 A;  1PPD A;  3LFY A;  1YK8 A;  3F75 A;  2YJC A;  2NQA A;  3QSD A;  3P5X A;  4REZ A;  4YYR A;  4YYQ A;  4FK5 A;  1XKG A;  1CTE A;  2AGA A;  4OEL A;  2AYO A;  4P6E A;  1U9W A;  3WXG A;  2IPP B;  1PPO A;  2WBF X;  2XU3 A;  4G54 A;  4AXL A;  1PBH A;  1FH0 A;  3BPF A;  1ATK A;  4MI7 A;  4I04 A;  3IOQ A;  2HWK A;  4BOZ A;  1PCI A;  1ME4 A;  1BY8 A;  2ATO A;  4N79 A;  4CDE B;  3CH3 X;  3W31 A;  2FUD A;  1ZIV A;  1PXV A;  2UZJ A;  3DF0 A;  1PAD A;  4QH6 A;  5CHT A;  1U9Q X;  5E6J A;  3I06 A;  2XU1 A;  2HHN A;  1PPN A;  1TLO A;  2JRI A;  2DJG B;  5F02 A;  3KWZ A;  1EWO A;  4Q8G A;  2VHF A;  3TNX A;  1GLO A;  4DMY A;  4BSQ A;  1NPZ A;  3PRP A;  1ME3 A;  3IV2 A;  1YAL A;  1YVB A;  3P5U A;  2R9F A;  2DOS A;  4GUA A;  3IUT A;  5CVM A;  1GMY A;  1U5I A;  1ICF A;  4RF0 A;  5J94 A;  1AU0 A;  2F1G A;  3P5V A;  3KSE A;  3CBJ A;  1KXR A;  1AYV A;  3OF9 A;  2E01 A;  2JQG R;  4QBB A;  3RNV A;  4MZO A;  2B1M A;  2J7Q C;  2P7U A;  3P5W A;  2XU5 A;  1Y08 A;  4BOS A;  2NQI A;  1Y4H A;  2R9M A;  3BCN A;  2DCD A;  2O6X A;  2DC8 A;  4W5C A;  4WA6 A;  2Y6E A;  2DZZ A;  9PAP A;  4WUR A;  2JQF R;  2DCC A;  2VHS A;  3C9E A;  3OQC A;  4PT5 A;  4I05 A;  2FYE A;  3OIS A;  5EZS A;  5EGW A;  3MHS A;  2GFO A;  2HXZ A;  1SP4 B;  1DF0 A;  1PPP A;  3GCB A;  4CDD B;  2BDZ A;  3H8C A;  2HD5 A;  3IEJ A;  1K3B B;  5CVO B;  1STF E;  1CVZ A;  1CB5 A;  1KHP A;  2E00 A;  3S3Q A;  3RVW A;  1MHW A;  1MS6 A;  3CBK A;  3PRM A;  3I3T A;  4BS5 A;  1PE6 A;  4BS6 A;  1AU4 A;  1PIP A;  3V6E A;  1KFU L;  3HHA A;  2BU3 A;  2AU1 A;  4P6G A;  2AYN A;  8PCH A;  3ZUA A;  5PAD A;  1Q6K A;  4IP3 A;  2HH5 A;  3KX1 A;  4BOU A;  3TRK A;  2Z84 A;  3QT4 A;  3WXF A;  4OVZ A;  2G6D A;  3M99 A;  3PW3 A;  1QDQ A;  2G8J A;  1NQC A;  1F2A A;  3PHX A;  4X6I A;  3LXS A;  2DCA A;  2FQ9 A;  2PNS A;  3C0R A;  1O0E A;  1CQD A;  1AEC A;  4MZS A;  4QRG A;  4BQV A;  2OP3 A;  2XU4 A;  3MJ5 A;  4OW0 A;  3MOR A;  4CDF B;  2AUZ A;  3O1G A;  3KKU A;  3H8B A;  3PHU A;  2H7J A;  4QRX A;  4XUI A;  2YJ2 A;  5FPW A;  1YK7 A;  5K16 A;  2AVW A;  4ZTB A;  4XZX A;  3PHW A;  1GCB A;  6PAD A;  4RF1 A;  2DC9 A;  3H89 A;  1AYW A;  4D8I A;  4W4U A;  2G8E A;  4W5B A;  2DCB A;  4BPV A;  5A24 A;  4MM3 B;  1AIM A;  3B79 A;  3N3K A;  3MTN A;  4BOQ A;  2IBI A;  2YJ9 A;  3MHH A;  4D8E A;  2E02 A;  3PNR A;  3PDF A;  4PP2 E;  1F2B A;  3IMA A;  1CJL A;  3K8U A;  4YYU A;  2BTW A;  3H7D A;  1A6R A;  3WXE A;  3N4C A;  2AIM A;  4D8B A;  2DJF B;  4R3D A;  1F29 A;  1BQI A;  3ERV A;  1CPJ A;  1U9V A;  1NB5 A;  2R6N A;  3B21 A;  2F7D A;  4I07 A;  5KO3 A;  1NLJ A;  2OUL A;  1MEG A;  4YYS A;  1NB3 A;  4HWY A;  1BP4 A;  2B1N A;  5CVN B;  1F2C A;  3MTV A;  2R9O A;  1QXP A;  4OVZ B;  4CDC B;  1AU2 A;  1PVJ A;  4YVA A;  3BC3 A;  1SNK A;  5EF4 A;  1ITO A;  3BY4 A;  1AYU A;  1AU3 A;  1YT7 A;  1MEM A;  2G7Y A;  3PT2 A;  1KHQ A;  2P86 A;  3ZNH A;  1DEU A;  3BOW A;  1ZCM A;  3KWB X;  3RVX A;  4DMX A;  3PSE A;  2PBH A;  1DKI A;  1EWL A;  4YYW A;  3MP2 A;  2FRQ A;  4FJC A;  1CV8 A;  1YZB A;  1VJV A; 
#chains in the Genus database with same CATH homology
 3RNV A;  4ZTB A;  4XZX A;  2J7Q C;  3PHW A;  4M0W A;  3W30 A;  4BOS A;  4RF1 A;  5EZQ A;  4D8I A;  4WUR A;  4RKX A;  4MM3 B;  4IUM A;  2J7Q A;  3OQC A;  4PT5 A;  5EZS A;  2BTW B;  3E9S A;  4BOQ A;  4D8E A;  3IFU A;  4BOP A;  4REZ A;  2BTW A;  4D8B A;  4P16 A;  2AGA A;  3TMP A;  4R3D A;  3PRM A;  3B21 A;  5KO3 A;  4MI7 A;  1UKF A;  2HWK A;  2BU3 A;  4BOZ A;  3BBA A;  3MTV A;  3W31 A;  4OVZ B;  2UZJ A;  1PVJ A;  4IP3 A;  4BOU A;  2JTC A;  3BY4 A;  2Z84 A;  3TRK A;  3PT2 A;  4RNA A;  4HXD B;  3ZNH A;  4OVZ A;  5E6J A;  3PHX A;  2JRI A;  5JZE A;  2FE8 A;  3BB7 A;  3PSE A;  1DKI A;  3C0R A;  3PRP A;  4A5U A;  3MJ5 A;  4OW0 A;  2DOS A;  4GUA A;  3MP2 A;  3PHU A;  4RF0 A;  3O65 A;  1YZB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...