3C0RA

Structure of ovarian tumor (otu) domain in complex with ubiquitin
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
175
structure length
175
Chain Sequence
b'RVLKSTEMSIGGSGENVLSVHPVLDDNSCLFHAIAYGIFKQDSVRDLREMVSKEVLNNPVKFNDAILDKPNKDYAQWILKMESWGGAIEIGIISDALAVAIYVVDIDAVKIEKFNEDKFDNYILILFNGIHYDSLTMNEFKTVFNKNQPESDDVLTAALQLASNLKQTGYSFNTH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin thioesterase OTU1
molecule tags Cell cycle, hydrolase
source organism Saccharomyces cerevisiae
publication title Structural basis for ubiquitin recognition by the Otu1 ovarian tumor domain protein
pubmed doi rcsb
total genus 50
structure length 175
sequence length 175
chains with identical sequence C
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2008-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02338 OTU OTU-like cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.80 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 3c0rA00
3PSEA 3PHWA 3PRPA 4HXDB 5JZEA 3PHXA 3C0RA 3PRMA 3TMPA 4BOSA 3ZNHA 4BOPA 4BOZA 4BOQA 4BOUA 3PHUA 3BY4A 3PT2A
chains in the Genus database with same CATH superfamily
2FUDA 4WURA 3BPMA 2IBIA 3BC3A 4I04A 1FH0A 3S3RA 1AYUA 3PHXA 1NPZA 1AU3A 1BP4A 4CDFB 1PPNA 2GFOA 3O0UA 3RNVA 3MTNA 2VHSA 1YK7A 4CDCB 4XZXA 2NQGA 3CH2X 1GLOA 1BQIA 4HWYA 1MHWA 2Y6EA 4OW0A 3KWBX 5A24A 4BSQA 2JQGR 4PP1A 2J7QC 4AXLA 2GHUA 4XR7A 2DJGB 2FT2A 2F7DA 4N8WA 2YJ9A 1PE6A 4BOUA 1DEUA 3KSEA 2HH5A 3RVVA 1CPJA 1EWLA 2FYEA 3OVZA 3H89A 3OVXA 1KHQA 2PREA 3N3KA 2OULA 3DF0A 1PBHA 2AYOA 3P5VA 2P7UA 3E1ZB 4BQVA 3ZUAA 4PP2E 4MSXA 1YK8A 2FRQA 2E03A 4N79A 3BWKA 2G8EA 5CVMA 1JQPA 4ZUXU 2R6NA 4OVZA 2UZJA 2BU3A 3HHIA 1KFXL 1QDQA 2E00A 1KXRA 5CHTA 5CVNB 1F2AA 1QOLA 1VJVA 2ATOA 4D8EA 4CDDB 4X6IA 3RVWA 3WXEA 5EF4A 1EF7A 3O65A 1GMYA 2H7JA 1STFE 1U9XA 4OELA 1AIMA 1DF0A 2DCAA 2PNSA 3BCNA 2R9FA 4QRGA 2R9MA 1AU4A 2F1GA 1YZBA 2J7QA 1PVJA 4I07A 4RF0A 4BS6A 4X6HA 4FJCA 3BPFA 2VHFA 1YVBA 5F02A 1CJLA 3CBKA 4REZA 5EZSA 3USVA 1U5IA 3U8EA 1ZCMA 3MHHA 4BOQA 3BOWA 1F2CA 3P5XA 1EWPA 2YJ2A 4YYSA 2PADA 1F29A 1PPOA 3BY4A 4IUMA 2JTCA 4DMXA 5JH3A 4RKXA 1BGOA 3N3GA 2DCBA 1KHPA 2AGAA 4GUAA 4G54A 5J94A 2NQDB 1TU6A 3K9MA 3QT4A 2JQFR 3IMAA 3HWNA 4WA6A 4RY2A 3PHUA 1MEGA 3M99A 1M6DA 1IWDA 4CDEB 2ACTA 2DC8A 2AYNA 3QSDA 3TNXA 5JZEA 1U9WA 2HHNA 2B1NA 4QRVA 1AYVA 2R9CA 3I3TA 1GCBA 3K8UA 3PBHA 3HD3A 1NB5A 4QH6A 2XU3A 2P0RA 3IUTA 1AECA 3P5WA 3TRKA 4P6GA 1PCIA 3OF8A 4YYQA 2OZ2A 1X9YA 3TMPA 2JRIA 4XUIA 4I05A 3KFQA 1PIPA 3O1GA 2HWKA 3MP2A 1CVZA 3H8BA 3LFYA 3PW3A 4YYVA 1Y4HA 1PADA 4ZTBA 2YJ8A 4MZOA 2FO5A 9PAPA 2DCDA 1CB5A 3MORA 3BB7A 3NHEA 2DCCA 3D6SA 3C9EA 4W4UA 5EZQA 2YJBA 3PDFA 3WXGA 1SNKA 1ME4A 2FQ9A 1DKIA 1NB3A 3PNRA 4IP3A 3B21A 6PADA 5CVOB 2AS8A 4R3DA 3ZNHA 3LXSA 1TLOA 2G7YA 2NQIA 4FIPA 3KKUA 5E6JA 2FRAA 4Q8GA 3OISA 3P5UA 2XU4A 4PI3A 2PBHA 1NQCA 3MHSA 4YV8A 2G8JA 2AU1A 1AYWA 1S4VA 2R9NA 2BDLA 2Y5BA 3N4CA 2R9OA 2XU1A 4DMYA 4D8IA 1XKGA 2Z84A 4M0WA 3F5VA 1CTEA 1HUCB 2DC6A 2DJFB 5EGWA 3PSEA 2YJCA 4YYWA 2DOSA 1MIRA 4PT5A 3PRPA 1EWMA 1U9QX 2BTWA 4OEMA 5PADA 4RF1A 4KLBA 4QBBA 2HD5A 3PRMA 3QJ3A 4BOSA 4BOZA 1AU0A 3ERVA 3IEJA 2DC9A 3KX1A 3E9SA 2E01A 4AXMA 1CQDA 3S3QA 2CIOA 4YYRA 1CSBB 1MS6A 4YYUA 1U9VA 2DZYA 1VSNA 2IPPB 2AIMA 1MDWA 3IHPA 1TL9A 1YALA 4W5BA 4W5CA 4BS5A 1KFUL 3H7DA 4D8BA 3W31A 2O6XA 4BOPA 1A6RA 2ARYA 3H6SA 4MM3B 3IV2A 4K7CA 2AVWA 3K24A 8PCHA 3I06A 5KO3A 3IOQA 3H8CA 1ITOA 1Y08A 2C0YA 1ME3A 2AUZA 3GCBA 2BDZA 4BPVA 4P6EA 2XU5A 5CHVA 1F2BA 1AU2A 1ICFA 4YVAA 4FK5A 1UKFA 3CBJA 3W30A 1MEMA 3KW9A 3OQCA 3B79A 1ZIVA 1PPDA 3CH3X 3WXFA 2B1MA 1POPA 4Q8HA 4OVZB 4X6JA 3BBAA 4QRXA 3PT2A 4CZWA 3V6CA 7PCKA 1ATKA 1SP4B 2FE8A 1NLJA 4RNAA 2P86A 3HHAA 5JA7A 3RVXA 2G6DA 3V6EA 1O0EA 2WBFX 4HXDB 1THEA 3PHWA 1PPPA 3C0RA 4P16A 4MZSA 3OF9A 3MTVA 4N4ZA 1YT7A 1BY8A 1CS8A 3F75A 2AUXA 4A5UA 2E02A 2CB5A 4MI7A 3IFUA 1Q6KA 2HXZA 3KWZA 3MJ5A 1EWOA 3AI8A 5K16A 2DC7A 2BTWB 4PADA 1QMYA 2OP3A 1QXPA 1PXVA 5FPWA 2FTDA 2DZZA 1NL6A 1K3BB 1CV8A 2NQAA 1GECE
chains in the Genus database with same CATH topology
3PSEA 3IFUA 3O65A 3W30A 2AGAA 4GUAA 4WURA 3OQCA 2HWKA 1DKIA 5KO3A 2DOSA 3MP2A 3MJ5A 4BOUA 4REZA 4HXDB 5EZSA 4PT5A 3PHWA 3PRPA 3C0RA 3PHXA 4OVZB 4OVZA 2UZJA 2BU3A 4ZTBA 3RNVA 4IP3A 2BTWB 2BTWA 3BBAA 4BOQA 4D8BA 3PHUA 3B21A 3PT2A 3W31A 4D8IA 4P16A 4RF1A 4XZXA 3MTVA 3PRMA 4BOSA 2Z84A 3ZNHA 4R3DA 4M0WA 4BOPA 4BOZA 3BB7A 3TRKA 4D8EA 3BY4A 4IUMA 1YZBA 4OW0A 2FE8A 2JTCA 5JZEA 4A5UA 3TMPA 5E6JA 2J7QA 1PVJA 3E9SA 4RKXA 2JRIA 4RF0A 4MI7A 2J7QC 5EZQA 4MM3B 1UKFA 4RNAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PSE A;  3PHW A;  3PRP A;  4HXD B;  5JZE A;  3PHX A;  3C0R A;  3PRM A;  3TMP A;  4BOS A;  3ZNH A;  4BOP A;  4BOZ A;  4BOQ A;  4BOU A;  3PHU A;  3BY4 A;  3PT2 A; 
#chains in the Genus database with same CATH topology
 2FUD A;  4WUR A;  3BPM A;  2IBI A;  3BC3 A;  4I04 A;  1FH0 A;  3S3R A;  1AYU A;  3PHX A;  1NPZ A;  1AU3 A;  1BP4 A;  4CDF B;  1PPN A;  2GFO A;  3O0U A;  3RNV A;  3MTN A;  2VHS A;  1YK7 A;  4CDC B;  4XZX A;  2NQG A;  3CH2 X;  1GLO A;  1BQI A;  4HWY A;  1MHW A;  2Y6E A;  4OW0 A;  3KWB X;  5A24 A;  4BSQ A;  2JQG R;  4PP1 A;  2J7Q C;  4AXL A;  2GHU A;  4XR7 A;  2DJG B;  2FT2 A;  2F7D A;  4N8W A;  2YJ9 A;  1PE6 A;  4BOU A;  1DEU A;  3KSE A;  2HH5 A;  3RVV A;  1CPJ A;  1EWL A;  2FYE A;  3OVZ A;  3H89 A;  3OVX A;  1KHQ A;  2PRE A;  3N3K A;  2OUL A;  3DF0 A;  1PBH A;  2AYO A;  3P5V A;  2P7U A;  3E1Z B;  4BQV A;  3ZUA A;  4PP2 E;  4MSX A;  1YK8 A;  2FRQ A;  2E03 A;  4N79 A;  3BWK A;  2G8E A;  5CVM A;  1JQP A;  4ZUX U;  2R6N A;  4OVZ A;  2UZJ A;  2BU3 A;  3HHI A;  1KFX L;  1QDQ A;  2E00 A;  1KXR A;  5CHT A;  5CVN B;  1F2A A;  1QOL A;  1VJV A;  2ATO A;  4D8E A;  4CDD B;  4X6I A;  3RVW A;  3WXE A;  5EF4 A;  1EF7 A;  3O65 A;  1GMY A;  2H7J A;  1STF E;  1U9X A;  4OEL A;  1AIM A;  1DF0 A;  2DCA A;  2PNS A;  3BCN A;  2R9F A;  4QRG A;  2R9M A;  1AU4 A;  2F1G A;  1YZB A;  2J7Q A;  1PVJ A;  4I07 A;  4RF0 A;  4BS6 A;  4X6H A;  4FJC A;  3BPF A;  2VHF A;  1YVB A;  5F02 A;  1CJL A;  3CBK A;  4REZ A;  5EZS A;  3USV A;  1U5I A;  3U8E A;  1ZCM A;  3MHH A;  4BOQ A;  3BOW A;  1F2C A;  3P5X A;  1EWP A;  2YJ2 A;  4YYS A;  2PAD A;  1F29 A;  1PPO A;  3BY4 A;  4IUM A;  2JTC A;  4DMX A;  5JH3 A;  4RKX A;  1BGO A;  3N3G A;  2DCB A;  1KHP A;  2AGA A;  4GUA A;  4G54 A;  5J94 A;  2NQD B;  1TU6 A;  3K9M A;  3QT4 A;  2JQF R;  3IMA A;  3HWN A;  4WA6 A;  4RY2 A;  3PHU A;  1MEG A;  3M99 A;  1M6D A;  1IWD A;  4CDE B;  2ACT A;  2DC8 A;  2AYN A;  3QSD A;  3TNX A;  5JZE A;  1U9W A;  2HHN A;  2B1N A;  4QRV A;  1AYV A;  2R9C A;  3I3T A;  1GCB A;  3K8U A;  3PBH A;  3HD3 A;  1NB5 A;  4QH6 A;  2XU3 A;  2P0R A;  3IUT A;  1AEC A;  3P5W A;  3TRK A;  4P6G A;  1PCI A;  3OF8 A;  4YYQ A;  2OZ2 A;  1X9Y A;  3TMP A;  2JRI A;  4XUI A;  4I05 A;  3KFQ A;  1PIP A;  3O1G A;  2HWK A;  3MP2 A;  1CVZ A;  3H8B A;  3LFY A;  3PW3 A;  4YYV A;  1Y4H A;  1PAD A;  4ZTB A;  2YJ8 A;  4MZO A;  2FO5 A;  9PAP A;  2DCD A;  1CB5 A;  3MOR A;  3BB7 A;  3NHE A;  2DCC A;  3D6S A;  3C9E A;  4W4U A;  5EZQ A;  2YJB A;  3PDF A;  3WXG A;  1SNK A;  1ME4 A;  2FQ9 A;  1DKI A;  1NB3 A;  3PNR A;  4IP3 A;  3B21 A;  6PAD A;  5CVO B;  2AS8 A;  4R3D A;  3ZNH A;  3LXS A;  1TLO A;  2G7Y A;  2NQI A;  4FIP A;  3KKU A;  5E6J A;  2FRA A;  4Q8G A;  3OIS A;  3P5U A;  2XU4 A;  4PI3 A;  2PBH A;  1NQC A;  3MHS A;  4YV8 A;  2G8J A;  2AU1 A;  1AYW A;  1S4V A;  2R9N A;  2BDL A;  2Y5B A;  3N4C A;  2R9O A;  2XU1 A;  4DMY A;  4D8I A;  1XKG A;  2Z84 A;  4M0W A;  3F5V A;  1CTE A;  1HUC B;  2DC6 A;  2DJF B;  5EGW A;  3PSE A;  2YJC A;  4YYW A;  2DOS A;  1MIR A;  4PT5 A;  3PRP A;  1EWM A;  1U9Q X;  2BTW A;  4OEM A;  5PAD A;  4RF1 A;  4KLB A;  4QBB A;  2HD5 A;  3PRM A;  3QJ3 A;  4BOS A;  4BOZ A;  1AU0 A;  3ERV A;  3IEJ A;  2DC9 A;  3KX1 A;  3E9S A;  2E01 A;  4AXM A;  1CQD A;  3S3Q A;  2CIO A;  4YYR A;  1CSB B;  1MS6 A;  4YYU A;  1U9V A;  2DZY A;  1VSN A;  2IPP B;  2AIM A;  1MDW A;  3IHP A;  1TL9 A;  1YAL A;  4W5B A;  4W5C A;  4BS5 A;  1KFU L;  3H7D A;  4D8B A;  3W31 A;  2O6X A;  4BOP A;  1A6R A;  2ARY A;  3H6S A;  4MM3 B;  3IV2 A;  4K7C A;  2AVW A;  3K24 A;  8PCH A;  3I06 A;  5KO3 A;  3IOQ A;  3H8C A;  1ITO A;  1Y08 A;  2C0Y A;  1ME3 A;  2AUZ A;  3GCB A;  2BDZ A;  4BPV A;  4P6E A;  2XU5 A;  5CHV A;  1F2B A;  1AU2 A;  1ICF A;  4YVA A;  4FK5 A;  1UKF A;  3CBJ A;  3W30 A;  1MEM A;  3KW9 A;  3OQC A;  3B79 A;  1ZIV A;  1PPD A;  3CH3 X;  3WXF A;  2B1M A;  1POP A;  4Q8H A;  4OVZ B;  4X6J A;  3BBA A;  4QRX A;  3PT2 A;  4CZW A;  3V6C A;  7PCK A;  1ATK A;  1SP4 B;  2FE8 A;  1NLJ A;  4RNA A;  2P86 A;  3HHA A;  5JA7 A;  3RVX A;  2G6D A;  3V6E A;  1O0E A;  2WBF X;  4HXD B;  1THE A;  3PHW A;  1PPP A;  3C0R A;  4P16 A;  4MZS A;  3OF9 A;  3MTV A;  4N4Z A;  1YT7 A;  1BY8 A;  1CS8 A;  3F75 A;  2AUX A;  4A5U A;  2E02 A;  2CB5 A;  4MI7 A;  3IFU A;  1Q6K A;  2HXZ A;  3KWZ A;  3MJ5 A;  1EWO A;  3AI8 A;  5K16 A;  2DC7 A;  2BTW B;  4PAD A;  1QMY A;  2OP3 A;  1QXP A;  1PXV A;  5FPW A;  2FTD A;  2DZZ A;  1NL6 A;  1K3B B;  1CV8 A;  2NQA A;  1GEC E; 
#chains in the Genus database with same CATH homology
 3PSE A;  3IFU A;  3O65 A;  3W30 A;  2AGA A;  4GUA A;  4WUR A;  3OQC A;  2HWK A;  1DKI A;  5KO3 A;  2DOS A;  3MP2 A;  3MJ5 A;  4BOU A;  4REZ A;  4HXD B;  5EZS A;  4PT5 A;  3PHW A;  3PRP A;  3C0R A;  3PHX A;  4OVZ B;  4OVZ A;  2UZJ A;  2BU3 A;  4ZTB A;  3RNV A;  4IP3 A;  2BTW B;  2BTW A;  3BBA A;  4BOQ A;  4D8B A;  3PHU A;  3B21 A;  3PT2 A;  3W31 A;  4D8I A;  4P16 A;  4RF1 A;  4XZX A;  3MTV A;  3PRM A;  4BOS A;  2Z84 A;  3ZNH A;  4R3D A;  4M0W A;  4BOP A;  4BOZ A;  3BB7 A;  3TRK A;  4D8E A;  3BY4 A;  4IUM A;  1YZB A;  4OW0 A;  2FE8 A;  2JTC A;  5JZE A;  4A5U A;  3TMP A;  5E6J A;  2J7Q A;  1PVJ A;  3E9S A;  4RKX A;  2JRI A;  4RF0 A;  4MI7 A;  2J7Q C;  5EZQ A;  4MM3 B;  1UKF A;  4RNA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...