3USVA

Structure of the precursor of a thermostable variant of papain at 3.8 a resolution from a crystal soaked at ph 4
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
308
structure length
308
Chain Sequence
LTSTERLIQLFESWMLKHNKIYKNIDEKIYRFEIFKDNLKYIDETNKKNNSYWLGLNVFADMSNDEFKEKYTGSIAGNYTTTELSYEEVLNDGDVNIPEYVDWRQKGAVTPVKNQGSCGSAWAFSAVSTIESIIKIRTGNLNEYSEQELLDCDRRSYGCNGGYPWSALQLVAQYGIHYRNTYPYEGVQRYCRSREKGPYAAKTDGVRQVQPYNEGALLYSIANQPVSVVLEAAGKDFQLYRGGIFVGPCGNKVDHAVAAVGYGPNYILIRNSWGTGWGENGYIRIKRGTGNSYGVCGLYTSSFYPVKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic analysis of pro-papain variant elucidates the structural basis of the step-wise activation mechanism of the zymogen
rcsb
source organism Carica papaya
molecule tags Hydrolase
molecule keywords Papain
total genus 18
structure length 308
sequence length 308
chains with identical sequence C
ec nomenclature ec 3.4.22.2: Papain.
pdb deposition date 2011-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
A PF08246 Inhibitor_I29 Cathepsin propeptide inhibitor domain (I29)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3usvA00
3HHAA 3PW3A 1GMYA 3QJ3A 1JQPA 1PPDA 2DC9A 1XKGA 1YT7A 4QBBA 3K9MA 5JA7A 4XUIA 3ZUAA 2JQFR 2OP3A 3PNRA 1CB5A 4YYSA 3USVA 3F75A 3MTNA 2AVWA 1PBHA 3E1ZB 2R6NA 3I3TA 3RVWA 3H8BA 5EF4A 3AI8A 2DC7A 3C9EA 3KWBX 1NLJA 1YALA 2P7UA 1AU0A 1PPPA 1Q6KA 2BDLA 4BS5A 1PPOA 4N79A 4X6IA 4YYRA 1AYVA 2YJ9A 1Y08A 2AYNA 1TL9A 1KFXL 4CZWA 8PCHA 4PP2E 3DF0A 3I06A 2ATOA 3KFQA 1F2AA 3O0UA 2O6XA 4W5CA 4P6EA 1MHWA 4Q8HA 1MEGA 4W5BA 4P6GA 1HUCB 5PADA 4W4UA 2ARYA 4CDCB 7PCKA 4RY2A 1U9XA 3KKUA 4MSXA 2OULA 3MHHA 3MHSA 1EWOA 2B1NA 3BCNA 2XU5A 1MEMA 3S3RA 4X6HA 5CVNB 4I05A 2FYEA 2AUZA 1MS6A 3H7DA 1GECE 4PADA 3OF8A 2HHNA 2NQDB 1BY8A 2DCCA 5J94A 9PAPA 3IHPA 2VHFA 4HWYA 2YJCA 4OELA 2ACTA 2BDZA 5K16A 1AU4A 1DEUA 2FRQA 5EGWA 1ATKA 3D6SA 1F2BA 4I04A 2AU1A 2FUDA 1QXPA 1BGOA 5CHVA 3HWNA 4YYQA 1CJLA 1AYUA 2NQGA 2DJGB 2IPPB 2CIOA 1PCIA 3BPMA 3H8CA 2OZ2A 1AU2A 1CPJA 3PBHA 1U5IA 4QRGA 3CH2X 4CDEB 2HXZA 1ME3A 1NQCA 2HH5A 4AXLA 1MIRA 2C0YA 1ICFA 3IMAA 1F29A 3WXEA 4FIPA 2DCDA 5CVOB 2G7YA 1U9VA 3KX1A 2FO5A 2XU1A 2YJ8A 1M6DA 4YYUA 3BPFA 3V6CA 2JQGR 3KW9A 1F2CA 3H6SA 3HHIA 2H7JA 3QT4A 1PE6A 3N4CA 2G8JA 1TLOA 1K3BB 1EWLA 2AIMA 2HD5A 4XR7A 1NB3A 2R9MA 3LFYA 4FK5A 2E02A 4BQVA 3P5VA 1VJVA 5JH3A 3RVVA 2DCBA 1YVBA 2DZZA 3TNXA 3V6EA 3BOWA 4YYWA 2VHSA 4MZOA 5CHTA 4YVAA 1CVZA 2P86A 3GCBA 1AECA 2E00A 2F7DA 2F1GA 3P5WA 4AXMA 3S3QA 4I07A 2Y6EA 2DC8A 2E03A 2PNSA 1X9YA 3OF9A 1U9QX 1CTEA 1VSNA 3IEJA 2AYOA 3KWZA 3CH3X 1CV8A 1A6RA 1QMYA 2FT2A 4N4ZA 1QDQA 3QSDA 4YV8A 1MDWA 1CS8A 3OISA 2R9FA 2DC6A 3O1GA 3OVZA 3P5UA 2YJBA 2XU3A 1YK7A 3F5VA 3H89A 3NHEA 4BSQA 3PDFA 1NPZA 1O0EA 1AU3A 4CDFB 5A24A 1AIMA 2GHUA 2YJ2A 2Y5BA 2AUXA 4PP1A 2R9CA 2IBIA 1Y4HA 2DCAA 2B1MA 3HD3A 3M99A 1ME4A 3WXGA 2CB5A 2FQ9A 1EWMA 1S4VA 4X6JA 2FTDA 4K7CA 1STFE 3IV2A 2GFOA 3K8UA 4YYVA 1EWPA 4N8WA 1TU6A 1U9WA 4DMXA 1NB5A 3CBJA 3IOQA 4OEMA 1THEA 2PADA 3KSEA 3MORA 4MZSA 2G8EA 4WA6A 1PIPA 1PADA 2FRAA 2G6DA 2E01A 2DZYA 1BP4A 5CVMA 3N3GA 4FJCA 4QRXA 1YK8A 2DJFB 1ITOA 1QOLA 1EF7A 4BPVA 1KXRA 3IUTA 3LXSA 1ZIVA 1POPA 2NQIA 4ZUXU 2R9NA 1PPNA 1KHPA 4PI3A 4CDDB 1KHQA 3B79A 1GCBA 2XU4A 3OVXA 4QH6A 3K24A 6PADA 1BQIA 3ERVA 3BC3A 1SP4B 2PREA 3N3KA 2NQAA 1AYWA 1CQDA 1ZCMA 1CSBB 3BWKA 3RVXA 1PXVA 3WXFA 4G54A 2PBHA 2AS8A 1DF0A 4KLBA 1GLOA 5F02A 4DMYA 3CBKA 1KFUL 4Q8GA 4QRVA 2P0RA 3U8EA 5FPWA 3P5XA 2R9OA 4BS6A 1NL6A 1FH0A 1IWDA 2WBFX 1SNKA
chains in the Genus database with same CATH superfamily
3HHAA 3PW3A 1GMYA 3TMPA 3QJ3A 1JQPA 1PPDA 2DC9A 1XKGA 1YT7A 4QBBA 4XZXA 3K9MA 5JA7A 4XUIA 3ZUAA 2JQFR 2OP3A 3PNRA 1CB5A 4YYSA 3USVA 3F75A 3MTNA 2AVWA 1PBHA 3E1ZB 2R6NA 3I3TA 5KO3A 3RVWA 3H8BA 5EF4A 3AI8A 2DC7A 4REZA 3C9EA 3KWBX 4MM3B 1NLJA 1YALA 4D8EA 2P7UA 4RF1A 1AU0A 1PVJA 1PPPA 1Q6KA 2BDLA 3B21A 4BS5A 1PPOA 2AGAA 4N79A 5JZEA 4X6IA 4YYRA 1AYVA 2YJ9A 4ZTBA 3RNVA 1Y08A 2AYNA 1TL9A 1KFXL 4CZWA 8PCHA 4PP2E 3DF0A 3I06A 2ATOA 3KFQA 1F2AA 4BOPA 3O0UA 2O6XA 4W5CA 3W30A 2DOSA 4P6EA 1MHWA 4Q8HA 1MEGA 4W5BA 4P6GA 4PT5A 1HUCB 5PADA 4W4UA 2ARYA 4CDCB 7PCKA 4RY2A 1U9XA 2JTCA 4D8IA 3KKUA 4MSXA 2OULA 3MHHA 3MHSA 1EWOA 2B1NA 3BCNA 2XU5A 4MI7A 1MEMA 3S3RA 4X6HA 5CVNB 4IUMA 4I05A 2FYEA 2AUZA 1MS6A 3H7DA 1GECE 4PADA 3OF8A 2HHNA 2NQDB 1BY8A 3W31A 2DCCA 5J94A 9PAPA 3PHWA 3IHPA 4IP3A 5EZQA 3MP2A 2VHFA 4HWYA 2YJCA 4OELA 2ACTA 2BDZA 4RNAA 5K16A 1AU4A 1DEUA 2FRQA 5EGWA 1ATKA 3D6SA 1F2BA 4I04A 2AU1A 2FUDA 1QXPA 1BGOA 5CHVA 3HWNA 4YYQA 1CJLA 1AYUA 2NQGA 2DJGB 2IPPB 2CIOA 1PCIA 3BPMA 3H8CA 2OZ2A 1AU2A 1CPJA 3PBHA 1U5IA 4QRGA 4RKXA 3PHXA 2Z84A 3CH2X 4CDEB 2HXZA 1ME3A 1NQCA 2HH5A 3ZNHA 4AXLA 1MIRA 2C0YA 1ICFA 3IMAA 1F29A 3WXEA 4FIPA 2DCDA 5CVOB 2G7YA 1U9VA 3KX1A 2FO5A 2XU1A 2YJ8A 1M6DA 4YYUA 3BPFA 4M0WA 3V6CA 4D8BA 2JQGR 3KW9A 1F2CA 3H6SA 3HHIA 2H7JA 3QT4A 1PE6A 3N4CA 2G8JA 1TLOA 2HWKA 1K3BB 1EWLA 2BTWA 2AIMA 2HD5A 4XR7A 1NB3A 2BTWB 2R9MA 3LFYA 4FK5A 2E02A 4OW0A 3TRKA 3OQCA 4BQVA 3P5VA 1VJVA 5JH3A 3RVVA 2DCBA 1YVBA 2DZZA 3TNXA 3V6EA 3BOWA 3BB7A 4YYWA 2VHSA 4MZOA 5CHTA 4YVAA 1CVZA 2P86A 3GCBA 1AECA 2E00A 2F7DA 4R3DA 2F1GA 3P5WA 4AXMA 3S3QA 4GUAA 4I07A 2Y6EA 2DC8A 2E03A 2PNSA 3C0RA 1X9YA 3OF9A 1U9QX 1CTEA 1VSNA 2BU3A 3IEJA 2AYOA 3KWZA 3CH3X 3E9SA 4BOUA 1CV8A 1A6RA 1QMYA 2FT2A 3MJ5A 4N4ZA 1QDQA 3QSDA 4YV8A 1MDWA 3PRMA 1CS8A 3OISA 2R9FA 2DC6A 3O1GA 3OVZA 3P5UA 2YJBA 2XU3A 1YK7A 3F5VA 3H89A 3NHEA 4BSQA 3PDFA 2J7QC 1NPZA 3IFUA 1O0EA 1AU3A 4CDFB 3PRPA 5E6JA 5A24A 3BY4A 1AIMA 2FE8A 2GHUA 2YJ2A 2Y5BA 2AUXA 4PP1A 2R9CA 2IBIA 1Y4HA 2J7QA 2DCAA 2B1MA 3HD3A 4OVZA 3M99A 1ME4A 3WXGA 2CB5A 2FQ9A 4RF0A 1EWMA 1S4VA 4X6JA 1DKIA 2FTDA 4K7CA 1STFE 3IV2A 2GFOA 3K8UA 4YYVA 2UZJA 1EWPA 4N8WA 1TU6A 1U9WA 4BOQA 4DMXA 3CBJA 3IOQA 1NB5A 2JRIA 4OEMA 1THEA 2PADA 3KSEA 3MORA 4MZSA 2G8EA 3PT2A 4WA6A 1PIPA 1PADA 4A5UA 2FRAA 2G6DA 2E01A 2DZYA 1UKFA 1YZBA 1BP4A 5CVMA 3N3GA 4FJCA 4QRXA 1YK8A 2DJFB 1ITOA 1QOLA 1EF7A 4BPVA 1KXRA 3IUTA 3LXSA 1ZIVA 1POPA 4OVZB 2NQIA 4ZUXU 2R9NA 3PHUA 1PPNA 1KHPA 4PI3A 4CDDB 1KHQA 3B79A 1GCBA 2XU4A 3OVXA 4QH6A 3K24A 6PADA 1BQIA 3ERVA 3BC3A 1SP4B 2PREA 3N3KA 2NQAA 1AYWA 5EZSA 1CQDA 1ZCMA 1CSBB 4HXDB 3BWKA 3RVXA 1PXVA 3WXFA 4G54A 3BBAA 3O65A 2PBHA 2AS8A 1DF0A 4KLBA 1GLOA 5F02A 1SNKA 4DMYA 3CBKA 1KFUL 4Q8GA 4QRVA 2P0RA 4BOSA 3U8EA 4BOZA 5FPWA 3PSEA 3P5XA 2R9OA 4P16A 4WURA 4BS6A 1NL6A 1FH0A 1IWDA 2WBFX 3MTVA
chains in the Genus database with same CATH topology
3HHAA 3PW3A 1GMYA 3QJ3A 1W6FA 1JQPA 1PPDA 2DC9A 1XKGA 1YT7A 4QBBA 3K9MA 5JA7A 4XUIA 3ZUAA 2JQFR 2OP3A 3PNRA 1CB5A 4YYSA 3USVA 3F75A 3MTNA 2AVWA 1PBHA 3E1ZB 2R6NA 3I3TA 3RVWA 3H8BA 5EF4A 3AI8A 2DC7A 3C9EA 3KWBX 1NLJA 1YALA 2P7UA 1AU0A 1PPPA 1Q6KA 2BDLA 4BS5A 1PPOA 4N79A 4X6IA 4YYRA 2BSZA 1AYVA 2YJ9A 1Y08A 2AYNA 1TL9A 2VFCA 1KFXL 4CZWA 8PCHA 4PP2E 3DF0A 3I06A 2ATOA 3KFQA 1F2AA 3O0UA 2O6XA 4W5CA 4P6EA 1MHWA 4Q8HA 1MEGA 4W5BA 4P6GA 1HUCB 5PADA 4W4UA 2ARYA 4CDCB 7PCKA 4RY2A 1U9XA 3KKUA 4MSXA 2OULA 3MHHA 3MHSA 1EWOA 2B1NA 3BCNA 2XU5A 1MEMA 3S3RA 4X6HA 5CVNB 4I05A 2FYEA 2AUZA 1MS6A 3H7DA 1E2TA 1GECE 4PADA 3OF8A 2HHNA 2NQDB 1BY8A 2DCCA 5J94A 9PAPA 3IHPA 2VHFA 4HWYA 2YJCA 4OELA 2ACTA 2BDZA 5K16A 1AU4A 1DEUA 2FRQA 5EGWA 1ATKA 3D6SA 1F2BA 4I04A 2AU1A 3LTWA 2FUDA 1QXPA 1BGOA 5CHVA 3HWNA 4YYQA 1CJLA 1AYUA 2NQGA 2DJGB 2IPPB 2CIOA 1PCIA 3BPMA 3H8CA 2OZ2A 1AU2A 1CPJA 3PBHA 1U5IA 4QRGA 3CH2X 4CDEB 2HXZA 1ME3A 1NQCA 2HH5A 4AXLA 1GX3A 1MIRA 2C0YA 1ICFA 3IMAA 1F29A 1W5RA 4NV7A 3WXEA 4FIPA 2DCDA 5CVOB 2G7YA 1U9VA 3KX1A 2FO5A 2XU1A 2YJ8A 1M6DA 4YYUA 3BPFA 3V6CA 2JQGR 3KW9A 1F2CA 3H6SA 3HHIA 2H7JA 3QT4A 1PE6A 3N4CA 2G8JA 1TLOA 1K3BB 1EWLA 2AIMA 2HD5A 4XR7A 1NB3A 2R9MA 3LFYA 4FK5A 2E02A 1W4TA 4BQVA 3P5VA 1VJVA 5JH3A 3RVVA 2DCBA 1YVBA 2DZZA 3TNXA 3V6EA 3BOWA 4YYWA 2VHSA 4MZOA 5CHTA 4YVAA 1CVZA 2P86A 3GCBA 1AECA 2E00A 2F7DA 2F1GA 3P5WA 4AXMA 3S3QA 4I07A 2Y6EA 2DC8A 2E03A 2PNSA 1X9YA 3OF9A 2VFBA 1U9QX 1CTEA 1VSNA 3IEJA 2AYOA 3KWZA 3CH3X 1CV8A 4C5PA 1A6RA 1QMYA 2FT2A 4N4ZA 1QDQA 3QSDA 4YV8A 1MDWA 1CS8A 3OISA 2R9FA 2DC6A 3O1GA 3OVZA 3P5UA 2YJBA 2XU3A 1YK7A 3F5VA 3H89A 3NHEA 4BSQA 3PDFA 1NPZA 1O0EA 4NV8A 1AU3A 4CDFB 5A24A 1AIMA 2GHUA 2YJ2A 2Y5BA 2AUXA 4PP1A 2R9CA 2IBIA 1Y4HA 2DCAA 2B1MA 3HD3A 3M99A 1ME4A 4GUZA 2CB5A 2FQ9A 3WXGA 4B55A 1EWMA 1S4VA 4X6JA 2FTDA 4K7CA 1STFE 3IV2A 2GFOA 3K8UA 4YYVA 1EWPA 4N8WA 1TU6A 1U9WA 4DMXA 1NB5A 3CBJA 3IOQA 4OEMA 1THEA 2PADA 3KSEA 3MORA 4MZSA 2G8EA 4WA6A 1PIPA 1PADA 2FRAA 2G6DA 2E01A 2DZYA 1BP4A 5CVMA 3N3GA 4FJCA 4QRXA 1YK8A 2DJFB 1ITOA 1QOLA 1EF7A 4BPVA 1KXRA 3IUTA 3LXSA 1ZIVA 1POPA 2NQIA 4ZUXU 2R9NA 1PPNA 1KHPA 4PI3A 4CDDB 1KHQA 3B79A 1GCBA 2XU4A 3OVXA 4QH6A 3K24A 6PADA 1BQIA 3D9WA 3ERVA 3BC3A 1SP4B 2PREA 3N3KA 2NQAA 1AYWA 1CQDA 1ZCMA 1CSBB 3BWKA 3RVXA 1PXVA 3WXFA 4G54A 2PBHA 4BGFA 2AS8A 1DF0A 4KLBA 1GLOA 5F02A 4DMYA 3CBKA 1KFUL 4Q8GA 4QRVA 2P0RA 3U8EA 5FPWA 3P5XA 2R9OA 4BS6A 1NL6A 1FH0A 1IWDA 2WBFX 1SNKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HHA A;  3PW3 A;  1GMY A;  3QJ3 A;  1JQP A;  1PPD A;  2DC9 A;  1XKG A;  1YT7 A;  4QBB A;  3K9M A;  5JA7 A;  4XUI A;  3ZUA A;  2JQF R;  2OP3 A;  3PNR A;  1CB5 A;  4YYS A;  3USV A;  3F75 A;  3MTN A;  2AVW A;  1PBH A;  3E1Z B;  2R6N A;  3I3T A;  3RVW A;  3H8B A;  5EF4 A;  3AI8 A;  2DC7 A;  3C9E A;  3KWB X;  1NLJ A;  1YAL A;  2P7U A;  1AU0 A;  1PPP A;  1Q6K A;  2BDL A;  4BS5 A;  1PPO A;  4N79 A;  4X6I A;  4YYR A;  1AYV A;  2YJ9 A;  1Y08 A;  2AYN A;  1TL9 A;  1KFX L;  4CZW A;  8PCH A;  4PP2 E;  3DF0 A;  3I06 A;  2ATO A;  3KFQ A;  1F2A A;  3O0U A;  2O6X A;  4W5C A;  4P6E A;  1MHW A;  4Q8H A;  1MEG A;  4W5B A;  4P6G A;  1HUC B;  5PAD A;  4W4U A;  2ARY A;  4CDC B;  7PCK A;  4RY2 A;  1U9X A;  3KKU A;  4MSX A;  2OUL A;  3MHH A;  3MHS A;  1EWO A;  2B1N A;  3BCN A;  2XU5 A;  1MEM A;  3S3R A;  4X6H A;  5CVN B;  4I05 A;  2FYE A;  2AUZ A;  1MS6 A;  3H7D A;  1GEC E;  4PAD A;  3OF8 A;  2HHN A;  2NQD B;  1BY8 A;  2DCC A;  5J94 A;  9PAP A;  3IHP A;  2VHF A;  4HWY A;  2YJC A;  4OEL A;  2ACT A;  2BDZ A;  5K16 A;  1AU4 A;  1DEU A;  2FRQ A;  5EGW A;  1ATK A;  3D6S A;  1F2B A;  4I04 A;  2AU1 A;  2FUD A;  1QXP A;  1BGO A;  5CHV A;  3HWN A;  4YYQ A;  1CJL A;  1AYU A;  2NQG A;  2DJG B;  2IPP B;  2CIO A;  1PCI A;  3BPM A;  3H8C A;  2OZ2 A;  1AU2 A;  1CPJ A;  3PBH A;  1U5I A;  4QRG A;  3CH2 X;  4CDE B;  2HXZ A;  1ME3 A;  1NQC A;  2HH5 A;  4AXL A;  1MIR A;  2C0Y A;  1ICF A;  3IMA A;  1F29 A;  3WXE A;  4FIP A;  2DCD A;  5CVO B;  2G7Y A;  1U9V A;  3KX1 A;  2FO5 A;  2XU1 A;  2YJ8 A;  1M6D A;  4YYU A;  3BPF A;  3V6C A;  2JQG R;  3KW9 A;  1F2C A;  3H6S A;  3HHI A;  2H7J A;  3QT4 A;  1PE6 A;  3N4C A;  2G8J A;  1TLO A;  1K3B B;  1EWL A;  2AIM A;  2HD5 A;  4XR7 A;  1NB3 A;  2R9M A;  3LFY A;  4FK5 A;  2E02 A;  4BQV A;  3P5V A;  1VJV A;  5JH3 A;  3RVV A;  2DCB A;  1YVB A;  2DZZ A;  3TNX A;  3V6E A;  3BOW A;  4YYW A;  2VHS A;  4MZO A;  5CHT A;  4YVA A;  1CVZ A;  2P86 A;  3GCB A;  1AEC A;  2E00 A;  2F7D A;  2F1G A;  3P5W A;  4AXM A;  3S3Q A;  4I07 A;  2Y6E A;  2DC8 A;  2E03 A;  2PNS A;  1X9Y A;  3OF9 A;  1U9Q X;  1CTE A;  1VSN A;  3IEJ A;  2AYO A;  3KWZ A;  3CH3 X;  1CV8 A;  1A6R A;  1QMY A;  2FT2 A;  4N4Z A;  1QDQ A;  3QSD A;  4YV8 A;  1MDW A;  1CS8 A;  3OIS A;  2R9F A;  2DC6 A;  3O1G A;  3OVZ A;  3P5U A;  2YJB A;  2XU3 A;  1YK7 A;  3F5V A;  3H89 A;  3NHE A;  4BSQ A;  3PDF A;  1NPZ A;  1O0E A;  1AU3 A;  4CDF B;  5A24 A;  1AIM A;  2GHU A;  2YJ2 A;  2Y5B A;  2AUX A;  4PP1 A;  2R9C A;  2IBI A;  1Y4H A;  2DCA A;  2B1M A;  3HD3 A;  3M99 A;  1ME4 A;  3WXG A;  2CB5 A;  2FQ9 A;  1EWM A;  1S4V A;  4X6J A;  2FTD A;  4K7C A;  1STF E;  3IV2 A;  2GFO A;  3K8U A;  4YYV A;  1EWP A;  4N8W A;  1TU6 A;  1U9W A;  4DMX A;  1NB5 A;  3CBJ A;  3IOQ A;  4OEM A;  1THE A;  2PAD A;  3KSE A;  3MOR A;  4MZS A;  2G8E A;  4WA6 A;  1PIP A;  1PAD A;  2FRA A;  2G6D A;  2E01 A;  2DZY A;  1BP4 A;  5CVM A;  3N3G A;  4FJC A;  4QRX A;  1YK8 A;  2DJF B;  1ITO A;  1QOL A;  1EF7 A;  4BPV A;  1KXR A;  3IUT A;  3LXS A;  1ZIV A;  1POP A;  2NQI A;  4ZUX U;  2R9N A;  1PPN A;  1KHP A;  4PI3 A;  4CDD B;  1KHQ A;  3B79 A;  1GCB A;  2XU4 A;  3OVX A;  4QH6 A;  3K24 A;  6PAD A;  1BQI A;  3ERV A;  3BC3 A;  1SP4 B;  2PRE A;  3N3K A;  2NQA A;  1AYW A;  1CQD A;  1ZCM A;  1CSB B;  3BWK A;  3RVX A;  1PXV A;  3WXF A;  4G54 A;  2PBH A;  2AS8 A;  1DF0 A;  4KLB A;  1GLO A;  5F02 A;  4DMY A;  3CBK A;  1KFU L;  4Q8G A;  4QRV A;  2P0R A;  3U8E A;  5FPW A;  3P5X A;  2R9O A;  4BS6 A;  1NL6 A;  1FH0 A;  1IWD A;  2WBF X;  1SNK A; 
#chains in the Genus database with same CATH topology
 3HHA A;  3PW3 A;  1GMY A;  3TMP A;  3QJ3 A;  1JQP A;  1PPD A;  2DC9 A;  1XKG A;  1YT7 A;  4QBB A;  4XZX A;  3K9M A;  5JA7 A;  4XUI A;  3ZUA A;  2JQF R;  2OP3 A;  3PNR A;  1CB5 A;  4YYS A;  3USV A;  3F75 A;  3MTN A;  2AVW A;  1PBH A;  3E1Z B;  2R6N A;  3I3T A;  5KO3 A;  3RVW A;  3H8B A;  5EF4 A;  3AI8 A;  2DC7 A;  4REZ A;  3C9E A;  3KWB X;  4MM3 B;  1NLJ A;  1YAL A;  4D8E A;  2P7U A;  4RF1 A;  1AU0 A;  1PVJ A;  1PPP A;  1Q6K A;  2BDL A;  3B21 A;  4BS5 A;  1PPO A;  2AGA A;  4N79 A;  5JZE A;  4X6I A;  4YYR A;  1AYV A;  2YJ9 A;  4ZTB A;  3RNV A;  1Y08 A;  2AYN A;  1TL9 A;  1KFX L;  4CZW A;  8PCH A;  4PP2 E;  3DF0 A;  3I06 A;  2ATO A;  3KFQ A;  1F2A A;  4BOP A;  3O0U A;  2O6X A;  4W5C A;  3W30 A;  2DOS A;  4P6E A;  1MHW A;  4Q8H A;  1MEG A;  4W5B A;  4P6G A;  4PT5 A;  1HUC B;  5PAD A;  4W4U A;  2ARY A;  4CDC B;  7PCK A;  4RY2 A;  1U9X A;  2JTC A;  4D8I A;  3KKU A;  4MSX A;  2OUL A;  3MHH A;  3MHS A;  1EWO A;  2B1N A;  3BCN A;  2XU5 A;  4MI7 A;  1MEM A;  3S3R A;  4X6H A;  5CVN B;  4IUM A;  4I05 A;  2FYE A;  2AUZ A;  1MS6 A;  3H7D A;  1GEC E;  4PAD A;  3OF8 A;  2HHN A;  2NQD B;  1BY8 A;  3W31 A;  2DCC A;  5J94 A;  9PAP A;  3PHW A;  3IHP A;  4IP3 A;  5EZQ A;  3MP2 A;  2VHF A;  4HWY A;  2YJC A;  4OEL A;  2ACT A;  2BDZ A;  4RNA A;  5K16 A;  1AU4 A;  1DEU A;  2FRQ A;  5EGW A;  1ATK A;  3D6S A;  1F2B A;  4I04 A;  2AU1 A;  2FUD A;  1QXP A;  1BGO A;  5CHV A;  3HWN A;  4YYQ A;  1CJL A;  1AYU A;  2NQG A;  2DJG B;  2IPP B;  2CIO A;  1PCI A;  3BPM A;  3H8C A;  2OZ2 A;  1AU2 A;  1CPJ A;  3PBH A;  1U5I A;  4QRG A;  4RKX A;  3PHX A;  2Z84 A;  3CH2 X;  4CDE B;  2HXZ A;  1ME3 A;  1NQC A;  2HH5 A;  3ZNH A;  4AXL A;  1MIR A;  2C0Y A;  1ICF A;  3IMA A;  1F29 A;  3WXE A;  4FIP A;  2DCD A;  5CVO B;  2G7Y A;  1U9V A;  3KX1 A;  2FO5 A;  2XU1 A;  2YJ8 A;  1M6D A;  4YYU A;  3BPF A;  4M0W A;  3V6C A;  4D8B A;  2JQG R;  3KW9 A;  1F2C A;  3H6S A;  3HHI A;  2H7J A;  3QT4 A;  1PE6 A;  3N4C A;  2G8J A;  1TLO A;  2HWK A;  1K3B B;  1EWL A;  2BTW A;  2AIM A;  2HD5 A;  4XR7 A;  1NB3 A;  2BTW B;  2R9M A;  3LFY A;  4FK5 A;  2E02 A;  4OW0 A;  3TRK A;  3OQC A;  4BQV A;  3P5V A;  1VJV A;  5JH3 A;  3RVV A;  2DCB A;  1YVB A;  2DZZ A;  3TNX A;  3V6E A;  3BOW A;  3BB7 A;  4YYW A;  2VHS A;  4MZO A;  5CHT A;  4YVA A;  1CVZ A;  2P86 A;  3GCB A;  1AEC A;  2E00 A;  2F7D A;  4R3D A;  2F1G A;  3P5W A;  4AXM A;  3S3Q A;  4GUA A;  4I07 A;  2Y6E A;  2DC8 A;  2E03 A;  2PNS A;  3C0R A;  1X9Y A;  3OF9 A;  1U9Q X;  1CTE A;  1VSN A;  2BU3 A;  3IEJ A;  2AYO A;  3KWZ A;  3CH3 X;  3E9S A;  4BOU A;  1CV8 A;  1A6R A;  1QMY A;  2FT2 A;  3MJ5 A;  4N4Z A;  1QDQ A;  3QSD A;  4YV8 A;  1MDW A;  3PRM A;  1CS8 A;  3OIS A;  2R9F A;  2DC6 A;  3O1G A;  3OVZ A;  3P5U A;  2YJB A;  2XU3 A;  1YK7 A;  3F5V A;  3H89 A;  3NHE A;  4BSQ A;  3PDF A;  2J7Q C;  1NPZ A;  3IFU A;  1O0E A;  1AU3 A;  4CDF B;  3PRP A;  5E6J A;  5A24 A;  3BY4 A;  1AIM A;  2FE8 A;  2GHU A;  2YJ2 A;  2Y5B A;  2AUX A;  4PP1 A;  2R9C A;  2IBI A;  1Y4H A;  2J7Q A;  2DCA A;  2B1M A;  3HD3 A;  4OVZ A;  3M99 A;  1ME4 A;  3WXG A;  2CB5 A;  2FQ9 A;  4RF0 A;  1EWM A;  1S4V A;  4X6J A;  1DKI A;  2FTD A;  4K7C A;  1STF E;  3IV2 A;  2GFO A;  3K8U A;  4YYV A;  2UZJ A;  1EWP A;  4N8W A;  1TU6 A;  1U9W A;  4BOQ A;  4DMX A;  3CBJ A;  3IOQ A;  1NB5 A;  2JRI A;  4OEM A;  1THE A;  2PAD A;  3KSE A;  3MOR A;  4MZS A;  2G8E A;  3PT2 A;  4WA6 A;  1PIP A;  1PAD A;  4A5U A;  2FRA A;  2G6D A;  2E01 A;  2DZY A;  1UKF A;  1YZB A;  1BP4 A;  5CVM A;  3N3G A;  4FJC A;  4QRX A;  1YK8 A;  2DJF B;  1ITO A;  1QOL A;  1EF7 A;  4BPV A;  1KXR A;  3IUT A;  3LXS A;  1ZIV A;  1POP A;  4OVZ B;  2NQI A;  4ZUX U;  2R9N A;  3PHU A;  1PPN A;  1KHP A;  4PI3 A;  4CDD B;  1KHQ A;  3B79 A;  1GCB A;  2XU4 A;  3OVX A;  4QH6 A;  3K24 A;  6PAD A;  1BQI A;  3ERV A;  3BC3 A;  1SP4 B;  2PRE A;  3N3K A;  2NQA A;  1AYW A;  5EZS A;  1CQD A;  1ZCM A;  1CSB B;  4HXD B;  3BWK A;  3RVX A;  1PXV A;  3WXF A;  4G54 A;  3BBA A;  3O65 A;  2PBH A;  2AS8 A;  1DF0 A;  4KLB A;  1GLO A;  5F02 A;  1SNK A;  4DMY A;  3CBK A;  1KFU L;  4Q8G A;  4QRV A;  2P0R A;  4BOS A;  3U8E A;  4BOZ A;  5FPW A;  3PSE A;  3P5X A;  2R9O A;  4P16 A;  4WUR A;  4BS6 A;  1NL6 A;  1FH0 A;  1IWD A;  2WBF X;  3MTV A; 
#chains in the Genus database with same CATH homology
 3HHA A;  3PW3 A;  1GMY A;  3QJ3 A;  1W6F A;  1JQP A;  1PPD A;  2DC9 A;  1XKG A;  1YT7 A;  4QBB A;  3K9M A;  5JA7 A;  4XUI A;  3ZUA A;  2JQF R;  2OP3 A;  3PNR A;  1CB5 A;  4YYS A;  3USV A;  3F75 A;  3MTN A;  2AVW A;  1PBH A;  3E1Z B;  2R6N A;  3I3T A;  3RVW A;  3H8B A;  5EF4 A;  3AI8 A;  2DC7 A;  3C9E A;  3KWB X;  1NLJ A;  1YAL A;  2P7U A;  1AU0 A;  1PPP A;  1Q6K A;  2BDL A;  4BS5 A;  1PPO A;  4N79 A;  4X6I A;  4YYR A;  2BSZ A;  1AYV A;  2YJ9 A;  1Y08 A;  2AYN A;  1TL9 A;  2VFC A;  1KFX L;  4CZW A;  8PCH A;  4PP2 E;  3DF0 A;  3I06 A;  2ATO A;  3KFQ A;  1F2A A;  3O0U A;  2O6X A;  4W5C A;  4P6E A;  1MHW A;  4Q8H A;  1MEG A;  4W5B A;  4P6G A;  1HUC B;  5PAD A;  4W4U A;  2ARY A;  4CDC B;  7PCK A;  4RY2 A;  1U9X A;  3KKU A;  4MSX A;  2OUL A;  3MHH A;  3MHS A;  1EWO A;  2B1N A;  3BCN A;  2XU5 A;  1MEM A;  3S3R A;  4X6H A;  5CVN B;  4I05 A;  2FYE A;  2AUZ A;  1MS6 A;  3H7D A;  1E2T A;  1GEC E;  4PAD A;  3OF8 A;  2HHN A;  2NQD B;  1BY8 A;  2DCC A;  5J94 A;  9PAP A;  3IHP A;  2VHF A;  4HWY A;  2YJC A;  4OEL A;  2ACT A;  2BDZ A;  5K16 A;  1AU4 A;  1DEU A;  2FRQ A;  5EGW A;  1ATK A;  3D6S A;  1F2B A;  4I04 A;  2AU1 A;  3LTW A;  2FUD A;  1QXP A;  1BGO A;  5CHV A;  3HWN A;  4YYQ A;  1CJL A;  1AYU A;  2NQG A;  2DJG B;  2IPP B;  2CIO A;  1PCI A;  3BPM A;  3H8C A;  2OZ2 A;  1AU2 A;  1CPJ A;  3PBH A;  1U5I A;  4QRG A;  3CH2 X;  4CDE B;  2HXZ A;  1ME3 A;  1NQC A;  2HH5 A;  4AXL A;  1GX3 A;  1MIR A;  2C0Y A;  1ICF A;  3IMA A;  1F29 A;  1W5R A;  4NV7 A;  3WXE A;  4FIP A;  2DCD A;  5CVO B;  2G7Y A;  1U9V A;  3KX1 A;  2FO5 A;  2XU1 A;  2YJ8 A;  1M6D A;  4YYU A;  3BPF A;  3V6C A;  2JQG R;  3KW9 A;  1F2C A;  3H6S A;  3HHI A;  2H7J A;  3QT4 A;  1PE6 A;  3N4C A;  2G8J A;  1TLO A;  1K3B B;  1EWL A;  2AIM A;  2HD5 A;  4XR7 A;  1NB3 A;  2R9M A;  3LFY A;  4FK5 A;  2E02 A;  1W4T A;  4BQV A;  3P5V A;  1VJV A;  5JH3 A;  3RVV A;  2DCB A;  1YVB A;  2DZZ A;  3TNX A;  3V6E A;  3BOW A;  4YYW A;  2VHS A;  4MZO A;  5CHT A;  4YVA A;  1CVZ A;  2P86 A;  3GCB A;  1AEC A;  2E00 A;  2F7D A;  2F1G A;  3P5W A;  4AXM A;  3S3Q A;  4I07 A;  2Y6E A;  2DC8 A;  2E03 A;  2PNS A;  1X9Y A;  3OF9 A;  2VFB A;  1U9Q X;  1CTE A;  1VSN A;  3IEJ A;  2AYO A;  3KWZ A;  3CH3 X;  1CV8 A;  4C5P A;  1A6R A;  1QMY A;  2FT2 A;  4N4Z A;  1QDQ A;  3QSD A;  4YV8 A;  1MDW A;  1CS8 A;  3OIS A;  2R9F A;  2DC6 A;  3O1G A;  3OVZ A;  3P5U A;  2YJB A;  2XU3 A;  1YK7 A;  3F5V A;  3H89 A;  3NHE A;  4BSQ A;  3PDF A;  1NPZ A;  1O0E A;  4NV8 A;  1AU3 A;  4CDF B;  5A24 A;  1AIM A;  2GHU A;  2YJ2 A;  2Y5B A;  2AUX A;  4PP1 A;  2R9C A;  2IBI A;  1Y4H A;  2DCA A;  2B1M A;  3HD3 A;  3M99 A;  1ME4 A;  4GUZ A;  2CB5 A;  2FQ9 A;  3WXG A;  4B55 A;  1EWM A;  1S4V A;  4X6J A;  2FTD A;  4K7C A;  1STF E;  3IV2 A;  2GFO A;  3K8U A;  4YYV A;  1EWP A;  4N8W A;  1TU6 A;  1U9W A;  4DMX A;  1NB5 A;  3CBJ A;  3IOQ A;  4OEM A;  1THE A;  2PAD A;  3KSE A;  3MOR A;  4MZS A;  2G8E A;  4WA6 A;  1PIP A;  1PAD A;  2FRA A;  2G6D A;  2E01 A;  2DZY A;  1BP4 A;  5CVM A;  3N3G A;  4FJC A;  4QRX A;  1YK8 A;  2DJF B;  1ITO A;  1QOL A;  1EF7 A;  4BPV A;  1KXR A;  3IUT A;  3LXS A;  1ZIV A;  1POP A;  2NQI A;  4ZUX U;  2R9N A;  1PPN A;  1KHP A;  4PI3 A;  4CDD B;  1KHQ A;  3B79 A;  1GCB A;  2XU4 A;  3OVX A;  4QH6 A;  3K24 A;  6PAD A;  1BQI A;  3D9W A;  3ERV A;  3BC3 A;  1SP4 B;  2PRE A;  3N3K A;  2NQA A;  1AYW A;  1CQD A;  1ZCM A;  1CSB B;  3BWK A;  3RVX A;  1PXV A;  3WXF A;  4G54 A;  2PBH A;  4BGF A;  2AS8 A;  1DF0 A;  4KLB A;  1GLO A;  5F02 A;  4DMY A;  3CBK A;  1KFU L;  4Q8G A;  4QRV A;  2P0R A;  3U8E A;  5FPW A;  3P5X A;  2R9O A;  4BS6 A;  1NL6 A;  1FH0 A;  1IWD A;  2WBF X;  1SNK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...