3WXEA

Crystal structure of cyld usp domain (c596s) in complex with met1-linked diubiquitin
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
309
structure length
301
Chain Sequence
MGLEVMVGKKKGIQGHYNSSYLDSTLFCLFSFSSVLDTVLLRPRSKTDVEYYKETQELLRTEIVNPLRIHGYVCATKIMKLRRILEKVEAASGFTSEEKDPEEFLNILFHHILRVDPLLRLRSAGQKVQDCYFYQIFMDKKDKVMVPTSQQLLEWSFINSDLKFAEAPSCLIIQMPRFGKDFKMFNKIFPSLELDITDLLDDQQMELFAVLCIETSHYVAFVKYGSADSAWLFFDSMADRDGGQNGFNIPQVSRCPEVGEYLKMTPEELHALDPKNIQGYARRLLCDAYMCMYQSPTMSLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Uncharacterized protein
publication title Structures of CYLD USP with Met1- or Lys63-linked diubiquitin reveal mechanisms for dual specificity
doi rcsb
source organism Danio rerio
molecule tags Hydrolase/protein binding
total genus 84
structure length 301
sequence length 309
ec nomenclature
pdb deposition date 2014-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00443 UCH Ubiquitin carboxyl-terminal hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3wxeA00
2FT2A 1EWLA 1Q6KA 1F2BA 2PADA 1ICFA 1AU2A 1KXRA 2JQGR 3WXEA 4OEMA 1VSNA 2NQDB 1NB3A 2AIMA 1ZIVA 3QSDA 4I04A 2H7JA 4QRVA 1TLOA 5JH3A 4YYWA 1VJVA 2O6XA 3P5XA 1U9XA 4P6EA 2Y5BA 1YK8A 1NB5A 4MSXA 2R9NA 3P5VA 3HHIA 4QRGA 2CIOA 1ZCMA 2AS8A 7PCKA 4AXMA 4XUIA 2F1GA 2YJ2A 5FPWA 1DEUA 4BS5A 3V6EA 1CV8A 4YV8A 1CSBB 4BS6A 4YYUA 2DC8A 3U8EA 2R9MA 3HHAA 2VHFA 3MHSA 4K7CA 2OZ2A 3ERVA 1AU0A 2G8EA 2YJBA 2NQIA 3IMAA 1JQPA 5CVOB 1AU3A 1ME3A 1KFXL 2GFOA 5JA7A 2P0RA 2XU5A 4CDDB 1KHQA 1F29A 5EF4A 1YT7A 2FRQA 1M6DA 3CBJA 4BQVA 2PBHA 1KHPA 3C9EA 3KWZA 4YYRA 4PP1A 1AYUA 1KFUL 3IOQA 1POPA 3QJ3A 1U9VA 3TNXA 4WA6A 2R9FA 4Q8HA 1U5IA 3AI8A 4Q8GA 1CS8A 1CPJA 4XR7A 1MDWA 3CH2X 6PADA 3H89A 2VHSA 2OULA 1QOLA 2E01A 1FH0A 3USVA 1BY8A 1YALA 3S3QA 1SP4B 1O0EA 4P6GA 2DZYA 3NHEA 2F7DA 1TU6A 4YYSA 1MEGA 2Y6EA 3N4CA 4MZSA 2FYEA 3K24A 3N3KA 2AVWA 3KX1A 2HH5A 1U9QX 3KFQA 3RVVA 2PNSA 2XU4A 1NPZA 3OISA 1PCIA 4PP2E 1ITOA 2AU1A 2NQGA 3K8UA 3M99A 1PADA 4FIPA 1HUCB 2DJGB 2E02A 4G54A 1MIRA 3O0UA 1A6RA 2HXZA 1CB5A 4KLBA 4YYVA 1PIPA 3B79A 1GCBA 2FUDA 1IWDA 5EGWA 2DCBA 2E03A 3BPMA 3P5UA 1GECE 1NQCA 2CB5A 1PPOA 1QMYA 2B1NA 1Y4HA 3H7DA 2DCDA 2IBIA 3KKUA 3BCNA 2G6DA 1PPDA 2OP3A 2FQ9A 2XU1A 4CDFB 3P5WA 4HWYA 1QDQA 4W5BA 1NLJA 1BP4A 5CHVA 3RVWA 1ME4A 1NL6A 4FK5A 4DMXA 2DCCA 2AYNA 4PI3A 3IV2A 1YK7A 2FTDA 2XU3A 5CHTA 4DMYA 4BSQA 2P7UA 1PPPA 3KWBX 3BC3A 2WBFX 1DF0A 2DC7A 1BQIA 4W4UA 1AYWA 3IHPA 3E1ZB 4BPVA 2G8JA 3PW3A 3OVXA 2JQFR 3IUTA 3V6CA 3DF0A 2BDLA 4YYQA 1ATKA 3K9MA 1PPNA 3CH3X 1PXVA 3H8CA 1STFE 3HWNA 3H6SA 3MTNA 2AYOA 3OF8A 1X9YA 4QH6A 1AIMA 1QXPA 3PNRA 3HD3A 2YJ9A 4I07A 3QT4A 2R9CA 2BDZA 2B1MA 3S3RA 4CDEB 1EF7A 3N3GA 5PADA 4I05A 1CJLA 3H8BA 2HD5A 3RVXA 1PBHA 5K16A 2ACTA 1AYVA 2G7YA 3O1GA 1TL9A 4OELA 3MHHA 2P86A 3GCBA 2DZZA 2IPPB 1CTEA 2DJFB 3LXSA 1MS6A 4QRXA 5CVNB 4X6JA 2DC9A 1Y08A 4RY2A 1XKGA 3IEJA 3F5VA 1AECA 2DC6A 1GLOA 3I3TA 2E00A 1CQDA 2R6NA 4X6HA 5A24A 1MEMA 1MHWA 4CDCB 2NQAA 4AXLA 1SNKA 3LFYA 5F02A 5J94A 3KSEA 1AU4A 1EWOA 2YJCA 3KW9A 3WXFA 3OVZA 3PBHA 3D6SA 2DCAA 4PADA 3F75A 1S4VA 2GHUA 1U9WA 4CZWA 1EWMA 2R9OA 1BGOA 3BPFA 3ZUAA 4N4ZA 1EWPA 9PAPA 4N8WA 3BWKA 3WXGA 4MZOA 4ZUXU 3PDFA 4YVAA 3BOWA 4W5CA 1GMYA 1PE6A 3I06A 4X6IA 2FRAA 2C0YA 2HHNA 2ATOA 1K3BB 2ARYA 4QBBA 8PCHA 4N79A 1THEA 3CBKA 3MORA 1CVZA 1F2AA 2AUXA 2FO5A 2PREA 1YVBA 1F2CA 3OF9A 2YJ8A 4FJCA 2AUZA 5CVMA
chains in the Genus database with same CATH superfamily
2FT2A 3PT2A 1EWLA 1Q6KA 1F2BA 2PADA 2J7QA 1ICFA 1AU2A 1KXRA 2JQGR 5KO3A 3WXEA 4OEMA 1VSNA 2NQDB 4XZXA 1NB3A 2AIMA 1ZIVA 3QSDA 4I04A 2H7JA 4QRVA 1TLOA 5JH3A 4YYWA 4BOSA 1VJVA 2O6XA 3P5XA 1U9XA 3PRPA 4P6EA 4ZTBA 2Y5BA 1YK8A 4HXDB 1NB5A 4BOQA 3IFUA 4MSXA 2R9NA 3P5VA 3HHIA 4QRGA 2CIOA 3O65A 1ZCMA 2AS8A 2BTWB 7PCKA 4AXMA 4MI7A 4XUIA 2F1GA 2YJ2A 5FPWA 1DEUA 4BS5A 3V6EA 1CV8A 4YV8A 1CSBB 4BS6A 4YYUA 2DC8A 3U8EA 2R9MA 3MHSA 2VHFA 3HHAA 4K7CA 2OZ2A 3ERVA 1AU0A 2G8EA 2YJBA 2NQIA 3MTVA 3IMAA 1JQPA 5CVOB 1AU3A 1ME3A 4OVZA 4OW0A 1KFXL 2GFOA 5JA7A 2P0RA 2XU5A 4CDDB 1KHQA 1F29A 5EF4A 1YT7A 2FRQA 3W31A 3BBAA 3BY4A 1M6DA 3CBJA 2AGAA 4BQVA 3ZNHA 2PBHA 1KHPA 3C9EA 3KWZA 4YYRA 4PP1A 1AYUA 1KFUL 4RF0A 3TMPA 3IOQA 1POPA 3QJ3A 3C0RA 3MP2A 1U9VA 2HWKA 3TNXA 3PHWA 4WA6A 2R9FA 4Q8HA 1U5IA 3AI8A 4Q8GA 1CS8A 1CPJA 4XR7A 1MDWA 3CH2X 6PADA 3H89A 2VHSA 2OULA 1QOLA 4IUMA 2E01A 1FH0A 3USVA 1BY8A 1YALA 3S3QA 1SP4B 3B21A 1O0EA 4P6GA 2DZYA 3NHEA 2F7DA 4A5UA 1TU6A 2J7QC 2UZJA 4YYSA 1MEGA 2Y6EA 3N4CA 4MZSA 2FYEA 3E9SA 3K24A 3N3KA 2AVWA 3KX1A 2HH5A 1U9QX 3KFQA 3RVVA 2PNSA 2XU4A 1NPZA 3OISA 1PCIA 3W30A 4PP2E 4GUAA 1ITOA 2AU1A 4R3DA 2NQGA 3K8UA 3M99A 1PADA 4FIPA 1HUCB 2DJGB 2E02A 4G54A 1MIRA 3O0UA 1A6RA 4BOUA 2HXZA 4RKXA 1CB5A 4KLBA 4YYVA 1PIPA 3B79A 1GCBA 2FUDA 1IWDA 5EGWA 2DCBA 2E03A 3BPMA 1PVJA 3P5UA 1GECE 1NQCA 2CB5A 3PHUA 4BOPA 1PPOA 1QMYA 2B1NA 1Y4HA 3H7DA 2DCDA 2IBIA 3KKUA 4RF1A 3BCNA 2G6DA 1PPDA 4WURA 2OP3A 2FQ9A 2XU1A 3TRKA 4CDFB 3P5WA 4HWYA 1QDQA 4W5BA 4M0WA 1NLJA 1BP4A 5CHVA 4REZA 4OVZB 3RVWA 1ME4A 3RNVA 1NL6A 4FK5A 4DMXA 4D8IA 2DCCA 2AYNA 4PI3A 3IV2A 1YK7A 2FTDA 2XU3A 5CHTA 4DMYA 4BSQA 4IP3A 2P7UA 1PPPA 3OQCA 3KWBX 3BC3A 2WBFX 1DF0A 2DC7A 1BQIA 4W4UA 2JRIA 1AYWA 3IHPA 3E1ZB 4BPVA 2G8JA 3PW3A 3OVXA 2JQFR 3IUTA 3V6CA 3DF0A 2BDLA 4YYQA 1ATKA 3K9MA 1PPNA 3CH3X 1PXVA 3H8CA 1STFE 3HWNA 5EZQA 3H6SA 4D8EA 3MTNA 2AYOA 3OF8A 1X9YA 4QH6A 1AIMA 1QXPA 3PNRA 3HD3A 2YJ9A 4I07A 3QT4A 2R9CA 2BDZA 2B1MA 3S3RA 4CDEB 4RNAA 1EF7A 3N3GA 4BOZA 5PADA 4I05A 1YZBA 1CJLA 3H8BA 2HD5A 3MJ5A 3RVXA 1PBHA 5K16A 2ACTA 4D8BA 2DOSA 1AYVA 2G7YA 3O1GA 1TL9A 4OELA 3MHHA 2P86A 3GCBA 2DZZA 2IPPB 1CTEA 2DJFB 3LXSA 3PSEA 1MS6A 4QRXA 5CVNB 4X6JA 2DC9A 1Y08A 4RY2A 1XKGA 3IEJA 3F5VA 4P16A 1AECA 2DC6A 1GLOA 3I3TA 3PRMA 2E00A 1CQDA 2R6NA 4X6HA 5A24A 1MEMA 1MHWA 4CDCB 2BTWA 2NQAA 4AXLA 1SNKA 3LFYA 5F02A 5J94A 3KSEA 1AU4A 1EWOA 2YJCA 3KW9A 3WXFA 3OVZA 3PBHA 2FE8A 3D6SA 2DCAA 3PHXA 4PADA 3F75A 1S4VA 2BU3A 2GHUA 5JZEA 1U9WA 4CZWA 1EWMA 2R9OA 1BGOA 3BPFA 3ZUAA 4N4ZA 1EWPA 9PAPA 2Z84A 4N8WA 3BWKA 5E6JA 4MZOA 3WXGA 4ZUXU 3PDFA 4YVAA 3BOWA 4W5CA 1GMYA 5EZSA 1PE6A 3I06A 4X6IA 1UKFA 2FRAA 2JTCA 2C0YA 2HHNA 2ATOA 1K3BB 4MM3B 2ARYA 4QBBA 8PCHA 4N79A 1THEA 3CBKA 4PT5A 3BB7A 3MORA 1CVZA 1F2AA 2AUXA 2FO5A 2PREA 1DKIA 1YVBA 1F2CA 3OF9A 2YJ8A 4FJCA 2AUZA 5CVMA
chains in the Genus database with same CATH topology
2FT2A 1EWLA 1Q6KA 1F2BA 2PADA 1ICFA 1AU2A 1KXRA 2JQGR 3WXEA 4OEMA 1VSNA 2NQDB 1NB3A 2AIMA 1ZIVA 3QSDA 1GX3A 4I04A 2H7JA 4QRVA 1TLOA 5JH3A 4YYWA 1VJVA 2O6XA 3P5XA 1U9XA 4P6EA 2Y5BA 1YK8A 1NB5A 4MSXA 2R9NA 3P5VA 3HHIA 4QRGA 2CIOA 1ZCMA 2AS8A 7PCKA 4AXMA 4XUIA 2F1GA 2YJ2A 5FPWA 1DEUA 4BS5A 3V6EA 1CV8A 4YV8A 1CSBB 4BS6A 4YYUA 2DC8A 3U8EA 2R9MA 3HHAA 2VHFA 3MHSA 4K7CA 2OZ2A 3ERVA 4C5PA 1AU0A 2G8EA 2YJBA 2NQIA 3IMAA 1JQPA 5CVOB 1AU3A 1ME3A 1KFXL 2GFOA 5JA7A 1E2TA 2P0RA 2XU5A 4CDDB 1KHQA 1F29A 5EF4A 1YT7A 2FRQA 1M6DA 3CBJA 4GUZA 4BQVA 2PBHA 1KHPA 3C9EA 2BSZA 3KWZA 4YYRA 4PP1A 1AYUA 1KFUL 3IOQA 1POPA 3QJ3A 1U9VA 3TNXA 4WA6A 2R9FA 4Q8HA 1U5IA 3AI8A 4Q8GA 1W6FA 1CS8A 1CPJA 4XR7A 1MDWA 3CH2X 6PADA 3H89A 2VHSA 2OULA 1QOLA 2E01A 1FH0A 3USVA 1BY8A 1YALA 3S3QA 1SP4B 1O0EA 4P6GA 2DZYA 3NHEA 2F7DA 1TU6A 2VFCA 4YYSA 1MEGA 2Y6EA 3N4CA 4MZSA 2FYEA 3K24A 3N3KA 2AVWA 3KX1A 2HH5A 1U9QX 3KFQA 3RVVA 2PNSA 2XU4A 1NPZA 3OISA 1PCIA 4PP2E 1ITOA 2AU1A 2NQGA 3K8UA 3M99A 1PADA 4FIPA 1HUCB 2DJGB 2E02A 4G54A 1MIRA 3O0UA 1A6RA 2HXZA 1CB5A 4KLBA 4YYVA 1PIPA 3B79A 1GCBA 2FUDA 1IWDA 1W4TA 5EGWA 2DCBA 2E03A 3BPMA 3P5UA 1GECE 1NQCA 2CB5A 1PPOA 1QMYA 2B1NA 1Y4HA 3H7DA 2DCDA 2IBIA 3KKUA 3BCNA 2G6DA 1PPDA 2OP3A 2FQ9A 2XU1A 4CDFB 3P5WA 4HWYA 1QDQA 4W5BA 1NLJA 1BP4A 5CHVA 3RVWA 1ME4A 1NL6A 4FK5A 4DMXA 2DCCA 2AYNA 4B55A 4PI3A 2VFBA 3IV2A 1YK7A 2FTDA 2XU3A 5CHTA 4DMYA 4BSQA 2P7UA 1PPPA 3D9WA 3KWBX 3BC3A 2WBFX 1DF0A 2DC7A 1BQIA 4W4UA 1AYWA 3IHPA 3E1ZB 4BPVA 2G8JA 3PW3A 3OVXA 2JQFR 3IUTA 3V6CA 3DF0A 2BDLA 4YYQA 1ATKA 3K9MA 1PPNA 3CH3X 1PXVA 3H8CA 1STFE 3HWNA 3H6SA 3MTNA 2AYOA 3OF8A 1X9YA 4QH6A 1AIMA 1QXPA 3PNRA 3HD3A 2YJ9A 4I07A 1W5RA 3QT4A 2R9CA 2BDZA 2B1MA 3S3RA 4CDEB 1EF7A 3N3GA 5PADA 4I05A 4NV8A 1CJLA 3H8BA 2HD5A 3RVXA 1PBHA 5K16A 2ACTA 1AYVA 2G7YA 3O1GA 1TL9A 4OELA 3MHHA 2P86A 3GCBA 2DZZA 2IPPB 1CTEA 2DJFB 3LXSA 1MS6A 4QRXA 5CVNB 4X6JA 2DC9A 1Y08A 4RY2A 1XKGA 3IEJA 3F5VA 1AECA 2DC6A 1GLOA 3I3TA 2E00A 4BGFA 1CQDA 2R6NA 4X6HA 5A24A 1MEMA 1MHWA 4CDCB 2NQAA 4AXLA 1SNKA 3LFYA 5F02A 5J94A 3KSEA 1AU4A 1EWOA 2YJCA 3KW9A 3WXFA 3OVZA 3PBHA 3D6SA 2DCAA 3LTWA 4PADA 3F75A 1S4VA 2GHUA 1U9WA 4CZWA 1EWMA 2R9OA 1BGOA 3BPFA 3ZUAA 4N4ZA 1EWPA 9PAPA 4N8WA 3BWKA 3WXGA 4MZOA 4ZUXU 3PDFA 4YVAA 3BOWA 4W5CA 1GMYA 1PE6A 3I06A 4X6IA 2FRAA 2C0YA 2HHNA 2ATOA 1K3BB 2ARYA 4QBBA 8PCHA 4N79A 1THEA 3CBKA 3MORA 4NV7A 1CVZA 1F2AA 2AUXA 2FO5A 2PREA 1YVBA 1F2CA 3OF9A 2YJ8A 4FJCA 2AUZA 5CVMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FT2 A;  1EWL A;  1Q6K A;  1F2B A;  2PAD A;  1ICF A;  1AU2 A;  1KXR A;  2JQG R;  3WXE A;  4OEM A;  1VSN A;  2NQD B;  1NB3 A;  2AIM A;  1ZIV A;  3QSD A;  4I04 A;  2H7J A;  4QRV A;  1TLO A;  5JH3 A;  4YYW A;  1VJV A;  2O6X A;  3P5X A;  1U9X A;  4P6E A;  2Y5B A;  1YK8 A;  1NB5 A;  4MSX A;  2R9N A;  3P5V A;  3HHI A;  4QRG A;  2CIO A;  1ZCM A;  2AS8 A;  7PCK A;  4AXM A;  4XUI A;  2F1G A;  2YJ2 A;  5FPW A;  1DEU A;  4BS5 A;  3V6E A;  1CV8 A;  4YV8 A;  1CSB B;  4BS6 A;  4YYU A;  2DC8 A;  3U8E A;  2R9M A;  3HHA A;  2VHF A;  3MHS A;  4K7C A;  2OZ2 A;  3ERV A;  1AU0 A;  2G8E A;  2YJB A;  2NQI A;  3IMA A;  1JQP A;  5CVO B;  1AU3 A;  1ME3 A;  1KFX L;  2GFO A;  5JA7 A;  2P0R A;  2XU5 A;  4CDD B;  1KHQ A;  1F29 A;  5EF4 A;  1YT7 A;  2FRQ A;  1M6D A;  3CBJ A;  4BQV A;  2PBH A;  1KHP A;  3C9E A;  3KWZ A;  4YYR A;  4PP1 A;  1AYU A;  1KFU L;  3IOQ A;  1POP A;  3QJ3 A;  1U9V A;  3TNX A;  4WA6 A;  2R9F A;  4Q8H A;  1U5I A;  3AI8 A;  4Q8G A;  1CS8 A;  1CPJ A;  4XR7 A;  1MDW A;  3CH2 X;  6PAD A;  3H89 A;  2VHS A;  2OUL A;  1QOL A;  2E01 A;  1FH0 A;  3USV A;  1BY8 A;  1YAL A;  3S3Q A;  1SP4 B;  1O0E A;  4P6G A;  2DZY A;  3NHE A;  2F7D A;  1TU6 A;  4YYS A;  1MEG A;  2Y6E A;  3N4C A;  4MZS A;  2FYE A;  3K24 A;  3N3K A;  2AVW A;  3KX1 A;  2HH5 A;  1U9Q X;  3KFQ A;  3RVV A;  2PNS A;  2XU4 A;  1NPZ A;  3OIS A;  1PCI A;  4PP2 E;  1ITO A;  2AU1 A;  2NQG A;  3K8U A;  3M99 A;  1PAD A;  4FIP A;  1HUC B;  2DJG B;  2E02 A;  4G54 A;  1MIR A;  3O0U A;  1A6R A;  2HXZ A;  1CB5 A;  4KLB A;  4YYV A;  1PIP A;  3B79 A;  1GCB A;  2FUD A;  1IWD A;  5EGW A;  2DCB A;  2E03 A;  3BPM A;  3P5U A;  1GEC E;  1NQC A;  2CB5 A;  1PPO A;  1QMY A;  2B1N A;  1Y4H A;  3H7D A;  2DCD A;  2IBI A;  3KKU A;  3BCN A;  2G6D A;  1PPD A;  2OP3 A;  2FQ9 A;  2XU1 A;  4CDF B;  3P5W A;  4HWY A;  1QDQ A;  4W5B A;  1NLJ A;  1BP4 A;  5CHV A;  3RVW A;  1ME4 A;  1NL6 A;  4FK5 A;  4DMX A;  2DCC A;  2AYN A;  4PI3 A;  3IV2 A;  1YK7 A;  2FTD A;  2XU3 A;  5CHT A;  4DMY A;  4BSQ A;  2P7U A;  1PPP A;  3KWB X;  3BC3 A;  2WBF X;  1DF0 A;  2DC7 A;  1BQI A;  4W4U A;  1AYW A;  3IHP A;  3E1Z B;  4BPV A;  2G8J A;  3PW3 A;  3OVX A;  2JQF R;  3IUT A;  3V6C A;  3DF0 A;  2BDL A;  4YYQ A;  1ATK A;  3K9M A;  1PPN A;  3CH3 X;  1PXV A;  3H8C A;  1STF E;  3HWN A;  3H6S A;  3MTN A;  2AYO A;  3OF8 A;  1X9Y A;  4QH6 A;  1AIM A;  1QXP A;  3PNR A;  3HD3 A;  2YJ9 A;  4I07 A;  3QT4 A;  2R9C A;  2BDZ A;  2B1M A;  3S3R A;  4CDE B;  1EF7 A;  3N3G A;  5PAD A;  4I05 A;  1CJL A;  3H8B A;  2HD5 A;  3RVX A;  1PBH A;  5K16 A;  2ACT A;  1AYV A;  2G7Y A;  3O1G A;  1TL9 A;  4OEL A;  3MHH A;  2P86 A;  3GCB A;  2DZZ A;  2IPP B;  1CTE A;  2DJF B;  3LXS A;  1MS6 A;  4QRX A;  5CVN B;  4X6J A;  2DC9 A;  1Y08 A;  4RY2 A;  1XKG A;  3IEJ A;  3F5V A;  1AEC A;  2DC6 A;  1GLO A;  3I3T A;  2E00 A;  1CQD A;  2R6N A;  4X6H A;  5A24 A;  1MEM A;  1MHW A;  4CDC B;  2NQA A;  4AXL A;  1SNK A;  3LFY A;  5F02 A;  5J94 A;  3KSE A;  1AU4 A;  1EWO A;  2YJC A;  3KW9 A;  3WXF A;  3OVZ A;  3PBH A;  3D6S A;  2DCA A;  4PAD A;  3F75 A;  1S4V A;  2GHU A;  1U9W A;  4CZW A;  1EWM A;  2R9O A;  1BGO A;  3BPF A;  3ZUA A;  4N4Z A;  1EWP A;  9PAP A;  4N8W A;  3BWK A;  3WXG A;  4MZO A;  4ZUX U;  3PDF A;  4YVA A;  3BOW A;  4W5C A;  1GMY A;  1PE6 A;  3I06 A;  4X6I A;  2FRA A;  2C0Y A;  2HHN A;  2ATO A;  1K3B B;  2ARY A;  4QBB A;  8PCH A;  4N79 A;  1THE A;  3CBK A;  3MOR A;  1CVZ A;  1F2A A;  2AUX A;  2FO5 A;  2PRE A;  1YVB A;  1F2C A;  3OF9 A;  2YJ8 A;  4FJC A;  2AUZ A;  5CVM A; 
#chains in the Genus database with same CATH topology
 2FT2 A;  3PT2 A;  1EWL A;  1Q6K A;  1F2B A;  2PAD A;  2J7Q A;  1ICF A;  1AU2 A;  1KXR A;  2JQG R;  5KO3 A;  3WXE A;  4OEM A;  1VSN A;  2NQD B;  4XZX A;  1NB3 A;  2AIM A;  1ZIV A;  3QSD A;  4I04 A;  2H7J A;  4QRV A;  1TLO A;  5JH3 A;  4YYW A;  4BOS A;  1VJV A;  2O6X A;  3P5X A;  1U9X A;  3PRP A;  4P6E A;  4ZTB A;  2Y5B A;  1YK8 A;  4HXD B;  1NB5 A;  4BOQ A;  3IFU A;  4MSX A;  2R9N A;  3P5V A;  3HHI A;  4QRG A;  2CIO A;  3O65 A;  1ZCM A;  2AS8 A;  2BTW B;  7PCK A;  4AXM A;  4MI7 A;  4XUI A;  2F1G A;  2YJ2 A;  5FPW A;  1DEU A;  4BS5 A;  3V6E A;  1CV8 A;  4YV8 A;  1CSB B;  4BS6 A;  4YYU A;  2DC8 A;  3U8E A;  2R9M A;  3MHS A;  2VHF A;  3HHA A;  4K7C A;  2OZ2 A;  3ERV A;  1AU0 A;  2G8E A;  2YJB A;  2NQI A;  3MTV A;  3IMA A;  1JQP A;  5CVO B;  1AU3 A;  1ME3 A;  4OVZ A;  4OW0 A;  1KFX L;  2GFO A;  5JA7 A;  2P0R A;  2XU5 A;  4CDD B;  1KHQ A;  1F29 A;  5EF4 A;  1YT7 A;  2FRQ A;  3W31 A;  3BBA A;  3BY4 A;  1M6D A;  3CBJ A;  2AGA A;  4BQV A;  3ZNH A;  2PBH A;  1KHP A;  3C9E A;  3KWZ A;  4YYR A;  4PP1 A;  1AYU A;  1KFU L;  4RF0 A;  3TMP A;  3IOQ A;  1POP A;  3QJ3 A;  3C0R A;  3MP2 A;  1U9V A;  2HWK A;  3TNX A;  3PHW A;  4WA6 A;  2R9F A;  4Q8H A;  1U5I A;  3AI8 A;  4Q8G A;  1CS8 A;  1CPJ A;  4XR7 A;  1MDW A;  3CH2 X;  6PAD A;  3H89 A;  2VHS A;  2OUL A;  1QOL A;  4IUM A;  2E01 A;  1FH0 A;  3USV A;  1BY8 A;  1YAL A;  3S3Q A;  1SP4 B;  3B21 A;  1O0E A;  4P6G A;  2DZY A;  3NHE A;  2F7D A;  4A5U A;  1TU6 A;  2J7Q C;  2UZJ A;  4YYS A;  1MEG A;  2Y6E A;  3N4C A;  4MZS A;  2FYE A;  3E9S A;  3K24 A;  3N3K A;  2AVW A;  3KX1 A;  2HH5 A;  1U9Q X;  3KFQ A;  3RVV A;  2PNS A;  2XU4 A;  1NPZ A;  3OIS A;  1PCI A;  3W30 A;  4PP2 E;  4GUA A;  1ITO A;  2AU1 A;  4R3D A;  2NQG A;  3K8U A;  3M99 A;  1PAD A;  4FIP A;  1HUC B;  2DJG B;  2E02 A;  4G54 A;  1MIR A;  3O0U A;  1A6R A;  4BOU A;  2HXZ A;  4RKX A;  1CB5 A;  4KLB A;  4YYV A;  1PIP A;  3B79 A;  1GCB A;  2FUD A;  1IWD A;  5EGW A;  2DCB A;  2E03 A;  3BPM A;  1PVJ A;  3P5U A;  1GEC E;  1NQC A;  2CB5 A;  3PHU A;  4BOP A;  1PPO A;  1QMY A;  2B1N A;  1Y4H A;  3H7D A;  2DCD A;  2IBI A;  3KKU A;  4RF1 A;  3BCN A;  2G6D A;  1PPD A;  4WUR A;  2OP3 A;  2FQ9 A;  2XU1 A;  3TRK A;  4CDF B;  3P5W A;  4HWY A;  1QDQ A;  4W5B A;  4M0W A;  1NLJ A;  1BP4 A;  5CHV A;  4REZ A;  4OVZ B;  3RVW A;  1ME4 A;  3RNV A;  1NL6 A;  4FK5 A;  4DMX A;  4D8I A;  2DCC A;  2AYN A;  4PI3 A;  3IV2 A;  1YK7 A;  2FTD A;  2XU3 A;  5CHT A;  4DMY A;  4BSQ A;  4IP3 A;  2P7U A;  1PPP A;  3OQC A;  3KWB X;  3BC3 A;  2WBF X;  1DF0 A;  2DC7 A;  1BQI A;  4W4U A;  2JRI A;  1AYW A;  3IHP A;  3E1Z B;  4BPV A;  2G8J A;  3PW3 A;  3OVX A;  2JQF R;  3IUT A;  3V6C A;  3DF0 A;  2BDL A;  4YYQ A;  1ATK A;  3K9M A;  1PPN A;  3CH3 X;  1PXV A;  3H8C A;  1STF E;  3HWN A;  5EZQ A;  3H6S A;  4D8E A;  3MTN A;  2AYO A;  3OF8 A;  1X9Y A;  4QH6 A;  1AIM A;  1QXP A;  3PNR A;  3HD3 A;  2YJ9 A;  4I07 A;  3QT4 A;  2R9C A;  2BDZ A;  2B1M A;  3S3R A;  4CDE B;  4RNA A;  1EF7 A;  3N3G A;  4BOZ A;  5PAD A;  4I05 A;  1YZB A;  1CJL A;  3H8B A;  2HD5 A;  3MJ5 A;  3RVX A;  1PBH A;  5K16 A;  2ACT A;  4D8B A;  2DOS A;  1AYV A;  2G7Y A;  3O1G A;  1TL9 A;  4OEL A;  3MHH A;  2P86 A;  3GCB A;  2DZZ A;  2IPP B;  1CTE A;  2DJF B;  3LXS A;  3PSE A;  1MS6 A;  4QRX A;  5CVN B;  4X6J A;  2DC9 A;  1Y08 A;  4RY2 A;  1XKG A;  3IEJ A;  3F5V A;  4P16 A;  1AEC A;  2DC6 A;  1GLO A;  3I3T A;  3PRM A;  2E00 A;  1CQD A;  2R6N A;  4X6H A;  5A24 A;  1MEM A;  1MHW A;  4CDC B;  2BTW A;  2NQA A;  4AXL A;  1SNK A;  3LFY A;  5F02 A;  5J94 A;  3KSE A;  1AU4 A;  1EWO A;  2YJC A;  3KW9 A;  3WXF A;  3OVZ A;  3PBH A;  2FE8 A;  3D6S A;  2DCA A;  3PHX A;  4PAD A;  3F75 A;  1S4V A;  2BU3 A;  2GHU A;  5JZE A;  1U9W A;  4CZW A;  1EWM A;  2R9O A;  1BGO A;  3BPF A;  3ZUA A;  4N4Z A;  1EWP A;  9PAP A;  2Z84 A;  4N8W A;  3BWK A;  5E6J A;  4MZO A;  3WXG A;  4ZUX U;  3PDF A;  4YVA A;  3BOW A;  4W5C A;  1GMY A;  5EZS A;  1PE6 A;  3I06 A;  4X6I A;  1UKF A;  2FRA A;  2JTC A;  2C0Y A;  2HHN A;  2ATO A;  1K3B B;  4MM3 B;  2ARY A;  4QBB A;  8PCH A;  4N79 A;  1THE A;  3CBK A;  4PT5 A;  3BB7 A;  3MOR A;  1CVZ A;  1F2A A;  2AUX A;  2FO5 A;  2PRE A;  1DKI A;  1YVB A;  1F2C A;  3OF9 A;  2YJ8 A;  4FJC A;  2AUZ A;  5CVM A; 
#chains in the Genus database with same CATH homology
 2FT2 A;  1EWL A;  1Q6K A;  1F2B A;  2PAD A;  1ICF A;  1AU2 A;  1KXR A;  2JQG R;  3WXE A;  4OEM A;  1VSN A;  2NQD B;  1NB3 A;  2AIM A;  1ZIV A;  3QSD A;  1GX3 A;  4I04 A;  2H7J A;  4QRV A;  1TLO A;  5JH3 A;  4YYW A;  1VJV A;  2O6X A;  3P5X A;  1U9X A;  4P6E A;  2Y5B A;  1YK8 A;  1NB5 A;  4MSX A;  2R9N A;  3P5V A;  3HHI A;  4QRG A;  2CIO A;  1ZCM A;  2AS8 A;  7PCK A;  4AXM A;  4XUI A;  2F1G A;  2YJ2 A;  5FPW A;  1DEU A;  4BS5 A;  3V6E A;  1CV8 A;  4YV8 A;  1CSB B;  4BS6 A;  4YYU A;  2DC8 A;  3U8E A;  2R9M A;  3HHA A;  2VHF A;  3MHS A;  4K7C A;  2OZ2 A;  3ERV A;  4C5P A;  1AU0 A;  2G8E A;  2YJB A;  2NQI A;  3IMA A;  1JQP A;  5CVO B;  1AU3 A;  1ME3 A;  1KFX L;  2GFO A;  5JA7 A;  1E2T A;  2P0R A;  2XU5 A;  4CDD B;  1KHQ A;  1F29 A;  5EF4 A;  1YT7 A;  2FRQ A;  1M6D A;  3CBJ A;  4GUZ A;  4BQV A;  2PBH A;  1KHP A;  3C9E A;  2BSZ A;  3KWZ A;  4YYR A;  4PP1 A;  1AYU A;  1KFU L;  3IOQ A;  1POP A;  3QJ3 A;  1U9V A;  3TNX A;  4WA6 A;  2R9F A;  4Q8H A;  1U5I A;  3AI8 A;  4Q8G A;  1W6F A;  1CS8 A;  1CPJ A;  4XR7 A;  1MDW A;  3CH2 X;  6PAD A;  3H89 A;  2VHS A;  2OUL A;  1QOL A;  2E01 A;  1FH0 A;  3USV A;  1BY8 A;  1YAL A;  3S3Q A;  1SP4 B;  1O0E A;  4P6G A;  2DZY A;  3NHE A;  2F7D A;  1TU6 A;  2VFC A;  4YYS A;  1MEG A;  2Y6E A;  3N4C A;  4MZS A;  2FYE A;  3K24 A;  3N3K A;  2AVW A;  3KX1 A;  2HH5 A;  1U9Q X;  3KFQ A;  3RVV A;  2PNS A;  2XU4 A;  1NPZ A;  3OIS A;  1PCI A;  4PP2 E;  1ITO A;  2AU1 A;  2NQG A;  3K8U A;  3M99 A;  1PAD A;  4FIP A;  1HUC B;  2DJG B;  2E02 A;  4G54 A;  1MIR A;  3O0U A;  1A6R A;  2HXZ A;  1CB5 A;  4KLB A;  4YYV A;  1PIP A;  3B79 A;  1GCB A;  2FUD A;  1IWD A;  1W4T A;  5EGW A;  2DCB A;  2E03 A;  3BPM A;  3P5U A;  1GEC E;  1NQC A;  2CB5 A;  1PPO A;  1QMY A;  2B1N A;  1Y4H A;  3H7D A;  2DCD A;  2IBI A;  3KKU A;  3BCN A;  2G6D A;  1PPD A;  2OP3 A;  2FQ9 A;  2XU1 A;  4CDF B;  3P5W A;  4HWY A;  1QDQ A;  4W5B A;  1NLJ A;  1BP4 A;  5CHV A;  3RVW A;  1ME4 A;  1NL6 A;  4FK5 A;  4DMX A;  2DCC A;  2AYN A;  4B55 A;  4PI3 A;  2VFB A;  3IV2 A;  1YK7 A;  2FTD A;  2XU3 A;  5CHT A;  4DMY A;  4BSQ A;  2P7U A;  1PPP A;  3D9W A;  3KWB X;  3BC3 A;  2WBF X;  1DF0 A;  2DC7 A;  1BQI A;  4W4U A;  1AYW A;  3IHP A;  3E1Z B;  4BPV A;  2G8J A;  3PW3 A;  3OVX A;  2JQF R;  3IUT A;  3V6C A;  3DF0 A;  2BDL A;  4YYQ A;  1ATK A;  3K9M A;  1PPN A;  3CH3 X;  1PXV A;  3H8C A;  1STF E;  3HWN A;  3H6S A;  3MTN A;  2AYO A;  3OF8 A;  1X9Y A;  4QH6 A;  1AIM A;  1QXP A;  3PNR A;  3HD3 A;  2YJ9 A;  4I07 A;  1W5R A;  3QT4 A;  2R9C A;  2BDZ A;  2B1M A;  3S3R A;  4CDE B;  1EF7 A;  3N3G A;  5PAD A;  4I05 A;  4NV8 A;  1CJL A;  3H8B A;  2HD5 A;  3RVX A;  1PBH A;  5K16 A;  2ACT A;  1AYV A;  2G7Y A;  3O1G A;  1TL9 A;  4OEL A;  3MHH A;  2P86 A;  3GCB A;  2DZZ A;  2IPP B;  1CTE A;  2DJF B;  3LXS A;  1MS6 A;  4QRX A;  5CVN B;  4X6J A;  2DC9 A;  1Y08 A;  4RY2 A;  1XKG A;  3IEJ A;  3F5V A;  1AEC A;  2DC6 A;  1GLO A;  3I3T A;  2E00 A;  4BGF A;  1CQD A;  2R6N A;  4X6H A;  5A24 A;  1MEM A;  1MHW A;  4CDC B;  2NQA A;  4AXL A;  1SNK A;  3LFY A;  5F02 A;  5J94 A;  3KSE A;  1AU4 A;  1EWO A;  2YJC A;  3KW9 A;  3WXF A;  3OVZ A;  3PBH A;  3D6S A;  2DCA A;  3LTW A;  4PAD A;  3F75 A;  1S4V A;  2GHU A;  1U9W A;  4CZW A;  1EWM A;  2R9O A;  1BGO A;  3BPF A;  3ZUA A;  4N4Z A;  1EWP A;  9PAP A;  4N8W A;  3BWK A;  3WXG A;  4MZO A;  4ZUX U;  3PDF A;  4YVA A;  3BOW A;  4W5C A;  1GMY A;  1PE6 A;  3I06 A;  4X6I A;  2FRA A;  2C0Y A;  2HHN A;  2ATO A;  1K3B B;  2ARY A;  4QBB A;  8PCH A;  4N79 A;  1THE A;  3CBK A;  3MOR A;  4NV7 A;  1CVZ A;  1F2A A;  2AUX A;  2FO5 A;  2PRE A;  1YVB A;  1F2C A;  3OF9 A;  2YJ8 A;  4FJC A;  2AUZ A;  5CVM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...