3WXEA

Crystal structure of cyld usp domain (c596s) in complex with met1-linked diubiquitin
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
309
structure length
301
Chain Sequence
MGLEVMVGKKKGIQGHYNSSYLDSTLFCLFSFSSVLDTVLLRPRSKTDVEYYKETQELLRTEIVNPLRIHGYVCATKIMKLRRILEKVEAASGFTSEEKDPEEFLNILFHHILRVDPLLRLRSAGQKVQDCYFYQIFMDKKDKVMVPTSQQLLEWSFINSDLKFAEAPSCLIIQMPRFGKDFKMFNKIFPSLELDITDLLDDQQMELFAVLCIETSHYVAFVKYGSADSAWLFFDSMADRDGGQNGFNIPQVSRCPEVGEYLKMTPEELHALDPKNIQGYARRLLCDAYMCMYQSPTMSLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Uncharacterized protein
publication title Structures of CYLD USP with Met1- or Lys63-linked diubiquitin reveal mechanisms for dual specificity
doi rcsb
source organism Danio rerio
molecule tags Hydrolase/protein binding
total genus 84
structure length 301
sequence length 309
ec nomenclature
pdb deposition date 2014-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00443 UCH Ubiquitin carboxyl-terminal hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3wxeA00
1NQCA 2DC6A 3PBHA 2FO5A 2AYNA 2AIMA 3IUTA 2XU5A 2DZZA 1DEUA 1EF7A 1TL9A 1QOLA 3USVA 1U9XA 1PIPA 2HXZA 1QXPA 4BQVA 4BSQA 4QRXA 1AYUA 2R9NA 3E1ZB 3D6SA 2E01A 3S3QA 2JQGR 3HD3A 2R9FA 4I04A 2AUXA 2C0YA 2DC9A 3IV2A 4OELA 3QT4A 3C9EA 2ATOA 9PAPA 1AIMA 3S3RA 5EGWA 3OF9A 1MEGA 3K9MA 1VSNA 3HHAA 2HH5A 3IHPA 3LFYA 4YYSA 4PI3A 1EWMA 1PCIA 3RVVA 3F75A 4QBBA 2DCAA 1GMYA 3BCNA 3TNXA 1AU3A 3IEJA 4XR7A 3QJ3A 4CDCB 4YYVA 3KFQA 1ZCMA 3BPFA 3BC3A 3CBKA 1AU4A 3P5WA 3P5XA 4MZOA 1ITOA 3CBJA 1QMYA 2YJCA 1CJLA 4YVAA 1BGOA 3PNRA 2FRAA 3MHHA 1AU0A 2R9CA 3CH3X 3ZUAA 1BQIA 8PCHA 1MHWA 3CH2X 2XU4A 4YYWA 3H7DA 2Y5BA 3B79A 1JQPA 4AXLA 3U8EA 3O0UA 1PBHA 2FQ9A 1AU2A 4P6EA 3ERVA 2PADA 4YYRA 1KXRA 4ZUXU 3KX1A 6PADA 3KKUA 1TLOA 1QDQA 1PPPA 2F1GA 4AXMA 3AI8A 3NHEA 2PNSA 4MSXA 5CHTA 4I07A 3WXGA 1F2CA 4G54A 4DMXA 1TU6A 1Q6KA 1F29A 2OULA 1NL6A 1FH0A 2AU1A 4YYQA 1CB5A 4W5BA 2JQFR 3V6CA 2DCBA 2AUZA 3O1GA 3PW3A 4FK5A 4PP1A 3MTNA 3M99A 3N3KA 1POPA 2IPPB 2F7DA 2G7YA 1IWDA 2HD5A 1F2AA 1M6DA 2H7JA 4XUIA 2AYOA 2HHNA 3H89A 3OVZA 2DJFB 3WXFA 2B1MA 2CIOA 5F02A 2OP3A 1SNKA 1U5IA 1BY8A 2PREA 3PDFA 2P7UA 1AYVA 5PADA 3BWKA 2B1NA 2IBIA 4W5CA 5JH3A 1AYWA 1THEA 3KSEA 4FIPA 3HWNA 1CQDA 2R9OA 1MIRA 2Y6EA 4DMYA 1AECA 5CHVA 3H8BA 4YYUA 1PE6A 1PXVA 5A24A 1U9WA 1EWOA 2AS8A 1ME4A 1EWPA 3P5UA 2YJBA 2FRQA 1CPJA 1CV8A 4OEMA 2VHFA 3N4CA 3RVWA 3I06A 2E03A 2BDZA 4Q8HA 1U9VA 2NQGA 3MORA 4CZWA 1STFE 1YK7A 2ARYA 5CVMA 2OZ2A 3F5VA 3V6EA 1U9QX 3BPMA 4KLBA 1KHPA 5K16A 3P5VA 2DC7A 2DZYA 1KFXL 1SP4B 3LXSA 1MDWA 2FYEA 1X9YA 4BS6A 1PPDA 2FT2A 1NB3A 1NLJA 3BOWA 1YT7A 2YJ8A 2DC8A 3I3TA 4X6JA 1YALA 1BP4A 3KWZA 4BPVA 1MS6A 1PADA 2R9MA 5CVNB 1CSBB 2E00A 1A6RA 1GECE 4PADA 4X6HA 4I05A 4QRVA 2YJ9A 4CDFB 4PP2E 3DF0A 2BDLA 3QSDA 4HWYA 2CB5A 1ME3A 3H8CA 3N3GA 1ATKA 1GLOA 2DCDA 3K8UA 2E02A 5EF4A 2G8EA 2AVWA 2ACTA 4MZSA 1NPZA 2NQIA 4CDEB 4Q8GA 2NQDB 3IMAA 3OF8A 1ICFA 2DJGB 4QH6A 1KHQA 4N79A 3IOQA 1Y08A 2P0RA 2VHSA 3RVXA 5J94A 4WA6A 4CDDB 4P6GA 4YV8A 3HHIA 1O0EA 3KWBX 4BS5A 3GCBA 4RY2A 1CS8A 4FJCA 1ZIVA 1YK8A 2YJ2A 1EWLA 1HUCB 1CVZA 1VJVA 2FUDA 3MHSA 2GFOA 1F2BA 1GCBA 2R6NA 2WBFX 7PCKA 2FTDA 1S4VA 1PPNA 1K3BB 1DF0A 3OVXA 1NB5A 4K7CA 4X6IA 1XKGA 2G8JA 3KW9A 3K24A 2PBHA 3WXEA 2GHUA 5JA7A 2NQAA 4N4ZA 4N8WA 1Y4HA 2P86A 5CVOB 1PPOA 2XU3A 1CTEA 1KFUL 3OISA 1YVBA 1MEMA 4QRGA 2G6DA 3H6SA 4W4UA 2O6XA 2XU1A 5FPWA 2DCCA
chains in the Genus database with same CATH superfamily
1NQCA 2DC6A 3PBHA 2BTWB 2FO5A 2AYNA 2AIMA 3IUTA 2XU5A 2DZZA 1DEUA 1EF7A 1TL9A 1QOLA 3USVA 1U9XA 1PIPA 2HXZA 1QXPA 3W30A 4BQVA 4BSQA 4QRXA 1AYUA 2R9NA 3E1ZB 3D6SA 4HXDB 2E01A 3S3QA 4BOSA 2JQGR 3HD3A 2R9FA 4I04A 2AUXA 2C0YA 2DC9A 3IV2A 4OELA 3QT4A 3C9EA 2ATOA 3W31A 4BOZA 4D8IA 9PAPA 4IUMA 1AIMA 3S3RA 5EGWA 3OF9A 1MEGA 3K9MA 1VSNA 3HHAA 5KO3A 2HH5A 3IHPA 2Z84A 3LFYA 4YYSA 4PI3A 1EWMA 1PCIA 3RVVA 3F75A 4QBBA 2DCAA 1GMYA 3BCNA 5EZSA 3TNXA 1AU3A 4REZA 3IFUA 3IEJA 4XR7A 3QJ3A 4CDCB 4YYVA 3KFQA 1ZCMA 3BPFA 3BC3A 3CBKA 1AU4A 3P5WA 3P5XA 4MZOA 4PT5A 4OW0A 1ITOA 3CBJA 4ZTBA 3E9SA 1QMYA 2YJCA 1CJLA 4YVAA 3PRMA 1BGOA 3MJ5A 3PNRA 2FRAA 3MHHA 1AU0A 2R9CA 3CH3X 3ZUAA 1BQIA 8PCHA 1MHWA 3CH2X 2XU4A 4YYWA 3H7DA 2Y5BA 3B79A 1JQPA 4AXLA 3U8EA 3O0UA 1PBHA 2FQ9A 1AU2A 4P6EA 3ERVA 4MI7A 2PADA 4YYRA 1KXRA 4ZUXU 3KX1A 3PHWA 6PADA 3KKUA 1TLOA 1QDQA 1PPPA 4IP3A 2F1GA 4AXMA 1UKFA 3AI8A 3NHEA 2PNSA 4MSXA 5CHTA 4I07A 2JTCA 3WXGA 1F2CA 4G54A 3MTVA 4DMXA 1TU6A 1Q6KA 3TMPA 1F29A 2OULA 1NL6A 1FH0A 2AU1A 4YYQA 1CB5A 4W5BA 2JQFR 3V6CA 2DCBA 2AUZA 3O1GA 3PW3A 4FK5A 4PP1A 3MTNA 3M99A 3B21A 3N3KA 1POPA 2IPPB 2F7DA 1PVJA 2G7YA 5JZEA 3O65A 3PHXA 4BOUA 1IWDA 4D8BA 2HD5A 1F2AA 1M6DA 2H7JA 4XUIA 4BOPA 2AYOA 2HHNA 4R3DA 3ZNHA 3H89A 1YZBA 3OVZA 2DJFB 3WXFA 4RF1A 2B1MA 2DOSA 2CIOA 5F02A 2OP3A 1SNKA 1U5IA 1BY8A 2PREA 3PDFA 2P7UA 1AYVA 4WURA 5PADA 3BWKA 2B1NA 3RNVA 2IBIA 4W5CA 5JH3A 1AYWA 1THEA 3KSEA 3HWNA 4FIPA 1CQDA 2R9OA 1MIRA 2Y6EA 4DMYA 1AECA 5CHVA 3OQCA 3H8BA 4YYUA 1PE6A 4RNAA 1PXVA 2JRIA 5A24A 1U9WA 1EWOA 2AS8A 1ME4A 1EWPA 4XZXA 3BBAA 3P5UA 2YJBA 4OVZA 2FRQA 1CPJA 1CV8A 4OEMA 2VHFA 3N4CA 3RVWA 3I06A 2E03A 2BDZA 4Q8HA 1U9VA 2J7QA 2NQGA 3MORA 4CZWA 1STFE 1YK7A 2ARYA 5CVMA 2OZ2A 3BY4A 3F5VA 4BOQA 3V6EA 1U9QX 3BPMA 4KLBA 1KHPA 5K16A 4A5UA 3P5VA 2DC7A 2DZYA 1KFXL 1SP4B 3LXSA 1MDWA 2FYEA 1X9YA 4BS6A 1PPDA 2FT2A 1NB3A 1NLJA 3BOWA 1YT7A 2YJ8A 3PT2A 2DC8A 3I3TA 4X6JA 1YALA 1BP4A 3KWZA 3BB7A 4BPVA 5EZQA 1MS6A 1PADA 2R9MA 5CVNB 1CSBB 2E00A 1A6RA 1GECE 4PADA 4X6HA 4I05A 4MM3B 4QRVA 2YJ9A 4CDFB 4OVZB 3DF0A 4PP2E 3MP2A 2BDLA 3QSDA 4HWYA 2CB5A 1ME3A 3H8CA 3N3GA 1ATKA 1GLOA 2DCDA 1DKIA 3K8UA 2E02A 5EF4A 2G8EA 2AVWA 2ACTA 4MZSA 5E6JA 1NPZA 2J7QC 2NQIA 4CDEB 4Q8GA 2NQDB 4RF0A 3IMAA 3OF8A 1ICFA 2DJGB 3PRPA 4QH6A 2UZJA 1KHQA 4GUAA 4N79A 3IOQA 1Y08A 2P0RA 2VHSA 4P16A 2BTWA 3RVXA 5J94A 2FE8A 4WA6A 4CDDB 4P6GA 4YV8A 3HHIA 1O0EA 3KWBX 4BS5A 3GCBA 4RY2A 1CS8A 4FJCA 1ZIVA 1YK8A 3TRKA 3PHUA 2YJ2A 1EWLA 1HUCB 1CVZA 1VJVA 2FUDA 3MHSA 2GFOA 1F2BA 1GCBA 2R6NA 2WBFX 7PCKA 2FTDA 1S4VA 1PPNA 2BU3A 1K3BB 1DF0A 2AGAA 3OVXA 1NB5A 4K7CA 4X6IA 1XKGA 2G8JA 3KW9A 3K24A 2PBHA 3PSEA 3WXEA 4D8EA 2GHUA 5JA7A 3C0RA 4RKXA 2NQAA 4N4ZA 4N8WA 1Y4HA 2P86A 5CVOB 1PPOA 2XU3A 1CTEA 1KFUL 3OISA 1YVBA 1MEMA 4QRGA 4M0WA 2G6DA 3H6SA 4W4UA 2O6XA 2XU1A 5FPWA 2DCCA 2HWKA
chains in the Genus database with same CATH topology
1NQCA 2DC6A 3PBHA 2FO5A 2AYNA 2AIMA 3IUTA 2XU5A 2DZZA 1DEUA 1EF7A 1TL9A 1QOLA 3USVA 1U9XA 1PIPA 2HXZA 1QXPA 4BQVA 4BSQA 4QRXA 1AYUA 2R9NA 3E1ZB 3D6SA 2E01A 3S3QA 2JQGR 3HD3A 2R9FA 4I04A 2AUXA 2C0YA 4NV7A 2DC9A 3IV2A 4OELA 3QT4A 3C9EA 2ATOA 9PAPA 1AIMA 3S3RA 5EGWA 3OF9A 1MEGA 3K9MA 1VSNA 3HHAA 2HH5A 3IHPA 3LFYA 4YYSA 4PI3A 1EWMA 1PCIA 3RVVA 3F75A 4NV8A 4QBBA 2DCAA 1GMYA 3BCNA 3TNXA 1AU3A 3IEJA 4XR7A 3QJ3A 4CDCB 4YYVA 3KFQA 1ZCMA 3BPFA 3BC3A 3CBKA 1AU4A 3P5WA 3P5XA 4MZOA 1ITOA 3CBJA 1QMYA 2YJCA 1CJLA 4YVAA 1BGOA 3PNRA 2FRAA 3MHHA 1AU0A 1W6FA 2R9CA 3CH3X 3ZUAA 1BQIA 8PCHA 1MHWA 3CH2X 2XU4A 4YYWA 3H7DA 2Y5BA 3B79A 1JQPA 4AXLA 3U8EA 3O0UA 1PBHA 2FQ9A 1AU2A 4P6EA 3ERVA 2PADA 3LTWA 4YYRA 1KXRA 4ZUXU 3KX1A 6PADA 3KKUA 1TLOA 1QDQA 1PPPA 2F1GA 4AXMA 3AI8A 3NHEA 2PNSA 4MSXA 5CHTA 4I07A 3WXGA 1F2CA 4G54A 4DMXA 1TU6A 1Q6KA 1F29A 2OULA 1NL6A 1FH0A 2AU1A 4YYQA 1CB5A 4W5BA 2JQFR 3V6CA 2DCBA 2AUZA 3O1GA 2VFCA 3PW3A 4FK5A 4PP1A 3MTNA 3M99A 3N3KA 1POPA 2IPPB 2F7DA 2G7YA 4BGFA 1IWDA 2HD5A 1F2AA 1M6DA 2H7JA 4XUIA 2AYOA 2HHNA 3D9WA 3H89A 3OVZA 2DJFB 3WXFA 2B1MA 2CIOA 5F02A 2OP3A 1SNKA 1U5IA 1BY8A 2PREA 3PDFA 2P7UA 1AYVA 5PADA 3BWKA 2B1NA 2IBIA 4W5CA 4GUZA 5JH3A 1AYWA 1THEA 3KSEA 4FIPA 3HWNA 1CQDA 2R9OA 1MIRA 2Y6EA 4DMYA 1AECA 5CHVA 3H8BA 4YYUA 1PE6A 1PXVA 5A24A 1U9WA 1EWOA 2AS8A 1ME4A 1EWPA 3P5UA 2YJBA 2FRQA 1CPJA 1CV8A 4OEMA 2VHFA 3N4CA 3RVWA 3I06A 2E03A 2BDZA 4Q8HA 1U9VA 2NQGA 3MORA 4CZWA 1STFE 1YK7A 2ARYA 5CVMA 2OZ2A 3F5VA 3V6EA 1U9QX 3BPMA 4KLBA 1KHPA 5K16A 3P5VA 2DC7A 2DZYA 1KFXL 1SP4B 3LXSA 1MDWA 2FYEA 1X9YA 4BS6A 1PPDA 2FT2A 1NB3A 1NLJA 3BOWA 1YT7A 2YJ8A 2DC8A 3I3TA 4X6JA 1YALA 1BP4A 3KWZA 4BPVA 1MS6A 1PADA 2R9MA 1W5RA 5CVNB 1CSBB 2E00A 1A6RA 4C5PA 1GECE 4PADA 4X6HA 1W4TA 4I05A 4QRVA 2YJ9A 4CDFB 2BSZA 4PP2E 3DF0A 2BDLA 3QSDA 4HWYA 2CB5A 1ME3A 3H8CA 3N3GA 1ATKA 1GLOA 2DCDA 3K8UA 2E02A 5EF4A 2G8EA 2AVWA 2ACTA 4MZSA 1NPZA 2NQIA 4CDEB 4Q8GA 2NQDB 1E2TA 3IMAA 3OF8A 1ICFA 2DJGB 4QH6A 1KHQA 4N79A 3IOQA 1Y08A 2P0RA 2VHSA 3RVXA 5J94A 4WA6A 4CDDB 4P6GA 4YV8A 3HHIA 1O0EA 3KWBX 4BS5A 3GCBA 4RY2A 1CS8A 4FJCA 1ZIVA 1YK8A 2YJ2A 1EWLA 1HUCB 1CVZA 1VJVA 2FUDA 3MHSA 2GFOA 1F2BA 1GCBA 2R6NA 2WBFX 7PCKA 2FTDA 1S4VA 4B55A 1PPNA 1K3BB 1DF0A 3OVXA 2VFBA 1NB5A 4K7CA 4X6IA 1XKGA 2G8JA 3KW9A 3K24A 2PBHA 3WXEA 2GHUA 5JA7A 2NQAA 4N4ZA 4N8WA 1Y4HA 2P86A 5CVOB 1PPOA 2XU3A 1CTEA 1KFUL 3OISA 1YVBA 1MEMA 4QRGA 2G6DA 3H6SA 4W4UA 2O6XA 2XU1A 1GX3A 5FPWA 2DCCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NQC A;  2DC6 A;  3PBH A;  2FO5 A;  2AYN A;  2AIM A;  3IUT A;  2XU5 A;  2DZZ A;  1DEU A;  1EF7 A;  1TL9 A;  1QOL A;  3USV A;  1U9X A;  1PIP A;  2HXZ A;  1QXP A;  4BQV A;  4BSQ A;  4QRX A;  1AYU A;  2R9N A;  3E1Z B;  3D6S A;  2E01 A;  3S3Q A;  2JQG R;  3HD3 A;  2R9F A;  4I04 A;  2AUX A;  2C0Y A;  2DC9 A;  3IV2 A;  4OEL A;  3QT4 A;  3C9E A;  2ATO A;  9PAP A;  1AIM A;  3S3R A;  5EGW A;  3OF9 A;  1MEG A;  3K9M A;  1VSN A;  3HHA A;  2HH5 A;  3IHP A;  3LFY A;  4YYS A;  4PI3 A;  1EWM A;  1PCI A;  3RVV A;  3F75 A;  4QBB A;  2DCA A;  1GMY A;  3BCN A;  3TNX A;  1AU3 A;  3IEJ A;  4XR7 A;  3QJ3 A;  4CDC B;  4YYV A;  3KFQ A;  1ZCM A;  3BPF A;  3BC3 A;  3CBK A;  1AU4 A;  3P5W A;  3P5X A;  4MZO A;  1ITO A;  3CBJ A;  1QMY A;  2YJC A;  1CJL A;  4YVA A;  1BGO A;  3PNR A;  2FRA A;  3MHH A;  1AU0 A;  2R9C A;  3CH3 X;  3ZUA A;  1BQI A;  8PCH A;  1MHW A;  3CH2 X;  2XU4 A;  4YYW A;  3H7D A;  2Y5B A;  3B79 A;  1JQP A;  4AXL A;  3U8E A;  3O0U A;  1PBH A;  2FQ9 A;  1AU2 A;  4P6E A;  3ERV A;  2PAD A;  4YYR A;  1KXR A;  4ZUX U;  3KX1 A;  6PAD A;  3KKU A;  1TLO A;  1QDQ A;  1PPP A;  2F1G A;  4AXM A;  3AI8 A;  3NHE A;  2PNS A;  4MSX A;  5CHT A;  4I07 A;  3WXG A;  1F2C A;  4G54 A;  4DMX A;  1TU6 A;  1Q6K A;  1F29 A;  2OUL A;  1NL6 A;  1FH0 A;  2AU1 A;  4YYQ A;  1CB5 A;  4W5B A;  2JQF R;  3V6C A;  2DCB A;  2AUZ A;  3O1G A;  3PW3 A;  4FK5 A;  4PP1 A;  3MTN A;  3M99 A;  3N3K A;  1POP A;  2IPP B;  2F7D A;  2G7Y A;  1IWD A;  2HD5 A;  1F2A A;  1M6D A;  2H7J A;  4XUI A;  2AYO A;  2HHN A;  3H89 A;  3OVZ A;  2DJF B;  3WXF A;  2B1M A;  2CIO A;  5F02 A;  2OP3 A;  1SNK A;  1U5I A;  1BY8 A;  2PRE A;  3PDF A;  2P7U A;  1AYV A;  5PAD A;  3BWK A;  2B1N A;  2IBI A;  4W5C A;  5JH3 A;  1AYW A;  1THE A;  3KSE A;  4FIP A;  3HWN A;  1CQD A;  2R9O A;  1MIR A;  2Y6E A;  4DMY A;  1AEC A;  5CHV A;  3H8B A;  4YYU A;  1PE6 A;  1PXV A;  5A24 A;  1U9W A;  1EWO A;  2AS8 A;  1ME4 A;  1EWP A;  3P5U A;  2YJB A;  2FRQ A;  1CPJ A;  1CV8 A;  4OEM A;  2VHF A;  3N4C A;  3RVW A;  3I06 A;  2E03 A;  2BDZ A;  4Q8H A;  1U9V A;  2NQG A;  3MOR A;  4CZW A;  1STF E;  1YK7 A;  2ARY A;  5CVM A;  2OZ2 A;  3F5V A;  3V6E A;  1U9Q X;  3BPM A;  4KLB A;  1KHP A;  5K16 A;  3P5V A;  2DC7 A;  2DZY A;  1KFX L;  1SP4 B;  3LXS A;  1MDW A;  2FYE A;  1X9Y A;  4BS6 A;  1PPD A;  2FT2 A;  1NB3 A;  1NLJ A;  3BOW A;  1YT7 A;  2YJ8 A;  2DC8 A;  3I3T A;  4X6J A;  1YAL A;  1BP4 A;  3KWZ A;  4BPV A;  1MS6 A;  1PAD A;  2R9M A;  5CVN B;  1CSB B;  2E00 A;  1A6R A;  1GEC E;  4PAD A;  4X6H A;  4I05 A;  4QRV A;  2YJ9 A;  4CDF B;  4PP2 E;  3DF0 A;  2BDL A;  3QSD A;  4HWY A;  2CB5 A;  1ME3 A;  3H8C A;  3N3G A;  1ATK A;  1GLO A;  2DCD A;  3K8U A;  2E02 A;  5EF4 A;  2G8E A;  2AVW A;  2ACT A;  4MZS A;  1NPZ A;  2NQI A;  4CDE B;  4Q8G A;  2NQD B;  3IMA A;  3OF8 A;  1ICF A;  2DJG B;  4QH6 A;  1KHQ A;  4N79 A;  3IOQ A;  1Y08 A;  2P0R A;  2VHS A;  3RVX A;  5J94 A;  4WA6 A;  4CDD B;  4P6G A;  4YV8 A;  3HHI A;  1O0E A;  3KWB X;  4BS5 A;  3GCB A;  4RY2 A;  1CS8 A;  4FJC A;  1ZIV A;  1YK8 A;  2YJ2 A;  1EWL A;  1HUC B;  1CVZ A;  1VJV A;  2FUD A;  3MHS A;  2GFO A;  1F2B A;  1GCB A;  2R6N A;  2WBF X;  7PCK A;  2FTD A;  1S4V A;  1PPN A;  1K3B B;  1DF0 A;  3OVX A;  1NB5 A;  4K7C A;  4X6I A;  1XKG A;  2G8J A;  3KW9 A;  3K24 A;  2PBH A;  3WXE A;  2GHU A;  5JA7 A;  2NQA A;  4N4Z A;  4N8W A;  1Y4H A;  2P86 A;  5CVO B;  1PPO A;  2XU3 A;  1CTE A;  1KFU L;  3OIS A;  1YVB A;  1MEM A;  4QRG A;  2G6D A;  3H6S A;  4W4U A;  2O6X A;  2XU1 A;  5FPW A;  2DCC A; 
#chains in the Genus database with same CATH topology
 1NQC A;  2DC6 A;  3PBH A;  2BTW B;  2FO5 A;  2AYN A;  2AIM A;  3IUT A;  2XU5 A;  2DZZ A;  1DEU A;  1EF7 A;  1TL9 A;  1QOL A;  3USV A;  1U9X A;  1PIP A;  2HXZ A;  1QXP A;  3W30 A;  4BQV A;  4BSQ A;  4QRX A;  1AYU A;  2R9N A;  3E1Z B;  3D6S A;  4HXD B;  2E01 A;  3S3Q A;  4BOS A;  2JQG R;  3HD3 A;  2R9F A;  4I04 A;  2AUX A;  2C0Y A;  2DC9 A;  3IV2 A;  4OEL A;  3QT4 A;  3C9E A;  2ATO A;  3W31 A;  4BOZ A;  4D8I A;  9PAP A;  4IUM A;  1AIM A;  3S3R A;  5EGW A;  3OF9 A;  1MEG A;  3K9M A;  1VSN A;  3HHA A;  5KO3 A;  2HH5 A;  3IHP A;  2Z84 A;  3LFY A;  4YYS A;  4PI3 A;  1EWM A;  1PCI A;  3RVV A;  3F75 A;  4QBB A;  2DCA A;  1GMY A;  3BCN A;  5EZS A;  3TNX A;  1AU3 A;  4REZ A;  3IFU A;  3IEJ A;  4XR7 A;  3QJ3 A;  4CDC B;  4YYV A;  3KFQ A;  1ZCM A;  3BPF A;  3BC3 A;  3CBK A;  1AU4 A;  3P5W A;  3P5X A;  4MZO A;  4PT5 A;  4OW0 A;  1ITO A;  3CBJ A;  4ZTB A;  3E9S A;  1QMY A;  2YJC A;  1CJL A;  4YVA A;  3PRM A;  1BGO A;  3MJ5 A;  3PNR A;  2FRA A;  3MHH A;  1AU0 A;  2R9C A;  3CH3 X;  3ZUA A;  1BQI A;  8PCH A;  1MHW A;  3CH2 X;  2XU4 A;  4YYW A;  3H7D A;  2Y5B A;  3B79 A;  1JQP A;  4AXL A;  3U8E A;  3O0U A;  1PBH A;  2FQ9 A;  1AU2 A;  4P6E A;  3ERV A;  4MI7 A;  2PAD A;  4YYR A;  1KXR A;  4ZUX U;  3KX1 A;  3PHW A;  6PAD A;  3KKU A;  1TLO A;  1QDQ A;  1PPP A;  4IP3 A;  2F1G A;  4AXM A;  1UKF A;  3AI8 A;  3NHE A;  2PNS A;  4MSX A;  5CHT A;  4I07 A;  2JTC A;  3WXG A;  1F2C A;  4G54 A;  3MTV A;  4DMX A;  1TU6 A;  1Q6K A;  3TMP A;  1F29 A;  2OUL A;  1NL6 A;  1FH0 A;  2AU1 A;  4YYQ A;  1CB5 A;  4W5B A;  2JQF R;  3V6C A;  2DCB A;  2AUZ A;  3O1G A;  3PW3 A;  4FK5 A;  4PP1 A;  3MTN A;  3M99 A;  3B21 A;  3N3K A;  1POP A;  2IPP B;  2F7D A;  1PVJ A;  2G7Y A;  5JZE A;  3O65 A;  3PHX A;  4BOU A;  1IWD A;  4D8B A;  2HD5 A;  1F2A A;  1M6D A;  2H7J A;  4XUI A;  4BOP A;  2AYO A;  2HHN A;  4R3D A;  3ZNH A;  3H89 A;  1YZB A;  3OVZ A;  2DJF B;  3WXF A;  4RF1 A;  2B1M A;  2DOS A;  2CIO A;  5F02 A;  2OP3 A;  1SNK A;  1U5I A;  1BY8 A;  2PRE A;  3PDF A;  2P7U A;  1AYV A;  4WUR A;  5PAD A;  3BWK A;  2B1N A;  3RNV A;  2IBI A;  4W5C A;  5JH3 A;  1AYW A;  1THE A;  3KSE A;  3HWN A;  4FIP A;  1CQD A;  2R9O A;  1MIR A;  2Y6E A;  4DMY A;  1AEC A;  5CHV A;  3OQC A;  3H8B A;  4YYU A;  1PE6 A;  4RNA A;  1PXV A;  2JRI A;  5A24 A;  1U9W A;  1EWO A;  2AS8 A;  1ME4 A;  1EWP A;  4XZX A;  3BBA A;  3P5U A;  2YJB A;  4OVZ A;  2FRQ A;  1CPJ A;  1CV8 A;  4OEM A;  2VHF A;  3N4C A;  3RVW A;  3I06 A;  2E03 A;  2BDZ A;  4Q8H A;  1U9V A;  2J7Q A;  2NQG A;  3MOR A;  4CZW A;  1STF E;  1YK7 A;  2ARY A;  5CVM A;  2OZ2 A;  3BY4 A;  3F5V A;  4BOQ A;  3V6E A;  1U9Q X;  3BPM A;  4KLB A;  1KHP A;  5K16 A;  4A5U A;  3P5V A;  2DC7 A;  2DZY A;  1KFX L;  1SP4 B;  3LXS A;  1MDW A;  2FYE A;  1X9Y A;  4BS6 A;  1PPD A;  2FT2 A;  1NB3 A;  1NLJ A;  3BOW A;  1YT7 A;  2YJ8 A;  3PT2 A;  2DC8 A;  3I3T A;  4X6J A;  1YAL A;  1BP4 A;  3KWZ A;  3BB7 A;  4BPV A;  5EZQ A;  1MS6 A;  1PAD A;  2R9M A;  5CVN B;  1CSB B;  2E00 A;  1A6R A;  1GEC E;  4PAD A;  4X6H A;  4I05 A;  4MM3 B;  4QRV A;  2YJ9 A;  4CDF B;  4OVZ B;  3DF0 A;  4PP2 E;  3MP2 A;  2BDL A;  3QSD A;  4HWY A;  2CB5 A;  1ME3 A;  3H8C A;  3N3G A;  1ATK A;  1GLO A;  2DCD A;  1DKI A;  3K8U A;  2E02 A;  5EF4 A;  2G8E A;  2AVW A;  2ACT A;  4MZS A;  5E6J A;  1NPZ A;  2J7Q C;  2NQI A;  4CDE B;  4Q8G A;  2NQD B;  4RF0 A;  3IMA A;  3OF8 A;  1ICF A;  2DJG B;  3PRP A;  4QH6 A;  2UZJ A;  1KHQ A;  4GUA A;  4N79 A;  3IOQ A;  1Y08 A;  2P0R A;  2VHS A;  4P16 A;  2BTW A;  3RVX A;  5J94 A;  2FE8 A;  4WA6 A;  4CDD B;  4P6G A;  4YV8 A;  3HHI A;  1O0E A;  3KWB X;  4BS5 A;  3GCB A;  4RY2 A;  1CS8 A;  4FJC A;  1ZIV A;  1YK8 A;  3TRK A;  3PHU A;  2YJ2 A;  1EWL A;  1HUC B;  1CVZ A;  1VJV A;  2FUD A;  3MHS A;  2GFO A;  1F2B A;  1GCB A;  2R6N A;  2WBF X;  7PCK A;  2FTD A;  1S4V A;  1PPN A;  2BU3 A;  1K3B B;  1DF0 A;  2AGA A;  3OVX A;  1NB5 A;  4K7C A;  4X6I A;  1XKG A;  2G8J A;  3KW9 A;  3K24 A;  2PBH A;  3PSE A;  3WXE A;  4D8E A;  2GHU A;  5JA7 A;  3C0R A;  4RKX A;  2NQA A;  4N4Z A;  4N8W A;  1Y4H A;  2P86 A;  5CVO B;  1PPO A;  2XU3 A;  1CTE A;  1KFU L;  3OIS A;  1YVB A;  1MEM A;  4QRG A;  4M0W A;  2G6D A;  3H6S A;  4W4U A;  2O6X A;  2XU1 A;  5FPW A;  2DCC A;  2HWK A; 
#chains in the Genus database with same CATH homology
 1NQC A;  2DC6 A;  3PBH A;  2FO5 A;  2AYN A;  2AIM A;  3IUT A;  2XU5 A;  2DZZ A;  1DEU A;  1EF7 A;  1TL9 A;  1QOL A;  3USV A;  1U9X A;  1PIP A;  2HXZ A;  1QXP A;  4BQV A;  4BSQ A;  4QRX A;  1AYU A;  2R9N A;  3E1Z B;  3D6S A;  2E01 A;  3S3Q A;  2JQG R;  3HD3 A;  2R9F A;  4I04 A;  2AUX A;  2C0Y A;  4NV7 A;  2DC9 A;  3IV2 A;  4OEL A;  3QT4 A;  3C9E A;  2ATO A;  9PAP A;  1AIM A;  3S3R A;  5EGW A;  3OF9 A;  1MEG A;  3K9M A;  1VSN A;  3HHA A;  2HH5 A;  3IHP A;  3LFY A;  4YYS A;  4PI3 A;  1EWM A;  1PCI A;  3RVV A;  3F75 A;  4NV8 A;  4QBB A;  2DCA A;  1GMY A;  3BCN A;  3TNX A;  1AU3 A;  3IEJ A;  4XR7 A;  3QJ3 A;  4CDC B;  4YYV A;  3KFQ A;  1ZCM A;  3BPF A;  3BC3 A;  3CBK A;  1AU4 A;  3P5W A;  3P5X A;  4MZO A;  1ITO A;  3CBJ A;  1QMY A;  2YJC A;  1CJL A;  4YVA A;  1BGO A;  3PNR A;  2FRA A;  3MHH A;  1AU0 A;  1W6F A;  2R9C A;  3CH3 X;  3ZUA A;  1BQI A;  8PCH A;  1MHW A;  3CH2 X;  2XU4 A;  4YYW A;  3H7D A;  2Y5B A;  3B79 A;  1JQP A;  4AXL A;  3U8E A;  3O0U A;  1PBH A;  2FQ9 A;  1AU2 A;  4P6E A;  3ERV A;  2PAD A;  3LTW A;  4YYR A;  1KXR A;  4ZUX U;  3KX1 A;  6PAD A;  3KKU A;  1TLO A;  1QDQ A;  1PPP A;  2F1G A;  4AXM A;  3AI8 A;  3NHE A;  2PNS A;  4MSX A;  5CHT A;  4I07 A;  3WXG A;  1F2C A;  4G54 A;  4DMX A;  1TU6 A;  1Q6K A;  1F29 A;  2OUL A;  1NL6 A;  1FH0 A;  2AU1 A;  4YYQ A;  1CB5 A;  4W5B A;  2JQF R;  3V6C A;  2DCB A;  2AUZ A;  3O1G A;  2VFC A;  3PW3 A;  4FK5 A;  4PP1 A;  3MTN A;  3M99 A;  3N3K A;  1POP A;  2IPP B;  2F7D A;  2G7Y A;  4BGF A;  1IWD A;  2HD5 A;  1F2A A;  1M6D A;  2H7J A;  4XUI A;  2AYO A;  2HHN A;  3D9W A;  3H89 A;  3OVZ A;  2DJF B;  3WXF A;  2B1M A;  2CIO A;  5F02 A;  2OP3 A;  1SNK A;  1U5I A;  1BY8 A;  2PRE A;  3PDF A;  2P7U A;  1AYV A;  5PAD A;  3BWK A;  2B1N A;  2IBI A;  4W5C A;  4GUZ A;  5JH3 A;  1AYW A;  1THE A;  3KSE A;  4FIP A;  3HWN A;  1CQD A;  2R9O A;  1MIR A;  2Y6E A;  4DMY A;  1AEC A;  5CHV A;  3H8B A;  4YYU A;  1PE6 A;  1PXV A;  5A24 A;  1U9W A;  1EWO A;  2AS8 A;  1ME4 A;  1EWP A;  3P5U A;  2YJB A;  2FRQ A;  1CPJ A;  1CV8 A;  4OEM A;  2VHF A;  3N4C A;  3RVW A;  3I06 A;  2E03 A;  2BDZ A;  4Q8H A;  1U9V A;  2NQG A;  3MOR A;  4CZW A;  1STF E;  1YK7 A;  2ARY A;  5CVM A;  2OZ2 A;  3F5V A;  3V6E A;  1U9Q X;  3BPM A;  4KLB A;  1KHP A;  5K16 A;  3P5V A;  2DC7 A;  2DZY A;  1KFX L;  1SP4 B;  3LXS A;  1MDW A;  2FYE A;  1X9Y A;  4BS6 A;  1PPD A;  2FT2 A;  1NB3 A;  1NLJ A;  3BOW A;  1YT7 A;  2YJ8 A;  2DC8 A;  3I3T A;  4X6J A;  1YAL A;  1BP4 A;  3KWZ A;  4BPV A;  1MS6 A;  1PAD A;  2R9M A;  1W5R A;  5CVN B;  1CSB B;  2E00 A;  1A6R A;  4C5P A;  1GEC E;  4PAD A;  4X6H A;  1W4T A;  4I05 A;  4QRV A;  2YJ9 A;  4CDF B;  2BSZ A;  4PP2 E;  3DF0 A;  2BDL A;  3QSD A;  4HWY A;  2CB5 A;  1ME3 A;  3H8C A;  3N3G A;  1ATK A;  1GLO A;  2DCD A;  3K8U A;  2E02 A;  5EF4 A;  2G8E A;  2AVW A;  2ACT A;  4MZS A;  1NPZ A;  2NQI A;  4CDE B;  4Q8G A;  2NQD B;  1E2T A;  3IMA A;  3OF8 A;  1ICF A;  2DJG B;  4QH6 A;  1KHQ A;  4N79 A;  3IOQ A;  1Y08 A;  2P0R A;  2VHS A;  3RVX A;  5J94 A;  4WA6 A;  4CDD B;  4P6G A;  4YV8 A;  3HHI A;  1O0E A;  3KWB X;  4BS5 A;  3GCB A;  4RY2 A;  1CS8 A;  4FJC A;  1ZIV A;  1YK8 A;  2YJ2 A;  1EWL A;  1HUC B;  1CVZ A;  1VJV A;  2FUD A;  3MHS A;  2GFO A;  1F2B A;  1GCB A;  2R6N A;  2WBF X;  7PCK A;  2FTD A;  1S4V A;  4B55 A;  1PPN A;  1K3B B;  1DF0 A;  3OVX A;  2VFB A;  1NB5 A;  4K7C A;  4X6I A;  1XKG A;  2G8J A;  3KW9 A;  3K24 A;  2PBH A;  3WXE A;  2GHU A;  5JA7 A;  2NQA A;  4N4Z A;  4N8W A;  1Y4H A;  2P86 A;  5CVO B;  1PPO A;  2XU3 A;  1CTE A;  1KFU L;  3OIS A;  1YVB A;  1MEM A;  4QRG A;  2G6D A;  3H6S A;  4W4U A;  2O6X A;  2XU1 A;  1GX3 A;  5FPW A;  2DCC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...