3WXEA

Crystal structure of cyld usp domain (c596s) in complex with met1-linked diubiquitin
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
309
structure length
301
Chain Sequence
MGLEVMVGKKKGIQGHYNSSYLDSTLFCLFSFSSVLDTVLLRPRSKTDVEYYKETQELLRTEIVNPLRIHGYVCATKIMKLRRILEKVEAASGFTSEEKDPEEFLNILFHHILRVDPLLRLRSAGQKVQDCYFYQIFMDKKDKVMVPTSQQLLEWSFINSDLKFAEAPSCLIIQMPRFGKDFKMFNKIFPSLELDITDLLDDQQMELFAVLCIETSHYVAFVKYGSADSAWLFFDSMADRDGGQNGFNIPQVSRCPEVGEYLKMTPEELHALDPKNIQGYARRLLCDAYMCMYQSPTMSLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase/protein binding
molecule keywords Uncharacterized protein
publication title Structures of CYLD USP with Met1- or Lys63-linked diubiquitin reveal mechanisms for dual specificity
doi rcsb
source organism Danio rerio
total genus 84
structure length 301
sequence length 309
ec nomenclature
pdb deposition date 2014-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00443 UCH Ubiquitin carboxyl-terminal hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3wxeA00
1MIRA 2R9CA 2Y5BA 4P6EA 1F2BA 2G8EA 3KWZA 2R9OA 1DF0A 1MEGA 4QRVA 1U9XA 3H89A 1TL9A 1U5IA 2DZYA 2OULA 1CS8A 3BC3A 1ITOA 4Q8HA 2P0RA 4K7CA 2JQGR 4N79A 2R9NA 2AU1A 4RY2A 2YJ8A 1PPNA 3MHHA 3MORA 3H6SA 3O0UA 2YJ9A 3OISA 2AIMA 4DMYA 4I05A 2R9MA 5F02A 3IEJA 1SP4B 1NLJA 3NHEA 3MHSA 3WXEA 4PP2E 1F2AA 2FRQA 2B1NA 2O6XA 2XU3A 1AYWA 4AXMA 4MSXA 3BOWA 1VJVA 1U9VA 3I3TA 3RVXA 2DCAA 2FRAA 3C9EA 3LXSA 4KLBA 1AYUA 2JQFR 4N8WA 4MZSA 3I06A 2G6DA 3K8UA 3PBHA 1U9WA 2E00A 2AVWA 2F1GA 3DF0A 3K24A 3K9MA 1U9QX 1AU4A 1ATKA 2AUXA 1PPPA 4CDCB 1TLOA 2DC7A 5K16A 3IHPA 3KFQA 1BP4A 1PIPA 1ICFA 2FYEA 1AECA 1AU0A 1PXVA 2HHNA 3IOQA 3PW3A 2DC6A 1EF7A 2DC8A 1AIMA 3USVA 1Y4HA 2IBIA 3HD3A 2AYOA 2ACTA 1IWDA 4YV8A 4Q8GA 2BDLA 1A6RA 1TU6A 4X6IA 7PCKA 1CTEA 1EWMA 2E01A 1S4VA 3WXFA 4XR7A 3V6EA 4CZWA 2NQIA 5EGWA 1EWLA 1NPZA 2OZ2A 2XU1A 3M99A 1JQPA 1BQIA 1ZCMA 2YJCA 3CH3X 4WA6A 2NQDB 4W4UA 3HHAA 1QMYA 1Q6KA 1PCIA 4AXLA 4W5BA 5JH3A 2GHUA 1MDWA 4CDEB 4BSQA 1SNKA 1CB5A 2R9FA 4YYVA 3N3KA 1YK7A 4X6JA 4FK5A 3ERVA 4DMXA 1CJLA 2HXZA 2YJ2A 1VSNA 2F7DA 1FH0A 1YVBA 2PNSA 1M6DA 2P7UA 3P5VA 4I04A 1QDQA 3F75A 5PADA 2VHSA 4YVAA 3HWNA 1GMYA 2FTDA 1PPDA 3E1ZB 1K3BB 3P5UA 1GECE 2B1MA 4PI3A 4BS6A 3P5WA 2NQGA 1X9YA 4W5CA 3CBJA 2WBFX 3F5VA 1CV8A 1NB3A 3B79A 4OELA 2DJFB 3IUTA 4QBBA 1KFUL 2G8JA 2HH5A 2PADA 2E03A 4FIPA 1ME4A 3QSDA 4P6GA 4FJCA 2DZZA 4YYSA 1PE6A 1AU2A 3O1GA 2DC9A 3PDFA 2DCCA 3P5XA 1EWPA 5J94A 5JA7A 3PNRA 5A24A 2ATOA 3OVXA 4BQVA 1GCBA 1AU3A 4QRGA 2YJBA 3OVZA 2OP3A 3H7DA 3TNXA 4BPVA 4HWYA 4CDDB 1BGOA 2DCBA 1MS6A 3BWKA 3QJ3A 1YT7A 1NL6A 2NQAA 1NB5A 2E02A 2BDZA 2CB5A 2VHFA 2ARYA 4PP1A 3BPFA 3N3GA 1YK8A 3AI8A 1CPJA 1NQCA 2DJGB 4MZOA 1O0EA 3GCBA 5FPWA 2G7YA 1MHWA 2H7JA 2FO5A 1MEMA 2AYNA 4BS5A 2R6NA 1ZIVA 4YYWA 1KXRA 4N4ZA 1PPOA 2PBHA 4OEMA 1STFE 8PCHA 5CHVA 5CVNB 1KHQA 4X6HA 3OF8A 1YALA 3N4CA 3S3RA 3V6CA 4I07A 3MTNA 3KKUA 4YYRA 3BPMA 3BCNA 3RVVA 1F29A 1QXPA 3HHIA 3U8EA 2XU5A 1THEA 3CBKA 5CHTA 5EF4A 1AYVA 1EWOA 3S3QA 1CSBB 3KWBX 3IV2A 2AS8A 3KSEA 2FQ9A 3ZUAA 3WXGA 2CIOA 4YYUA 1F2CA 1PBHA 2PREA 4CDFB 3QT4A 1KHPA 3LFYA 4PADA 2XU4A 2Y6EA 1Y08A 2FUDA 3KW9A 2AUZA 1XKGA 1BY8A 4ZUXU 4G54A 2P86A 2FT2A 2C0YA 4YYQA 4QRXA 4QH6A 9PAPA 1DEUA 3H8CA 4XUIA 3RVWA 2GFOA 1GLOA 3H8BA 1CVZA 5CVOB 2IPPB 2DCDA 1ME3A 2HD5A 5CVMA 3CH2X 3IMAA 1KFXL 3OF9A 1POPA 3D6SA 1PADA 3KX1A 1QOLA 1CQDA 1HUCB 6PADA
chains in the Genus database with same CATH superfamily
1MIRA 2R9CA 2Y5BA 4P6EA 1F2BA 2G8EA 3KWZA 2R9OA 1DF0A 1MEGA 4QRVA 1U9XA 3H89A 1TL9A 1U5IA 2DZYA 2OULA 1CS8A 3BC3A 3PRMA 1ITOA 4Q8HA 2P0RA 4K7CA 2JQGR 4N79A 2R9NA 2AU1A 4RY2A 2YJ8A 4REZA 1PPNA 3MHHA 3MORA 3H6SA 4ZTBA 3O0UA 2YJ9A 3OISA 2AIMA 4DMYA 4RNAA 4I05A 2R9MA 5F02A 3IEJA 1SP4B 1NLJA 4MI7A 3NHEA 3MHSA 3WXEA 4PP2E 2BU3A 1F2AA 2FRQA 2B1NA 2O6XA 2XU3A 1AYWA 4AXMA 4MSXA 3BOWA 3IFUA 1VJVA 1U9VA 3I3TA 3RVXA 2DCAA 3OQCA 2FRAA 3C9EA 3LXSA 4KLBA 1AYUA 2JQFR 4N8WA 4MZSA 3I06A 2G6DA 3K8UA 3PBHA 1U9WA 2E00A 2AVWA 2BTWA 2F1GA 3PHXA 3DF0A 3K24A 3K9MA 1U9QX 1AU4A 2J7QC 1ATKA 3BB7A 2AUXA 1PPPA 4CDCB 3BBAA 4P16A 1TLOA 2DC7A 5K16A 3IHPA 4BOPA 3KFQA 1BP4A 1PIPA 1ICFA 2FYEA 1AECA 1AU0A 1PXVA 2HHNA 3IOQA 3PW3A 4OVZB 2DC6A 3TMPA 1EF7A 2DC8A 1AIMA 3USVA 4XZXA 1Y4HA 2IBIA 3E9SA 3HD3A 2AYOA 2ACTA 1IWDA 4YV8A 4Q8GA 2BDLA 3W31A 1A6RA 1TU6A 4X6IA 4BOUA 7PCKA 1CTEA 1EWMA 3MTVA 2E01A 1S4VA 3WXFA 4XR7A 4BOZA 3V6EA 4CZWA 2NQIA 5EGWA 3B21A 1EWLA 1NPZA 4A5UA 2OZ2A 2XU1A 3M99A 1JQPA 2HWKA 1BQIA 1ZCMA 4IP3A 2YJCA 3CH3X 4WA6A 2NQDB 4W4UA 3HHAA 1QMYA 1Q6KA 1PCIA 4AXLA 4W5BA 5JH3A 2GHUA 1MDWA 4CDEB 4BSQA 1SNKA 1CB5A 2R9FA 4YYVA 3N3KA 1YK7A 4X6JA 5KO3A 4FK5A 3ERVA 4DMXA 5JZEA 4GUAA 1CJLA 4OW0A 2HXZA 2YJ2A 1VSNA 2F7DA 2JTCA 1FH0A 1YVBA 2PNSA 1M6DA 2P7UA 3P5VA 4I04A 1QDQA 3F75A 5PADA 4MM3B 2AGAA 2VHSA 4WURA 4YVAA 3HWNA 1GMYA 2FTDA 4BOQA 1PPDA 3E1ZB 1K3BB 3P5UA 1GECE 2B1MA 1DKIA 4PI3A 4BS6A 3RNVA 3P5WA 4RF1A 2NQGA 1X9YA 4W5CA 4D8IA 3CBJA 2WBFX 3F5VA 1CV8A 1NB3A 3B79A 3BY4A 4OELA 2DJFB 3IUTA 4BOSA 4QBBA 1KFUL 2G8JA 3ZNHA 2HH5A 2PADA 2E03A 4FIPA 1ME4A 3QSDA 4P6GA 4FJCA 2BTWB 2DZZA 4RF0A 4IUMA 4YYSA 1PE6A 1AU2A 3O1GA 2DC9A 3PDFA 2DCCA 3P5XA 4D8BA 1EWPA 5J94A 5JA7A 3PNRA 5A24A 2ATOA 3OVXA 4BQVA 1GCBA 1AU3A 4QRGA 2YJBA 3OVZA 2OP3A 3H7DA 3TNXA 4BPVA 4M0WA 5E6JA 4HWYA 4CDDB 1BGOA 1UKFA 1MS6A 2DCBA 3BWKA 3QJ3A 1YT7A 1NL6A 2NQAA 3PHUA 1NB5A 2E02A 2BDZA 2CB5A 2VHFA 2ARYA 3MJ5A 4PP1A 3BPFA 3N3GA 3MP2A 1YK8A 3AI8A 1CPJA 1NQCA 2DJGB 4HXDB 4MZOA 1O0EA 3GCBA 5FPWA 2G7YA 1MHWA 2H7JA 2FO5A 1MEMA 2AYNA 3PHWA 4BS5A 2R6NA 1ZIVA 4YYWA 1KXRA 3PSEA 4N4ZA 1PPOA 2PBHA 4OEMA 1STFE 8PCHA 1YZBA 5CHVA 5CVNB 1KHQA 4X6HA 2DOSA 3OF8A 3PT2A 1YALA 3N4CA 3S3RA 3V6CA 4I07A 3MTNA 5EZQA 3KKUA 1PVJA 4YYRA 2J7QA 3BPMA 3BCNA 3RVVA 1F29A 1QXPA 3HHIA 3U8EA 3O65A 2XU5A 1THEA 3CBKA 5CHTA 5EF4A 1AYVA 1EWOA 3S3QA 3W30A 1CSBB 3KWBX 3IV2A 2UZJA 3C0RA 2AS8A 3KSEA 2FQ9A 3ZUAA 3WXGA 2CIOA 4YYUA 1F2CA 1PBHA 5EZSA 2FE8A 2PREA 3PRPA 2Z84A 4CDFB 3QT4A 4PT5A 1KHPA 4D8EA 2JRIA 3LFYA 4PADA 2XU4A 2Y6EA 4OVZA 1Y08A 2FUDA 3KW9A 2AUZA 4RKXA 1XKGA 1BY8A 4ZUXU 4G54A 2P86A 2FT2A 2C0YA 4YYQA 4QRXA 3TRKA 4QH6A 9PAPA 1DEUA 3H8CA 4XUIA 3RVWA 2GFOA 1GLOA 3H8BA 1CVZA 5CVOB 2IPPB 2DCDA 1ME3A 2HD5A 5CVMA 3CH2X 3IMAA 1KFXL 3OF9A 1POPA 3D6SA 1PADA 3KX1A 1QOLA 4R3DA 1CQDA 1HUCB 6PADA
chains in the Genus database with same CATH topology
1MIRA 2R9CA 2Y5BA 4P6EA 1F2BA 2G8EA 3KWZA 2R9OA 1DF0A 1MEGA 4NV7A 4QRVA 1U9XA 3H89A 1TL9A 1U5IA 2DZYA 2OULA 1CS8A 3BC3A 1ITOA 2BSZA 4Q8HA 2P0RA 4K7CA 2JQGR 4N79A 2R9NA 2AU1A 4RY2A 2YJ8A 1PPNA 3MHHA 3MORA 3H6SA 3O0UA 2YJ9A 1E2TA 3OISA 2AIMA 4C5PA 4DMYA 4I05A 2R9MA 5F02A 3IEJA 1SP4B 1NLJA 3NHEA 3MHSA 3WXEA 4PP2E 1F2AA 2FRQA 2B1NA 2O6XA 2XU3A 1AYWA 4AXMA 4B55A 4MSXA 3BOWA 4NV8A 1VJVA 1U9VA 3I3TA 3RVXA 2DCAA 2FRAA 3C9EA 3LXSA 4KLBA 1AYUA 2JQFR 4N8WA 4MZSA 3I06A 2G6DA 2VFCA 3K8UA 3PBHA 1U9WA 2E00A 2AVWA 2F1GA 3DF0A 3K24A 3K9MA 1U9QX 1AU4A 1ATKA 2AUXA 1PPPA 4CDCB 1TLOA 2DC7A 5K16A 3IHPA 3KFQA 1BP4A 1PIPA 1ICFA 2FYEA 1AECA 1AU0A 1PXVA 2HHNA 3IOQA 3PW3A 2DC6A 1EF7A 2DC8A 1AIMA 3USVA 1Y4HA 2IBIA 3HD3A 2AYOA 2ACTA 1IWDA 4YV8A 4Q8GA 2BDLA 1A6RA 3LTWA 1TU6A 4X6IA 7PCKA 1CTEA 1EWMA 2E01A 1S4VA 3WXFA 4XR7A 3V6EA 4CZWA 3D9WA 2NQIA 5EGWA 1EWLA 1NPZA 2OZ2A 2XU1A 3M99A 1JQPA 1BQIA 1ZCMA 2YJCA 3CH3X 4WA6A 2NQDB 4W4UA 4BGFA 3HHAA 1QMYA 1Q6KA 1PCIA 4AXLA 4W5BA 5JH3A 2GHUA 1MDWA 4CDEB 4BSQA 1SNKA 1CB5A 2R9FA 4YYVA 3N3KA 1YK7A 4X6JA 4FK5A 3ERVA 4DMXA 1CJLA 2HXZA 2YJ2A 1VSNA 2F7DA 1FH0A 1YVBA 2PNSA 1M6DA 2P7UA 3P5VA 4I04A 1QDQA 3F75A 5PADA 2VHSA 4YVAA 3HWNA 1GMYA 2FTDA 1PPDA 3E1ZB 1K3BB 3P5UA 1GECE 2B1MA 4PI3A 4BS6A 3P5WA 2NQGA 1X9YA 4W5CA 3CBJA 2WBFX 3F5VA 1CV8A 1NB3A 3B79A 4OELA 2DJFB 3IUTA 4QBBA 1KFUL 2G8JA 2HH5A 2PADA 2E03A 1W6FA 4FIPA 1ME4A 3QSDA 4P6GA 4FJCA 2DZZA 4YYSA 1PE6A 1AU2A 3O1GA 2DC9A 3PDFA 2DCCA 3P5XA 1EWPA 5J94A 5JA7A 3PNRA 5A24A 2ATOA 3OVXA 4BQVA 1GCBA 1AU3A 4QRGA 2YJBA 3OVZA 2OP3A 3H7DA 3TNXA 4BPVA 4HWYA 4CDDB 1BGOA 2DCBA 1MS6A 3BWKA 3QJ3A 1YT7A 1NL6A 2NQAA 1NB5A 2E02A 2BDZA 2CB5A 2VHFA 2ARYA 4PP1A 3BPFA 3N3GA 1YK8A 3AI8A 1CPJA 1NQCA 2DJGB 4MZOA 1O0EA 3GCBA 5FPWA 2G7YA 1MHWA 2H7JA 2FO5A 1MEMA 2AYNA 4BS5A 2R6NA 1ZIVA 4YYWA 1KXRA 4N4ZA 1PPOA 2PBHA 4OEMA 1STFE 8PCHA 5CHVA 5CVNB 1KHQA 4X6HA 3OF8A 1YALA 3N4CA 3S3RA 3V6CA 4I07A 3MTNA 3KKUA 4YYRA 3BPMA 3BCNA 3RVVA 4GUZA 1F29A 1QXPA 2VFBA 3HHIA 3U8EA 2XU5A 1THEA 3CBKA 5CHTA 5EF4A 1AYVA 1EWOA 3S3QA 1CSBB 3KWBX 3IV2A 1W4TA 2AS8A 3KSEA 2FQ9A 3ZUAA 3WXGA 2CIOA 4YYUA 1F2CA 1PBHA 1W5RA 2PREA 4CDFB 3QT4A 1KHPA 3LFYA 4PADA 2XU4A 2Y6EA 1Y08A 2FUDA 3KW9A 2AUZA 1XKGA 1BY8A 4ZUXU 4G54A 2P86A 2FT2A 2C0YA 4YYQA 4QRXA 4QH6A 9PAPA 1DEUA 3H8CA 4XUIA 3RVWA 2GFOA 1GLOA 1GX3A 3H8BA 1CVZA 5CVOB 2IPPB 2DCDA 1ME3A 2HD5A 5CVMA 3CH2X 3IMAA 1KFXL 3OF9A 1POPA 3D6SA 1PADA 3KX1A 1QOLA 1CQDA 1HUCB 6PADA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MIR A;  2R9C A;  2Y5B A;  4P6E A;  1F2B A;  2G8E A;  3KWZ A;  2R9O A;  1DF0 A;  1MEG A;  4QRV A;  1U9X A;  3H89 A;  1TL9 A;  1U5I A;  2DZY A;  2OUL A;  1CS8 A;  3BC3 A;  1ITO A;  4Q8H A;  2P0R A;  4K7C A;  2JQG R;  4N79 A;  2R9N A;  2AU1 A;  4RY2 A;  2YJ8 A;  1PPN A;  3MHH A;  3MOR A;  3H6S A;  3O0U A;  2YJ9 A;  3OIS A;  2AIM A;  4DMY A;  4I05 A;  2R9M A;  5F02 A;  3IEJ A;  1SP4 B;  1NLJ A;  3NHE A;  3MHS A;  3WXE A;  4PP2 E;  1F2A A;  2FRQ A;  2B1N A;  2O6X A;  2XU3 A;  1AYW A;  4AXM A;  4MSX A;  3BOW A;  1VJV A;  1U9V A;  3I3T A;  3RVX A;  2DCA A;  2FRA A;  3C9E A;  3LXS A;  4KLB A;  1AYU A;  2JQF R;  4N8W A;  4MZS A;  3I06 A;  2G6D A;  3K8U A;  3PBH A;  1U9W A;  2E00 A;  2AVW A;  2F1G A;  3DF0 A;  3K24 A;  3K9M A;  1U9Q X;  1AU4 A;  1ATK A;  2AUX A;  1PPP A;  4CDC B;  1TLO A;  2DC7 A;  5K16 A;  3IHP A;  3KFQ A;  1BP4 A;  1PIP A;  1ICF A;  2FYE A;  1AEC A;  1AU0 A;  1PXV A;  2HHN A;  3IOQ A;  3PW3 A;  2DC6 A;  1EF7 A;  2DC8 A;  1AIM A;  3USV A;  1Y4H A;  2IBI A;  3HD3 A;  2AYO A;  2ACT A;  1IWD A;  4YV8 A;  4Q8G A;  2BDL A;  1A6R A;  1TU6 A;  4X6I A;  7PCK A;  1CTE A;  1EWM A;  2E01 A;  1S4V A;  3WXF A;  4XR7 A;  3V6E A;  4CZW A;  2NQI A;  5EGW A;  1EWL A;  1NPZ A;  2OZ2 A;  2XU1 A;  3M99 A;  1JQP A;  1BQI A;  1ZCM A;  2YJC A;  3CH3 X;  4WA6 A;  2NQD B;  4W4U A;  3HHA A;  1QMY A;  1Q6K A;  1PCI A;  4AXL A;  4W5B A;  5JH3 A;  2GHU A;  1MDW A;  4CDE B;  4BSQ A;  1SNK A;  1CB5 A;  2R9F A;  4YYV A;  3N3K A;  1YK7 A;  4X6J A;  4FK5 A;  3ERV A;  4DMX A;  1CJL A;  2HXZ A;  2YJ2 A;  1VSN A;  2F7D A;  1FH0 A;  1YVB A;  2PNS A;  1M6D A;  2P7U A;  3P5V A;  4I04 A;  1QDQ A;  3F75 A;  5PAD A;  2VHS A;  4YVA A;  3HWN A;  1GMY A;  2FTD A;  1PPD A;  3E1Z B;  1K3B B;  3P5U A;  1GEC E;  2B1M A;  4PI3 A;  4BS6 A;  3P5W A;  2NQG A;  1X9Y A;  4W5C A;  3CBJ A;  2WBF X;  3F5V A;  1CV8 A;  1NB3 A;  3B79 A;  4OEL A;  2DJF B;  3IUT A;  4QBB A;  1KFU L;  2G8J A;  2HH5 A;  2PAD A;  2E03 A;  4FIP A;  1ME4 A;  3QSD A;  4P6G A;  4FJC A;  2DZZ A;  4YYS A;  1PE6 A;  1AU2 A;  3O1G A;  2DC9 A;  3PDF A;  2DCC A;  3P5X A;  1EWP A;  5J94 A;  5JA7 A;  3PNR A;  5A24 A;  2ATO A;  3OVX A;  4BQV A;  1GCB A;  1AU3 A;  4QRG A;  2YJB A;  3OVZ A;  2OP3 A;  3H7D A;  3TNX A;  4BPV A;  4HWY A;  4CDD B;  1BGO A;  2DCB A;  1MS6 A;  3BWK A;  3QJ3 A;  1YT7 A;  1NL6 A;  2NQA A;  1NB5 A;  2E02 A;  2BDZ A;  2CB5 A;  2VHF A;  2ARY A;  4PP1 A;  3BPF A;  3N3G A;  1YK8 A;  3AI8 A;  1CPJ A;  1NQC A;  2DJG B;  4MZO A;  1O0E A;  3GCB A;  5FPW A;  2G7Y A;  1MHW A;  2H7J A;  2FO5 A;  1MEM A;  2AYN A;  4BS5 A;  2R6N A;  1ZIV A;  4YYW A;  1KXR A;  4N4Z A;  1PPO A;  2PBH A;  4OEM A;  1STF E;  8PCH A;  5CHV A;  5CVN B;  1KHQ A;  4X6H A;  3OF8 A;  1YAL A;  3N4C A;  3S3R A;  3V6C A;  4I07 A;  3MTN A;  3KKU A;  4YYR A;  3BPM A;  3BCN A;  3RVV A;  1F29 A;  1QXP A;  3HHI A;  3U8E A;  2XU5 A;  1THE A;  3CBK A;  5CHT A;  5EF4 A;  1AYV A;  1EWO A;  3S3Q A;  1CSB B;  3KWB X;  3IV2 A;  2AS8 A;  3KSE A;  2FQ9 A;  3ZUA A;  3WXG A;  2CIO A;  4YYU A;  1F2C A;  1PBH A;  2PRE A;  4CDF B;  3QT4 A;  1KHP A;  3LFY A;  4PAD A;  2XU4 A;  2Y6E A;  1Y08 A;  2FUD A;  3KW9 A;  2AUZ A;  1XKG A;  1BY8 A;  4ZUX U;  4G54 A;  2P86 A;  2FT2 A;  2C0Y A;  4YYQ A;  4QRX A;  4QH6 A;  9PAP A;  1DEU A;  3H8C A;  4XUI A;  3RVW A;  2GFO A;  1GLO A;  3H8B A;  1CVZ A;  5CVO B;  2IPP B;  2DCD A;  1ME3 A;  2HD5 A;  5CVM A;  3CH2 X;  3IMA A;  1KFX L;  3OF9 A;  1POP A;  3D6S A;  1PAD A;  3KX1 A;  1QOL A;  1CQD A;  1HUC B;  6PAD A; 
#chains in the Genus database with same CATH topology
 1MIR A;  2R9C A;  2Y5B A;  4P6E A;  1F2B A;  2G8E A;  3KWZ A;  2R9O A;  1DF0 A;  1MEG A;  4QRV A;  1U9X A;  3H89 A;  1TL9 A;  1U5I A;  2DZY A;  2OUL A;  1CS8 A;  3BC3 A;  3PRM A;  1ITO A;  4Q8H A;  2P0R A;  4K7C A;  2JQG R;  4N79 A;  2R9N A;  2AU1 A;  4RY2 A;  2YJ8 A;  4REZ A;  1PPN A;  3MHH A;  3MOR A;  3H6S A;  4ZTB A;  3O0U A;  2YJ9 A;  3OIS A;  2AIM A;  4DMY A;  4RNA A;  4I05 A;  2R9M A;  5F02 A;  3IEJ A;  1SP4 B;  1NLJ A;  4MI7 A;  3NHE A;  3MHS A;  3WXE A;  4PP2 E;  2BU3 A;  1F2A A;  2FRQ A;  2B1N A;  2O6X A;  2XU3 A;  1AYW A;  4AXM A;  4MSX A;  3BOW A;  3IFU A;  1VJV A;  1U9V A;  3I3T A;  3RVX A;  2DCA A;  3OQC A;  2FRA A;  3C9E A;  3LXS A;  4KLB A;  1AYU A;  2JQF R;  4N8W A;  4MZS A;  3I06 A;  2G6D A;  3K8U A;  3PBH A;  1U9W A;  2E00 A;  2AVW A;  2BTW A;  2F1G A;  3PHX A;  3DF0 A;  3K24 A;  3K9M A;  1U9Q X;  1AU4 A;  2J7Q C;  1ATK A;  3BB7 A;  2AUX A;  1PPP A;  4CDC B;  3BBA A;  4P16 A;  1TLO A;  2DC7 A;  5K16 A;  3IHP A;  4BOP A;  3KFQ A;  1BP4 A;  1PIP A;  1ICF A;  2FYE A;  1AEC A;  1AU0 A;  1PXV A;  2HHN A;  3IOQ A;  3PW3 A;  4OVZ B;  2DC6 A;  3TMP A;  1EF7 A;  2DC8 A;  1AIM A;  3USV A;  4XZX A;  1Y4H A;  2IBI A;  3E9S A;  3HD3 A;  2AYO A;  2ACT A;  1IWD A;  4YV8 A;  4Q8G A;  2BDL A;  3W31 A;  1A6R A;  1TU6 A;  4X6I A;  4BOU A;  7PCK A;  1CTE A;  1EWM A;  3MTV A;  2E01 A;  1S4V A;  3WXF A;  4XR7 A;  4BOZ A;  3V6E A;  4CZW A;  2NQI A;  5EGW A;  3B21 A;  1EWL A;  1NPZ A;  4A5U A;  2OZ2 A;  2XU1 A;  3M99 A;  1JQP A;  2HWK A;  1BQI A;  1ZCM A;  4IP3 A;  2YJC A;  3CH3 X;  4WA6 A;  2NQD B;  4W4U A;  3HHA A;  1QMY A;  1Q6K A;  1PCI A;  4AXL A;  4W5B A;  5JH3 A;  2GHU A;  1MDW A;  4CDE B;  4BSQ A;  1SNK A;  1CB5 A;  2R9F A;  4YYV A;  3N3K A;  1YK7 A;  4X6J A;  5KO3 A;  4FK5 A;  3ERV A;  4DMX A;  5JZE A;  4GUA A;  1CJL A;  4OW0 A;  2HXZ A;  2YJ2 A;  1VSN A;  2F7D A;  2JTC A;  1FH0 A;  1YVB A;  2PNS A;  1M6D A;  2P7U A;  3P5V A;  4I04 A;  1QDQ A;  3F75 A;  5PAD A;  4MM3 B;  2AGA A;  2VHS A;  4WUR A;  4YVA A;  3HWN A;  1GMY A;  2FTD A;  4BOQ A;  1PPD A;  3E1Z B;  1K3B B;  3P5U A;  1GEC E;  2B1M A;  1DKI A;  4PI3 A;  4BS6 A;  3RNV A;  3P5W A;  4RF1 A;  2NQG A;  1X9Y A;  4W5C A;  4D8I A;  3CBJ A;  2WBF X;  3F5V A;  1CV8 A;  1NB3 A;  3B79 A;  3BY4 A;  4OEL A;  2DJF B;  3IUT A;  4BOS A;  4QBB A;  1KFU L;  2G8J A;  3ZNH A;  2HH5 A;  2PAD A;  2E03 A;  4FIP A;  1ME4 A;  3QSD A;  4P6G A;  4FJC A;  2BTW B;  2DZZ A;  4RF0 A;  4IUM A;  4YYS A;  1PE6 A;  1AU2 A;  3O1G A;  2DC9 A;  3PDF A;  2DCC A;  3P5X A;  4D8B A;  1EWP A;  5J94 A;  5JA7 A;  3PNR A;  5A24 A;  2ATO A;  3OVX A;  4BQV A;  1GCB A;  1AU3 A;  4QRG A;  2YJB A;  3OVZ A;  2OP3 A;  3H7D A;  3TNX A;  4BPV A;  4M0W A;  5E6J A;  4HWY A;  4CDD B;  1BGO A;  1UKF A;  1MS6 A;  2DCB A;  3BWK A;  3QJ3 A;  1YT7 A;  1NL6 A;  2NQA A;  3PHU A;  1NB5 A;  2E02 A;  2BDZ A;  2CB5 A;  2VHF A;  2ARY A;  3MJ5 A;  4PP1 A;  3BPF A;  3N3G A;  3MP2 A;  1YK8 A;  3AI8 A;  1CPJ A;  1NQC A;  2DJG B;  4HXD B;  4MZO A;  1O0E A;  3GCB A;  5FPW A;  2G7Y A;  1MHW A;  2H7J A;  2FO5 A;  1MEM A;  2AYN A;  3PHW A;  4BS5 A;  2R6N A;  1ZIV A;  4YYW A;  1KXR A;  3PSE A;  4N4Z A;  1PPO A;  2PBH A;  4OEM A;  1STF E;  8PCH A;  1YZB A;  5CHV A;  5CVN B;  1KHQ A;  4X6H A;  2DOS A;  3OF8 A;  3PT2 A;  1YAL A;  3N4C A;  3S3R A;  3V6C A;  4I07 A;  3MTN A;  5EZQ A;  3KKU A;  1PVJ A;  4YYR A;  2J7Q A;  3BPM A;  3BCN A;  3RVV A;  1F29 A;  1QXP A;  3HHI A;  3U8E A;  3O65 A;  2XU5 A;  1THE A;  3CBK A;  5CHT A;  5EF4 A;  1AYV A;  1EWO A;  3S3Q A;  3W30 A;  1CSB B;  3KWB X;  3IV2 A;  2UZJ A;  3C0R A;  2AS8 A;  3KSE A;  2FQ9 A;  3ZUA A;  3WXG A;  2CIO A;  4YYU A;  1F2C A;  1PBH A;  5EZS A;  2FE8 A;  2PRE A;  3PRP A;  2Z84 A;  4CDF B;  3QT4 A;  4PT5 A;  1KHP A;  4D8E A;  2JRI A;  3LFY A;  4PAD A;  2XU4 A;  2Y6E A;  4OVZ A;  1Y08 A;  2FUD A;  3KW9 A;  2AUZ A;  4RKX A;  1XKG A;  1BY8 A;  4ZUX U;  4G54 A;  2P86 A;  2FT2 A;  2C0Y A;  4YYQ A;  4QRX A;  3TRK A;  4QH6 A;  9PAP A;  1DEU A;  3H8C A;  4XUI A;  3RVW A;  2GFO A;  1GLO A;  3H8B A;  1CVZ A;  5CVO B;  2IPP B;  2DCD A;  1ME3 A;  2HD5 A;  5CVM A;  3CH2 X;  3IMA A;  1KFX L;  3OF9 A;  1POP A;  3D6S A;  1PAD A;  3KX1 A;  1QOL A;  4R3D A;  1CQD A;  1HUC B;  6PAD A; 
#chains in the Genus database with same CATH homology
 1MIR A;  2R9C A;  2Y5B A;  4P6E A;  1F2B A;  2G8E A;  3KWZ A;  2R9O A;  1DF0 A;  1MEG A;  4NV7 A;  4QRV A;  1U9X A;  3H89 A;  1TL9 A;  1U5I A;  2DZY A;  2OUL A;  1CS8 A;  3BC3 A;  1ITO A;  2BSZ A;  4Q8H A;  2P0R A;  4K7C A;  2JQG R;  4N79 A;  2R9N A;  2AU1 A;  4RY2 A;  2YJ8 A;  1PPN A;  3MHH A;  3MOR A;  3H6S A;  3O0U A;  2YJ9 A;  1E2T A;  3OIS A;  2AIM A;  4C5P A;  4DMY A;  4I05 A;  2R9M A;  5F02 A;  3IEJ A;  1SP4 B;  1NLJ A;  3NHE A;  3MHS A;  3WXE A;  4PP2 E;  1F2A A;  2FRQ A;  2B1N A;  2O6X A;  2XU3 A;  1AYW A;  4AXM A;  4B55 A;  4MSX A;  3BOW A;  4NV8 A;  1VJV A;  1U9V A;  3I3T A;  3RVX A;  2DCA A;  2FRA A;  3C9E A;  3LXS A;  4KLB A;  1AYU A;  2JQF R;  4N8W A;  4MZS A;  3I06 A;  2G6D A;  2VFC A;  3K8U A;  3PBH A;  1U9W A;  2E00 A;  2AVW A;  2F1G A;  3DF0 A;  3K24 A;  3K9M A;  1U9Q X;  1AU4 A;  1ATK A;  2AUX A;  1PPP A;  4CDC B;  1TLO A;  2DC7 A;  5K16 A;  3IHP A;  3KFQ A;  1BP4 A;  1PIP A;  1ICF A;  2FYE A;  1AEC A;  1AU0 A;  1PXV A;  2HHN A;  3IOQ A;  3PW3 A;  2DC6 A;  1EF7 A;  2DC8 A;  1AIM A;  3USV A;  1Y4H A;  2IBI A;  3HD3 A;  2AYO A;  2ACT A;  1IWD A;  4YV8 A;  4Q8G A;  2BDL A;  1A6R A;  3LTW A;  1TU6 A;  4X6I A;  7PCK A;  1CTE A;  1EWM A;  2E01 A;  1S4V A;  3WXF A;  4XR7 A;  3V6E A;  4CZW A;  3D9W A;  2NQI A;  5EGW A;  1EWL A;  1NPZ A;  2OZ2 A;  2XU1 A;  3M99 A;  1JQP A;  1BQI A;  1ZCM A;  2YJC A;  3CH3 X;  4WA6 A;  2NQD B;  4W4U A;  4BGF A;  3HHA A;  1QMY A;  1Q6K A;  1PCI A;  4AXL A;  4W5B A;  5JH3 A;  2GHU A;  1MDW A;  4CDE B;  4BSQ A;  1SNK A;  1CB5 A;  2R9F A;  4YYV A;  3N3K A;  1YK7 A;  4X6J A;  4FK5 A;  3ERV A;  4DMX A;  1CJL A;  2HXZ A;  2YJ2 A;  1VSN A;  2F7D A;  1FH0 A;  1YVB A;  2PNS A;  1M6D A;  2P7U A;  3P5V A;  4I04 A;  1QDQ A;  3F75 A;  5PAD A;  2VHS A;  4YVA A;  3HWN A;  1GMY A;  2FTD A;  1PPD A;  3E1Z B;  1K3B B;  3P5U A;  1GEC E;  2B1M A;  4PI3 A;  4BS6 A;  3P5W A;  2NQG A;  1X9Y A;  4W5C A;  3CBJ A;  2WBF X;  3F5V A;  1CV8 A;  1NB3 A;  3B79 A;  4OEL A;  2DJF B;  3IUT A;  4QBB A;  1KFU L;  2G8J A;  2HH5 A;  2PAD A;  2E03 A;  1W6F A;  4FIP A;  1ME4 A;  3QSD A;  4P6G A;  4FJC A;  2DZZ A;  4YYS A;  1PE6 A;  1AU2 A;  3O1G A;  2DC9 A;  3PDF A;  2DCC A;  3P5X A;  1EWP A;  5J94 A;  5JA7 A;  3PNR A;  5A24 A;  2ATO A;  3OVX A;  4BQV A;  1GCB A;  1AU3 A;  4QRG A;  2YJB A;  3OVZ A;  2OP3 A;  3H7D A;  3TNX A;  4BPV A;  4HWY A;  4CDD B;  1BGO A;  2DCB A;  1MS6 A;  3BWK A;  3QJ3 A;  1YT7 A;  1NL6 A;  2NQA A;  1NB5 A;  2E02 A;  2BDZ A;  2CB5 A;  2VHF A;  2ARY A;  4PP1 A;  3BPF A;  3N3G A;  1YK8 A;  3AI8 A;  1CPJ A;  1NQC A;  2DJG B;  4MZO A;  1O0E A;  3GCB A;  5FPW A;  2G7Y A;  1MHW A;  2H7J A;  2FO5 A;  1MEM A;  2AYN A;  4BS5 A;  2R6N A;  1ZIV A;  4YYW A;  1KXR A;  4N4Z A;  1PPO A;  2PBH A;  4OEM A;  1STF E;  8PCH A;  5CHV A;  5CVN B;  1KHQ A;  4X6H A;  3OF8 A;  1YAL A;  3N4C A;  3S3R A;  3V6C A;  4I07 A;  3MTN A;  3KKU A;  4YYR A;  3BPM A;  3BCN A;  3RVV A;  4GUZ A;  1F29 A;  1QXP A;  2VFB A;  3HHI A;  3U8E A;  2XU5 A;  1THE A;  3CBK A;  5CHT A;  5EF4 A;  1AYV A;  1EWO A;  3S3Q A;  1CSB B;  3KWB X;  3IV2 A;  1W4T A;  2AS8 A;  3KSE A;  2FQ9 A;  3ZUA A;  3WXG A;  2CIO A;  4YYU A;  1F2C A;  1PBH A;  1W5R A;  2PRE A;  4CDF B;  3QT4 A;  1KHP A;  3LFY A;  4PAD A;  2XU4 A;  2Y6E A;  1Y08 A;  2FUD A;  3KW9 A;  2AUZ A;  1XKG A;  1BY8 A;  4ZUX U;  4G54 A;  2P86 A;  2FT2 A;  2C0Y A;  4YYQ A;  4QRX A;  4QH6 A;  9PAP A;  1DEU A;  3H8C A;  4XUI A;  3RVW A;  2GFO A;  1GLO A;  1GX3 A;  3H8B A;  1CVZ A;  5CVO B;  2IPP B;  2DCD A;  1ME3 A;  2HD5 A;  5CVM A;  3CH2 X;  3IMA A;  1KFX L;  3OF9 A;  1POP A;  3D6S A;  1PAD A;  3KX1 A;  1QOL A;  1CQD A;  1HUC B;  6PAD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...