1NPZA

Crystal structures of cathepsin s inhibitor complexes
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
217
structure length
217
Chain Sequence
LPDSVDWREKGCVTEVKYQGSCGACWAFSAVGALEAQLKLKTGKLVTLSAQNLVDCSTEKYGNKGCNGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYDSKYRAATCSKYTELPYGREDVLKEAVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSWGHNFGEEGYIRMARNKGNHCGIASFPSYPEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Cathepsin S
publication title Specificity determinants of human cathepsin s revealed by crystal structures of complexes.
pubmed doi rcsb
total genus 68
structure length 217
sequence length 217
chains with identical sequence B
ec nomenclature ec 3.4.22.27: Cathepsin S.
pdb deposition date 2003-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1npzA00
1ICFA 2NQIA 3F5VA 4XR7A 2JQGR 1U9XA 2AVWA 1S4VA 5F02A 1X9YA 2HHNA 9PAPA 5EGWA 2HH5A 1CQDA 2FO5A 2XU1A 4RY2A 1CPJA 3O1GA 3I3TA 2FRQA 1MDWA 2FUDA 2P86A 3HHAA 2CIOA 4G54A 3IEJA 2PBHA 3WXGA 1KHPA 1TLOA 2G7YA 4KLBA 2R6NA 4K7CA 1AU2A 3I06A 4QBBA 4N79A 2XU5A 1F29A 3PDFA 3H8BA 3P5XA 5JA7A 1AIMA 2HXZA 2JQFR 4BS6A 1KFUL 2NQDB 4QRGA 3KX1A 2Y5BA 1Y4HA 1CS8A 4PI3A 3BPMA 1U9WA 1ATKA 1ZIVA 3BPFA 1O0EA 2FRAA 3M99A 4BQVA 3PBHA 3IV2A 2H7JA 3KWZA 3N3GA 4QRXA 3BOWA 3OISA 1F2BA 4CDFB 2NQAA 4X6HA 1PXVA 3MTNA 1A6RA 2FT2A 2ATOA 1BGOA 3KW9A 4MZOA 2VHSA 2DZZA 2C0YA 4WA6A 4W5BA 1DF0A 1EWPA 1M6DA 2OULA 1MEMA 3HWNA 1U9QX 4BSQA 1XKGA 1QDQA 2ARYA 1PPNA 3RVXA 2DC6A 3D6SA 5JH3A 4MSXA 3DF0A 1STFE 3CBKA 4XUIA 1CTEA 2G6DA 2AYNA 4YVAA 4I04A 2YJCA 1AYVA 1QOLA 1VJVA 1MEGA 2IBIA 2AS8A 2AYOA 3CH3X 1JQPA 2DCBA 2YJ2A 4BS5A 3MHHA 4N8WA 3OVXA 1KHQA 3S3QA 3N4CA 1HUCB 3O0UA 2XU3A 4QRVA 3IOQA 1NL6A 1AU4A 1GLOA 3OVZA 4QH6A 4YYQA 4AXMA 4X6IA 4FK5A 2OZ2A 1GMYA 1SP4B 2ACTA 4PP2E 1QXPA 3B79A 3WXFA 3HHIA 3H7DA 3USVA 1BQIA 4DMXA 2AUXA 1CV8A 3C9EA 1CB5A 1ITOA 1KXRA 3QT4A 2IPPB 2XU4A 2E01A 3K24A 1NB5A 2R9MA 1NQCA 1ZCMA 5CVMA 2GFOA 1YVBA 5A24A 1NB3A 2G8JA 4AXLA 4FIPA 2O6XA 3N3KA 4CZWA 4CDEB 2YJ9A 1AU3A 1PPPA 2PADA 3ZUAA 1CVZA 1KFXL 3U8EA 2AUZA 1BP4A 5K16A 1SNKA 1K3BB 5CVOB 1F2AA 4PADA 4P6EA 1NPZA 1MS6A 2FTDA 1AU0A 3KFQA 4CDDB 5PADA 3P5WA 1PPDA 1U9VA 3KKUA 1BY8A 2F1GA 5CHVA 5FPWA 3PW3A 2E02A 2E03A 7PCKA 4Q8GA 3CBJA 2DC8A 3V6CA 3TNXA 1EWOA 4P6GA 1PCIA 2FYEA 1Q6KA 1PBHA 2BDLA 2DCDA 4OEMA 3KSEA 3OF9A 1YT7A 4X6JA 1ME3A 1VSNA 2Y6EA 1DEUA 3OF8A 1YALA 1GECE 1PADA 1F2CA 1EF7A 2P7UA 1AYUA 4N4ZA 4YV8A 2NQGA 1MHWA 2FQ9A 4HWYA 2AIMA 2B1NA 2DZYA 3NHEA 5CVNB 1CJLA 3V6EA 4YYRA 4DMYA 1TU6A 1YK7A 3HD3A 2DJFB 4MZSA 2AU1A 3IUTA 4YYWA 2DCCA 2PREA 1EWLA 3WXEA 3ERVA 2YJ8A 2HD5A 4Q8HA 6PADA 1IWDA 1QMYA 3IMAA 1EWMA 3K8UA 1POPA 2DC7A 2VHFA 5J94A 3E1ZB 2R9CA 2G8EA 2F7DA 1AECA 5EF4A 3PNRA 3F75A 2WBFX 3MHSA 5CHTA 3KWBX 4W4UA 1MIRA 3S3RA 2R9NA 8PCHA 2E00A 4CDCB 1GCBA 1NLJA 3K9MA 1CSBB 3RVVA 2P0RA 4W5CA 3QJ3A 1THEA 2DJGB 1PPOA 3CH2X 2OP3A 1YK8A 3P5VA 2CB5A 2PNSA 2DC9A 1U5IA 3H89A 4BPVA 1PE6A 1Y08A 3H8CA 3QSDA 2DCAA 3GCBA 4I05A 3RVWA 3BC3A 2BDZA 2YJBA 1FH0A 4ZUXU 1AYWA 3AI8A 1TL9A 3IHPA 2R9OA 3MORA 4YYSA 4I07A 4OELA 2GHUA 1PIPA 3LFYA 2B1MA 4FJCA 3BCNA 4PP1A 4YYVA 3BWKA 3LXSA 4YYUA 3P5UA 1ME4A 3H6SA 2R9FA
chains in the Genus database with same CATH superfamily
1ICFA 2NQIA 3F5VA 4XR7A 2JQGR 1U9XA 2AVWA 1S4VA 5KO3A 4D8IA 5F02A 1X9YA 2HHNA 9PAPA 5EGWA 2HH5A 1CQDA 2FO5A 2XU1A 4RY2A 1CPJA 3O1GA 3I3TA 2FRQA 1MDWA 2FUDA 2P86A 3HHAA 2CIOA 4G54A 3IEJA 2PBHA 3WXGA 1KHPA 1TLOA 2G7YA 3B21A 1UKFA 4KLBA 2R6NA 4K7CA 1AU2A 3MP2A 3I06A 5EZSA 4QBBA 4N79A 2XU5A 4BOSA 1F29A 3PDFA 3H8BA 3P5XA 5JA7A 1AIMA 2HXZA 2JQFR 4BS6A 2DOSA 1KFUL 2NQDB 4QRGA 3KX1A 2Y5BA 3BB7A 1Y4HA 1CS8A 1PVJA 4PI3A 5E6JA 3BPMA 1U9WA 1ATKA 1ZIVA 3BPFA 1O0EA 3E9SA 2FRAA 3M99A 5EZQA 2J7QA 4BQVA 4GUAA 3PBHA 3IV2A 2H7JA 3KWZA 3N3GA 4QRXA 3BOWA 3OISA 1F2BA 2J7QC 4CDFB 2NQAA 4X6HA 1PXVA 3MTNA 1A6RA 2FT2A 2ATOA 1BGOA 4OW0A 3KW9A 3MTVA 4MZOA 2VHSA 2DZZA 2C0YA 4WA6A 4W5BA 1DF0A 1EWPA 1M6DA 2OULA 1MEMA 3HWNA 4OVZB 1U9QX 4BSQA 1XKGA 1QDQA 2JRIA 2ARYA 1PPNA 3RVXA 2DC6A 3D6SA 5JH3A 4MSXA 3DF0A 1STFE 4BOQA 3CBKA 4MM3B 4XUIA 1CTEA 2G6DA 2AYNA 4D8EA 4I04A 4YVAA 2YJCA 1AYVA 1QOLA 1VJVA 1MEGA 2IBIA 3PRPA 2AS8A 4HXDB 2AYOA 3CH3X 1JQPA 2DCBA 2YJ2A 3RNVA 4BS5A 3MHHA 4N8WA 3OVXA 1KHQA 2UZJA 3N4CA 3S3QA 4BOUA 1HUCB 3O0UA 2XU3A 4QRVA 3IOQA 1NL6A 1AU4A 1GLOA 3OVZA 4QH6A 4YYQA 4AXMA 4X6IA 3PHUA 4FK5A 2OZ2A 4MI7A 1GMYA 1SP4B 4RF1A 2ACTA 4PP2E 4RF0A 1QXPA 3B79A 3WXFA 3HHIA 3H7DA 3USVA 1BQIA 4RNAA 4DMXA 2AUXA 1CV8A 4XZXA 4REZA 3C9EA 1CB5A 1ITOA 1KXRA 3QT4A 2IPPB 2XU4A 2E01A 3K24A 1NB5A 2R9MA 4A5UA 2Z84A 3W31A 3BBAA 1NQCA 1ZCMA 5CVMA 2GFOA 1YVBA 5A24A 1NB3A 2G8JA 4AXLA 4FIPA 2O6XA 3N3KA 4IUMA 4CZWA 4CDEB 2YJ9A 1AU3A 2BTWB 1PPPA 2PADA 3ZUAA 1CVZA 1KFXL 3TRKA 3U8EA 2AUZA 1BP4A 5K16A 1SNKA 1K3BB 5CVOB 1F2AA 4PADA 4P6EA 1NPZA 1MS6A 2FTDA 1AU0A 3KFQA 4CDDB 5PADA 3P5WA 1PPDA 1U9VA 3KKUA 1BY8A 2F1GA 5CHVA 5FPWA 3PW3A 2E02A 4R3DA 2E03A 7PCKA 4Q8GA 3CBJA 2DC8A 4BOZA 3V6CA 4IP3A 3TNXA 2FE8A 1EWOA 4P6GA 1PCIA 2FYEA 1Q6KA 1PBHA 2BDLA 2DCDA 3ZNHA 4OEMA 3KSEA 3PSEA 3OF9A 1YT7A 4X6JA 1ME3A 1VSNA 4PT5A 2Y6EA 1DEUA 3OF8A 1YALA 1GECE 1PADA 1F2CA 1EF7A 2P7UA 1AYUA 4N4ZA 4YV8A 2NQGA 1MHWA 2FQ9A 4HWYA 4BOPA 2AIMA 2B1NA 2DZYA 3NHEA 5CVNB 1CJLA 2HWKA 3V6EA 2JTCA 4YYRA 4DMYA 1TU6A 1YK7A 4OVZA 3HD3A 4M0WA 2DJFB 4MZSA 2AU1A 3IUTA 4YYWA 4D8BA 2DCCA 2PREA 1EWLA 3WXEA 3ERVA 2YJ8A 2HD5A 4WURA 4Q8HA 6PADA 5JZEA 1IWDA 1QMYA 3IMAA 3OQCA 1EWMA 3K8UA 1POPA 2DC7A 2VHFA 5J94A 3PHXA 2BU3A 3PRMA 3TMPA 4ZTBA 3E1ZB 2R9CA 3PT2A 2G8EA 2F7DA 1YZBA 1AECA 5EF4A 3PNRA 3F75A 2WBFX 3MHSA 5CHTA 3KWBX 4RKXA 4W4UA 1MIRA 3S3RA 2R9NA 8PCHA 2E00A 4CDCB 1GCBA 1NLJA 3K9MA 3BY4A 1CSBB 3RVVA 1DKIA 2P0RA 4W5CA 3QJ3A 1THEA 2DJGB 4P16A 1PPOA 3PHWA 3CH2X 2OP3A 1YK8A 3P5VA 2CB5A 2PNSA 2DC9A 1U5IA 3H89A 4BPVA 1PE6A 3O65A 1Y08A 3H8CA 3QSDA 2DCAA 3GCBA 3IFUA 4I05A 3RVWA 3BC3A 2BDZA 2AGAA 2YJBA 1FH0A 4ZUXU 1AYWA 3AI8A 1TL9A 3IHPA 2R9OA 3MJ5A 3MORA 4YYSA 4I07A 4OELA 2GHUA 1PIPA 3LFYA 2B1MA 4FJCA 3BCNA 4PP1A 4YYVA 3BWKA 3LXSA 4YYUA 2BTWA 3P5UA 1ME4A 3C0RA 3H6SA 3W30A 2R9FA
chains in the Genus database with same CATH topology
1ICFA 2NQIA 2VFBA 3F5VA 4XR7A 2JQGR 1U9XA 2AVWA 1S4VA 5F02A 1X9YA 2HHNA 9PAPA 5EGWA 2HH5A 1CQDA 2FO5A 2XU1A 4RY2A 1CPJA 3O1GA 3I3TA 1GX3A 2FRQA 1MDWA 2FUDA 2P86A 3HHAA 2CIOA 4G54A 3IEJA 2PBHA 3WXGA 1KHPA 1TLOA 2G7YA 4KLBA 2R6NA 4K7CA 1AU2A 3I06A 4QBBA 4N79A 2XU5A 1F29A 3PDFA 3H8BA 3P5XA 5JA7A 1AIMA 2HXZA 2JQFR 4BS6A 1KFUL 2NQDB 4QRGA 3KX1A 2Y5BA 1Y4HA 1CS8A 4PI3A 3BPMA 1U9WA 1ATKA 1ZIVA 3BPFA 1O0EA 2FRAA 3M99A 4BQVA 3PBHA 3IV2A 2H7JA 3KWZA 3N3GA 4QRXA 3BOWA 1W6FA 3OISA 1F2BA 4CDFB 2NQAA 4X6HA 1PXVA 3MTNA 1A6RA 2FT2A 2VFCA 2ATOA 1BGOA 3KW9A 4MZOA 2VHSA 2DZZA 2C0YA 4WA6A 4W5BA 1DF0A 1EWPA 4NV7A 1M6DA 4NV8A 2OULA 1MEMA 3HWNA 1U9QX 4BSQA 1XKGA 1QDQA 2ARYA 1PPNA 3RVXA 2DC6A 3D6SA 5JH3A 4MSXA 3DF0A 1STFE 3CBKA 4XUIA 1CTEA 2G6DA 2AYNA 4YVAA 4I04A 2YJCA 1AYVA 1QOLA 1VJVA 1MEGA 2IBIA 2AS8A 2AYOA 3CH3X 1JQPA 2DCBA 2YJ2A 4BS5A 3MHHA 4N8WA 3D9WA 3OVXA 1KHQA 3S3QA 3N4CA 1HUCB 3O0UA 2XU3A 4QRVA 3IOQA 1NL6A 1AU4A 1GLOA 3OVZA 4QH6A 4YYQA 4AXMA 4X6IA 4FK5A 2OZ2A 1GMYA 1SP4B 2ACTA 4PP2E 1QXPA 3B79A 3WXFA 3HHIA 3H7DA 3USVA 1BQIA 4DMXA 2AUXA 1CV8A 3C9EA 1CB5A 1ITOA 1KXRA 3QT4A 2IPPB 2XU4A 2E01A 3K24A 1NB5A 2R9MA 3LTWA 1NQCA 1ZCMA 5CVMA 2GFOA 1YVBA 5A24A 1NB3A 2G8JA 4AXLA 4FIPA 2O6XA 3N3KA 4CZWA 4GUZA 4CDEB 2YJ9A 1AU3A 1PPPA 2PADA 3ZUAA 1CVZA 1KFXL 3U8EA 2AUZA 1BP4A 5K16A 1SNKA 1K3BB 5CVOB 1F2AA 4B55A 4PADA 4P6EA 1NPZA 1MS6A 2FTDA 1AU0A 3KFQA 4CDDB 5PADA 3P5WA 1PPDA 1U9VA 3KKUA 1BY8A 2F1GA 5CHVA 5FPWA 3PW3A 2E02A 2E03A 7PCKA 4Q8GA 3CBJA 2DC8A 3V6CA 3TNXA 1EWOA 4P6GA 1PCIA 2FYEA 1Q6KA 1PBHA 2BDLA 2DCDA 4OEMA 3KSEA 3OF9A 1YT7A 4X6JA 1ME3A 1VSNA 2Y6EA 1DEUA 3OF8A 1YALA 1GECE 1PADA 1F2CA 1EF7A 2P7UA 1AYUA 4N4ZA 4YV8A 2NQGA 1MHWA 2FQ9A 4HWYA 2AIMA 2B1NA 2DZYA 3NHEA 5CVNB 1CJLA 3V6EA 4YYRA 4DMYA 1TU6A 1YK7A 3HD3A 2DJFB 4MZSA 2AU1A 3IUTA 4YYWA 2DCCA 2PREA 1EWLA 3WXEA 3ERVA 2YJ8A 2HD5A 4Q8HA 2BSZA 6PADA 1IWDA 1QMYA 3IMAA 1EWMA 3K8UA 1POPA 2DC7A 2VHFA 5J94A 3E1ZB 2R9CA 1W4TA 2G8EA 2F7DA 1AECA 5EF4A 3PNRA 3F75A 2WBFX 3MHSA 5CHTA 3KWBX 4W4UA 4C5PA 1MIRA 3S3RA 2R9NA 8PCHA 2E00A 4CDCB 1GCBA 1NLJA 3K9MA 1CSBB 3RVVA 2P0RA 4W5CA 3QJ3A 1THEA 2DJGB 1PPOA 3CH2X 2OP3A 1YK8A 3P5VA 2CB5A 1W5RA 2PNSA 2DC9A 1U5IA 3H89A 4BPVA 1PE6A 1Y08A 3H8CA 3QSDA 2DCAA 3GCBA 4I05A 3RVWA 3BC3A 2BDZA 2YJBA 1FH0A 4ZUXU 1AYWA 3AI8A 1TL9A 3IHPA 2R9OA 3MORA 4YYSA 4I07A 4OELA 1E2TA 2GHUA 1PIPA 3LFYA 4BGFA 2B1MA 4FJCA 3BCNA 4PP1A 4YYVA 3BWKA 3LXSA 4YYUA 3P5UA 1ME4A 3H6SA 2R9FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ICF A;  2NQI A;  3F5V A;  4XR7 A;  2JQG R;  1U9X A;  2AVW A;  1S4V A;  5F02 A;  1X9Y A;  2HHN A;  9PAP A;  5EGW A;  2HH5 A;  1CQD A;  2FO5 A;  2XU1 A;  4RY2 A;  1CPJ A;  3O1G A;  3I3T A;  2FRQ A;  1MDW A;  2FUD A;  2P86 A;  3HHA A;  2CIO A;  4G54 A;  3IEJ A;  2PBH A;  3WXG A;  1KHP A;  1TLO A;  2G7Y A;  4KLB A;  2R6N A;  4K7C A;  1AU2 A;  3I06 A;  4QBB A;  4N79 A;  2XU5 A;  1F29 A;  3PDF A;  3H8B A;  3P5X A;  5JA7 A;  1AIM A;  2HXZ A;  2JQF R;  4BS6 A;  1KFU L;  2NQD B;  4QRG A;  3KX1 A;  2Y5B A;  1Y4H A;  1CS8 A;  4PI3 A;  3BPM A;  1U9W A;  1ATK A;  1ZIV A;  3BPF A;  1O0E A;  2FRA A;  3M99 A;  4BQV A;  3PBH A;  3IV2 A;  2H7J A;  3KWZ A;  3N3G A;  4QRX A;  3BOW A;  3OIS A;  1F2B A;  4CDF B;  2NQA A;  4X6H A;  1PXV A;  3MTN A;  1A6R A;  2FT2 A;  2ATO A;  1BGO A;  3KW9 A;  4MZO A;  2VHS A;  2DZZ A;  2C0Y A;  4WA6 A;  4W5B A;  1DF0 A;  1EWP A;  1M6D A;  2OUL A;  1MEM A;  3HWN A;  1U9Q X;  4BSQ A;  1XKG A;  1QDQ A;  2ARY A;  1PPN A;  3RVX A;  2DC6 A;  3D6S A;  5JH3 A;  4MSX A;  3DF0 A;  1STF E;  3CBK A;  4XUI A;  1CTE A;  2G6D A;  2AYN A;  4YVA A;  4I04 A;  2YJC A;  1AYV A;  1QOL A;  1VJV A;  1MEG A;  2IBI A;  2AS8 A;  2AYO A;  3CH3 X;  1JQP A;  2DCB A;  2YJ2 A;  4BS5 A;  3MHH A;  4N8W A;  3OVX A;  1KHQ A;  3S3Q A;  3N4C A;  1HUC B;  3O0U A;  2XU3 A;  4QRV A;  3IOQ A;  1NL6 A;  1AU4 A;  1GLO A;  3OVZ A;  4QH6 A;  4YYQ A;  4AXM A;  4X6I A;  4FK5 A;  2OZ2 A;  1GMY A;  1SP4 B;  2ACT A;  4PP2 E;  1QXP A;  3B79 A;  3WXF A;  3HHI A;  3H7D A;  3USV A;  1BQI A;  4DMX A;  2AUX A;  1CV8 A;  3C9E A;  1CB5 A;  1ITO A;  1KXR A;  3QT4 A;  2IPP B;  2XU4 A;  2E01 A;  3K24 A;  1NB5 A;  2R9M A;  1NQC A;  1ZCM A;  5CVM A;  2GFO A;  1YVB A;  5A24 A;  1NB3 A;  2G8J A;  4AXL A;  4FIP A;  2O6X A;  3N3K A;  4CZW A;  4CDE B;  2YJ9 A;  1AU3 A;  1PPP A;  2PAD A;  3ZUA A;  1CVZ A;  1KFX L;  3U8E A;  2AUZ A;  1BP4 A;  5K16 A;  1SNK A;  1K3B B;  5CVO B;  1F2A A;  4PAD A;  4P6E A;  1NPZ A;  1MS6 A;  2FTD A;  1AU0 A;  3KFQ A;  4CDD B;  5PAD A;  3P5W A;  1PPD A;  1U9V A;  3KKU A;  1BY8 A;  2F1G A;  5CHV A;  5FPW A;  3PW3 A;  2E02 A;  2E03 A;  7PCK A;  4Q8G A;  3CBJ A;  2DC8 A;  3V6C A;  3TNX A;  1EWO A;  4P6G A;  1PCI A;  2FYE A;  1Q6K A;  1PBH A;  2BDL A;  2DCD A;  4OEM A;  3KSE A;  3OF9 A;  1YT7 A;  4X6J A;  1ME3 A;  1VSN A;  2Y6E A;  1DEU A;  3OF8 A;  1YAL A;  1GEC E;  1PAD A;  1F2C A;  1EF7 A;  2P7U A;  1AYU A;  4N4Z A;  4YV8 A;  2NQG A;  1MHW A;  2FQ9 A;  4HWY A;  2AIM A;  2B1N A;  2DZY A;  3NHE A;  5CVN B;  1CJL A;  3V6E A;  4YYR A;  4DMY A;  1TU6 A;  1YK7 A;  3HD3 A;  2DJF B;  4MZS A;  2AU1 A;  3IUT A;  4YYW A;  2DCC A;  2PRE A;  1EWL A;  3WXE A;  3ERV A;  2YJ8 A;  2HD5 A;  4Q8H A;  6PAD A;  1IWD A;  1QMY A;  3IMA A;  1EWM A;  3K8U A;  1POP A;  2DC7 A;  2VHF A;  5J94 A;  3E1Z B;  2R9C A;  2G8E A;  2F7D A;  1AEC A;  5EF4 A;  3PNR A;  3F75 A;  2WBF X;  3MHS A;  5CHT A;  3KWB X;  4W4U A;  1MIR A;  3S3R A;  2R9N A;  8PCH A;  2E00 A;  4CDC B;  1GCB A;  1NLJ A;  3K9M A;  1CSB B;  3RVV A;  2P0R A;  4W5C A;  3QJ3 A;  1THE A;  2DJG B;  1PPO A;  3CH2 X;  2OP3 A;  1YK8 A;  3P5V A;  2CB5 A;  2PNS A;  2DC9 A;  1U5I A;  3H89 A;  4BPV A;  1PE6 A;  1Y08 A;  3H8C A;  3QSD A;  2DCA A;  3GCB A;  4I05 A;  3RVW A;  3BC3 A;  2BDZ A;  2YJB A;  1FH0 A;  4ZUX U;  1AYW A;  3AI8 A;  1TL9 A;  3IHP A;  2R9O A;  3MOR A;  4YYS A;  4I07 A;  4OEL A;  2GHU A;  1PIP A;  3LFY A;  2B1M A;  4FJC A;  3BCN A;  4PP1 A;  4YYV A;  3BWK A;  3LXS A;  4YYU A;  3P5U A;  1ME4 A;  3H6S A;  2R9F A; 
#chains in the Genus database with same CATH topology
 1ICF A;  2NQI A;  3F5V A;  4XR7 A;  2JQG R;  1U9X A;  2AVW A;  1S4V A;  5KO3 A;  4D8I A;  5F02 A;  1X9Y A;  2HHN A;  9PAP A;  5EGW A;  2HH5 A;  1CQD A;  2FO5 A;  2XU1 A;  4RY2 A;  1CPJ A;  3O1G A;  3I3T A;  2FRQ A;  1MDW A;  2FUD A;  2P86 A;  3HHA A;  2CIO A;  4G54 A;  3IEJ A;  2PBH A;  3WXG A;  1KHP A;  1TLO A;  2G7Y A;  3B21 A;  1UKF A;  4KLB A;  2R6N A;  4K7C A;  1AU2 A;  3MP2 A;  3I06 A;  5EZS A;  4QBB A;  4N79 A;  2XU5 A;  4BOS A;  1F29 A;  3PDF A;  3H8B A;  3P5X A;  5JA7 A;  1AIM A;  2HXZ A;  2JQF R;  4BS6 A;  2DOS A;  1KFU L;  2NQD B;  4QRG A;  3KX1 A;  2Y5B A;  3BB7 A;  1Y4H A;  1CS8 A;  1PVJ A;  4PI3 A;  5E6J A;  3BPM A;  1U9W A;  1ATK A;  1ZIV A;  3BPF A;  1O0E A;  3E9S A;  2FRA A;  3M99 A;  5EZQ A;  2J7Q A;  4BQV A;  4GUA A;  3PBH A;  3IV2 A;  2H7J A;  3KWZ A;  3N3G A;  4QRX A;  3BOW A;  3OIS A;  1F2B A;  2J7Q C;  4CDF B;  2NQA A;  4X6H A;  1PXV A;  3MTN A;  1A6R A;  2FT2 A;  2ATO A;  1BGO A;  4OW0 A;  3KW9 A;  3MTV A;  4MZO A;  2VHS A;  2DZZ A;  2C0Y A;  4WA6 A;  4W5B A;  1DF0 A;  1EWP A;  1M6D A;  2OUL A;  1MEM A;  3HWN A;  4OVZ B;  1U9Q X;  4BSQ A;  1XKG A;  1QDQ A;  2JRI A;  2ARY A;  1PPN A;  3RVX A;  2DC6 A;  3D6S A;  5JH3 A;  4MSX A;  3DF0 A;  1STF E;  4BOQ A;  3CBK A;  4MM3 B;  4XUI A;  1CTE A;  2G6D A;  2AYN A;  4D8E A;  4I04 A;  4YVA A;  2YJC A;  1AYV A;  1QOL A;  1VJV A;  1MEG A;  2IBI A;  3PRP A;  2AS8 A;  4HXD B;  2AYO A;  3CH3 X;  1JQP A;  2DCB A;  2YJ2 A;  3RNV A;  4BS5 A;  3MHH A;  4N8W A;  3OVX A;  1KHQ A;  2UZJ A;  3N4C A;  3S3Q A;  4BOU A;  1HUC B;  3O0U A;  2XU3 A;  4QRV A;  3IOQ A;  1NL6 A;  1AU4 A;  1GLO A;  3OVZ A;  4QH6 A;  4YYQ A;  4AXM A;  4X6I A;  3PHU A;  4FK5 A;  2OZ2 A;  4MI7 A;  1GMY A;  1SP4 B;  4RF1 A;  2ACT A;  4PP2 E;  4RF0 A;  1QXP A;  3B79 A;  3WXF A;  3HHI A;  3H7D A;  3USV A;  1BQI A;  4RNA A;  4DMX A;  2AUX A;  1CV8 A;  4XZX A;  4REZ A;  3C9E A;  1CB5 A;  1ITO A;  1KXR A;  3QT4 A;  2IPP B;  2XU4 A;  2E01 A;  3K24 A;  1NB5 A;  2R9M A;  4A5U A;  2Z84 A;  3W31 A;  3BBA A;  1NQC A;  1ZCM A;  5CVM A;  2GFO A;  1YVB A;  5A24 A;  1NB3 A;  2G8J A;  4AXL A;  4FIP A;  2O6X A;  3N3K A;  4IUM A;  4CZW A;  4CDE B;  2YJ9 A;  1AU3 A;  2BTW B;  1PPP A;  2PAD A;  3ZUA A;  1CVZ A;  1KFX L;  3TRK A;  3U8E A;  2AUZ A;  1BP4 A;  5K16 A;  1SNK A;  1K3B B;  5CVO B;  1F2A A;  4PAD A;  4P6E A;  1NPZ A;  1MS6 A;  2FTD A;  1AU0 A;  3KFQ A;  4CDD B;  5PAD A;  3P5W A;  1PPD A;  1U9V A;  3KKU A;  1BY8 A;  2F1G A;  5CHV A;  5FPW A;  3PW3 A;  2E02 A;  4R3D A;  2E03 A;  7PCK A;  4Q8G A;  3CBJ A;  2DC8 A;  4BOZ A;  3V6C A;  4IP3 A;  3TNX A;  2FE8 A;  1EWO A;  4P6G A;  1PCI A;  2FYE A;  1Q6K A;  1PBH A;  2BDL A;  2DCD A;  3ZNH A;  4OEM A;  3KSE A;  3PSE A;  3OF9 A;  1YT7 A;  4X6J A;  1ME3 A;  1VSN A;  4PT5 A;  2Y6E A;  1DEU A;  3OF8 A;  1YAL A;  1GEC E;  1PAD A;  1F2C A;  1EF7 A;  2P7U A;  1AYU A;  4N4Z A;  4YV8 A;  2NQG A;  1MHW A;  2FQ9 A;  4HWY A;  4BOP A;  2AIM A;  2B1N A;  2DZY A;  3NHE A;  5CVN B;  1CJL A;  2HWK A;  3V6E A;  2JTC A;  4YYR A;  4DMY A;  1TU6 A;  1YK7 A;  4OVZ A;  3HD3 A;  4M0W A;  2DJF B;  4MZS A;  2AU1 A;  3IUT A;  4YYW A;  4D8B A;  2DCC A;  2PRE A;  1EWL A;  3WXE A;  3ERV A;  2YJ8 A;  2HD5 A;  4WUR A;  4Q8H A;  6PAD A;  5JZE A;  1IWD A;  1QMY A;  3IMA A;  3OQC A;  1EWM A;  3K8U A;  1POP A;  2DC7 A;  2VHF A;  5J94 A;  3PHX A;  2BU3 A;  3PRM A;  3TMP A;  4ZTB A;  3E1Z B;  2R9C A;  3PT2 A;  2G8E A;  2F7D A;  1YZB A;  1AEC A;  5EF4 A;  3PNR A;  3F75 A;  2WBF X;  3MHS A;  5CHT A;  3KWB X;  4RKX A;  4W4U A;  1MIR A;  3S3R A;  2R9N A;  8PCH A;  2E00 A;  4CDC B;  1GCB A;  1NLJ A;  3K9M A;  3BY4 A;  1CSB B;  3RVV A;  1DKI A;  2P0R A;  4W5C A;  3QJ3 A;  1THE A;  2DJG B;  4P16 A;  1PPO A;  3PHW A;  3CH2 X;  2OP3 A;  1YK8 A;  3P5V A;  2CB5 A;  2PNS A;  2DC9 A;  1U5I A;  3H89 A;  4BPV A;  1PE6 A;  3O65 A;  1Y08 A;  3H8C A;  3QSD A;  2DCA A;  3GCB A;  3IFU A;  4I05 A;  3RVW A;  3BC3 A;  2BDZ A;  2AGA A;  2YJB A;  1FH0 A;  4ZUX U;  1AYW A;  3AI8 A;  1TL9 A;  3IHP A;  2R9O A;  3MJ5 A;  3MOR A;  4YYS A;  4I07 A;  4OEL A;  2GHU A;  1PIP A;  3LFY A;  2B1M A;  4FJC A;  3BCN A;  4PP1 A;  4YYV A;  3BWK A;  3LXS A;  4YYU A;  2BTW A;  3P5U A;  1ME4 A;  3C0R A;  3H6S A;  3W30 A;  2R9F A; 
#chains in the Genus database with same CATH homology
 1ICF A;  2NQI A;  2VFB A;  3F5V A;  4XR7 A;  2JQG R;  1U9X A;  2AVW A;  1S4V A;  5F02 A;  1X9Y A;  2HHN A;  9PAP A;  5EGW A;  2HH5 A;  1CQD A;  2FO5 A;  2XU1 A;  4RY2 A;  1CPJ A;  3O1G A;  3I3T A;  1GX3 A;  2FRQ A;  1MDW A;  2FUD A;  2P86 A;  3HHA A;  2CIO A;  4G54 A;  3IEJ A;  2PBH A;  3WXG A;  1KHP A;  1TLO A;  2G7Y A;  4KLB A;  2R6N A;  4K7C A;  1AU2 A;  3I06 A;  4QBB A;  4N79 A;  2XU5 A;  1F29 A;  3PDF A;  3H8B A;  3P5X A;  5JA7 A;  1AIM A;  2HXZ A;  2JQF R;  4BS6 A;  1KFU L;  2NQD B;  4QRG A;  3KX1 A;  2Y5B A;  1Y4H A;  1CS8 A;  4PI3 A;  3BPM A;  1U9W A;  1ATK A;  1ZIV A;  3BPF A;  1O0E A;  2FRA A;  3M99 A;  4BQV A;  3PBH A;  3IV2 A;  2H7J A;  3KWZ A;  3N3G A;  4QRX A;  3BOW A;  1W6F A;  3OIS A;  1F2B A;  4CDF B;  2NQA A;  4X6H A;  1PXV A;  3MTN A;  1A6R A;  2FT2 A;  2VFC A;  2ATO A;  1BGO A;  3KW9 A;  4MZO A;  2VHS A;  2DZZ A;  2C0Y A;  4WA6 A;  4W5B A;  1DF0 A;  1EWP A;  4NV7 A;  1M6D A;  4NV8 A;  2OUL A;  1MEM A;  3HWN A;  1U9Q X;  4BSQ A;  1XKG A;  1QDQ A;  2ARY A;  1PPN A;  3RVX A;  2DC6 A;  3D6S A;  5JH3 A;  4MSX A;  3DF0 A;  1STF E;  3CBK A;  4XUI A;  1CTE A;  2G6D A;  2AYN A;  4YVA A;  4I04 A;  2YJC A;  1AYV A;  1QOL A;  1VJV A;  1MEG A;  2IBI A;  2AS8 A;  2AYO A;  3CH3 X;  1JQP A;  2DCB A;  2YJ2 A;  4BS5 A;  3MHH A;  4N8W A;  3D9W A;  3OVX A;  1KHQ A;  3S3Q A;  3N4C A;  1HUC B;  3O0U A;  2XU3 A;  4QRV A;  3IOQ A;  1NL6 A;  1AU4 A;  1GLO A;  3OVZ A;  4QH6 A;  4YYQ A;  4AXM A;  4X6I A;  4FK5 A;  2OZ2 A;  1GMY A;  1SP4 B;  2ACT A;  4PP2 E;  1QXP A;  3B79 A;  3WXF A;  3HHI A;  3H7D A;  3USV A;  1BQI A;  4DMX A;  2AUX A;  1CV8 A;  3C9E A;  1CB5 A;  1ITO A;  1KXR A;  3QT4 A;  2IPP B;  2XU4 A;  2E01 A;  3K24 A;  1NB5 A;  2R9M A;  3LTW A;  1NQC A;  1ZCM A;  5CVM A;  2GFO A;  1YVB A;  5A24 A;  1NB3 A;  2G8J A;  4AXL A;  4FIP A;  2O6X A;  3N3K A;  4CZW A;  4GUZ A;  4CDE B;  2YJ9 A;  1AU3 A;  1PPP A;  2PAD A;  3ZUA A;  1CVZ A;  1KFX L;  3U8E A;  2AUZ A;  1BP4 A;  5K16 A;  1SNK A;  1K3B B;  5CVO B;  1F2A A;  4B55 A;  4PAD A;  4P6E A;  1NPZ A;  1MS6 A;  2FTD A;  1AU0 A;  3KFQ A;  4CDD B;  5PAD A;  3P5W A;  1PPD A;  1U9V A;  3KKU A;  1BY8 A;  2F1G A;  5CHV A;  5FPW A;  3PW3 A;  2E02 A;  2E03 A;  7PCK A;  4Q8G A;  3CBJ A;  2DC8 A;  3V6C A;  3TNX A;  1EWO A;  4P6G A;  1PCI A;  2FYE A;  1Q6K A;  1PBH A;  2BDL A;  2DCD A;  4OEM A;  3KSE A;  3OF9 A;  1YT7 A;  4X6J A;  1ME3 A;  1VSN A;  2Y6E A;  1DEU A;  3OF8 A;  1YAL A;  1GEC E;  1PAD A;  1F2C A;  1EF7 A;  2P7U A;  1AYU A;  4N4Z A;  4YV8 A;  2NQG A;  1MHW A;  2FQ9 A;  4HWY A;  2AIM A;  2B1N A;  2DZY A;  3NHE A;  5CVN B;  1CJL A;  3V6E A;  4YYR A;  4DMY A;  1TU6 A;  1YK7 A;  3HD3 A;  2DJF B;  4MZS A;  2AU1 A;  3IUT A;  4YYW A;  2DCC A;  2PRE A;  1EWL A;  3WXE A;  3ERV A;  2YJ8 A;  2HD5 A;  4Q8H A;  2BSZ A;  6PAD A;  1IWD A;  1QMY A;  3IMA A;  1EWM A;  3K8U A;  1POP A;  2DC7 A;  2VHF A;  5J94 A;  3E1Z B;  2R9C A;  1W4T A;  2G8E A;  2F7D A;  1AEC A;  5EF4 A;  3PNR A;  3F75 A;  2WBF X;  3MHS A;  5CHT A;  3KWB X;  4W4U A;  4C5P A;  1MIR A;  3S3R A;  2R9N A;  8PCH A;  2E00 A;  4CDC B;  1GCB A;  1NLJ A;  3K9M A;  1CSB B;  3RVV A;  2P0R A;  4W5C A;  3QJ3 A;  1THE A;  2DJG B;  1PPO A;  3CH2 X;  2OP3 A;  1YK8 A;  3P5V A;  2CB5 A;  1W5R A;  2PNS A;  2DC9 A;  1U5I A;  3H89 A;  4BPV A;  1PE6 A;  1Y08 A;  3H8C A;  3QSD A;  2DCA A;  3GCB A;  4I05 A;  3RVW A;  3BC3 A;  2BDZ A;  2YJB A;  1FH0 A;  4ZUX U;  1AYW A;  3AI8 A;  1TL9 A;  3IHP A;  2R9O A;  3MOR A;  4YYS A;  4I07 A;  4OEL A;  1E2T A;  2GHU A;  1PIP A;  3LFY A;  4BGF A;  2B1M A;  4FJC A;  3BCN A;  4PP1 A;  4YYV A;  3BWK A;  3LXS A;  4YYU A;  3P5U A;  1ME4 A;  3H6S A;  2R9F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...