1NPZA

Crystal structures of cathepsin s inhibitor complexes
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
217
structure length
217
Chain Sequence
b'LPDSVDWREKGCVTEVKYQGSCGACWAFSAVGALEAQLKLKTGKLVTLSAQNLVDCSTEKYGNKGCNGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYDSKYRAATCSKYTELPYGREDVLKEAVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSWGHNFGEEGYIRMARNKGNHCGIASFPSYPEI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cathepsin S
publication title Specificity determinants of human cathepsin s revealed by crystal structures of complexes.
pubmed doi rcsb
molecule tags Hydrolase
total genus 68
structure length 217
sequence length 217
chains with identical sequence B
ec nomenclature ec 3.4.22.27: Cathepsin S.
pdb deposition date 2003-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1npzA00
5J94A 4Q8GA 1NB5A 3I3TA 1A6RA 2R9NA 2GFOA 1NB3A 3K8UA 3WXFA 1NQCA 2FYEA 2GHUA 3V6CA 2NQAA 2PREA 1ATKA 3RVWA 3P5XA 2F1GA 3BC3A 3QJ3A 2R9CA 4XR7A 1KHPA 6PADA 2CB5A 1AU3A 3IMAA 3H89A 1QOLA 3S3RA 1EWPA 1F2AA 1PPOA 4YYSA 2FTDA 1MDWA 2G8EA 1F29A 5CHVA 5EF4A 1SNKA 1AYUA 2R6NA 2ATOA 4QBBA 2YJCA 5JH3A 1CPJA 2P0RA 2DJGB 1FH0A 1CTEA 4QRXA 1GECE 1EWOA 2PADA 3H7DA 3IUTA 3WXGA 1BP4A 2R9OA 1GCBA 4P6GA 2AUXA 2WBFX 4CZWA 1O0EA 1U9XA 3KWZA 2FRAA 2HHNA 1ITOA 1MEGA 1F2CA 2BDLA 2E03A 4G54A 4N79A 4YYVA 3CBJA 3PW3A 1PCIA 1YT7A 3AI8A 3MORA 4N4ZA 4OELA 3U8EA 4YYQA 2DZZA 1CB5A 2P7UA 2CIOA 1S4VA 1TL9A 3QT4A 3KX1A 1PBHA 4OEMA 3KSEA 4HWYA 4FIPA 1PE6A 4BS5A 1X9YA 3BCNA 1BY8A 2JQFR 5JA7A 2Y5BA 2BDZA 4I04A 3QSDA 1PXVA 3OVZA 5PADA 1KXRA 2G6DA 3HD3A 4DMYA 1YALA 1ZCMA 1AU0A 1MS6A 3LFYA 2OZ2A 3C9EA 1AU4A 7PCKA 3PBHA 1AYVA 4QRGA 2B1NA 4MZOA 4I07A 1NLJA 3LXSA 4AXMA 1KFUL 1CJLA 4BSQA 2O6XA 2DCAA 2HXZA 3BOWA 3O1GA 3IOQA 1EWMA 4YYUA 1ICFA 3DF0A 3P5VA 5A24A 3GCBA 1DEUA 1IWDA 1NL6A 5CVNB 2NQDB 2AUZA 1DF0A 1TLOA 4X6IA 1XKGA 3P5WA 1QDQA 1AYWA 3M99A 2DCBA 2XU4A 2NQGA 1AU2A 3BPMA 1M6DA 3D6SA 4YVAA 3P5UA 3RVVA 2G8JA 1BGOA 2AYOA 2DCDA 2G7YA 4QRVA 2E02A 3MHSA 4QH6A 4WA6A 1HUCB 4MSXA 3MTNA 1YVBA 2ACTA 2F7DA 3TNXA 2IPPB 1STFE 4BPVA 2C0YA 4CDEB 2FO5A 3N3GA 4X6HA 2AVWA 3N4CA 4W5CA 2HH5A 3BPFA 2DC8A 4CDCB 3OF8A 4KLBA 2DC9A 2DZYA 1CSBB 4BS6A 4Q8HA 3B79A 2E01A 2FQ9A 1KHQA 3IEJA 3ERVA 1PPDA 1MEMA 1VSNA 4W4UA 1K3BB 2B1MA 3O0UA 4CDDB 1JQPA 3USVA 3K9MA 2OULA 1GMYA 3OVXA 4X6JA 3KFQA 3ZUAA 2OP3A 3H8BA 5FPWA 3N3KA 3S3QA 4FJCA 2DC6A 2ARYA 3V6EA 2NQIA 1CQDA 4DMXA 2FRQA 4PADA 1QMYA 3NHEA 1BQIA 2PBHA 2VHSA 2YJ2A 2YJ8A 2YJBA 2JQGR 1PPNA 1MIRA 4YYRA 4CDFB 1F2BA 3K24A 5CVOB 2XU1A 3F5VA 3HHIA 2AIMA 1YK8A 2FT2A 3WXEA 1EWLA 4XUIA 3OISA 1CS8A 1PIPA 3F75A 1POPA 2DJFB 3BWKA 2XU3A 4YV8A 3CH3X 4N8WA 4AXLA 1PADA 1AECA 2PNSA 5CHTA 1ZIVA 1U9WA 4PP1A 1NPZA 2DCCA 3H6SA 9PAPA 1ME3A 2XU5A 4MZSA 1VJVA 3RVXA 4RY2A 3PDFA 3KKUA 4YYWA 8PCHA 1GLOA 1Y4HA 2P86A 2DC7A 2FUDA 3MHHA 1SP4B 5K16A 4FK5A 3IV2A 1U9VA 3HHAA 2AYNA 1KFXL 4BQVA 2R9MA 1U5IA 1U9QX 4PI3A 1PPPA 5F02A 2Y6EA 3PNRA 2R9FA 3CH2X 1CVZA 5CVMA 4W5BA 3OF9A 3E1ZB 1EF7A 2HD5A 4ZUXU 3HWNA 3I06A 2AS8A 1CV8A 3IHPA 2E00A 4K7CA 4I05A 4PP2E 3CBKA 2AU1A 1ME4A 1QXPA 2H7JA 4P6EA 1AIMA 1Q6KA 1MHWA 3KW9A 1YK7A 1Y08A 2IBIA 1THEA 3H8CA 5EGWA 2YJ9A 3KWBX 2VHFA 1TU6A
chains in the Genus database with same CATH superfamily
5J94A 4Q8GA 2AGAA 1NB5A 3I3TA 1A6RA 2BTWA 2R9NA 2GFOA 1NB3A 3K8UA 3WXFA 1NQCA 2FYEA 2GHUA 3V6CA 2NQAA 2PREA 1ATKA 3RVWA 3P5XA 2F1GA 3BC3A 3QJ3A 2R9CA 4XR7A 4BOUA 3PSEA 1KHPA 6PADA 4P16A 2CB5A 1AU3A 3IMAA 3H89A 4R3DA 1QOLA 3S3RA 1EWPA 1F2AA 1PPOA 4YYSA 2FTDA 1MDWA 2G8EA 1F29A 3O65A 5CHVA 5EF4A 1SNKA 1AYUA 2R6NA 2ATOA 4QBBA 2YJCA 3RNVA 5JH3A 1CPJA 2P0RA 2DJGB 3PT2A 1FH0A 3BY4A 1CTEA 1GECE 4QRXA 1EWOA 2PADA 3H7DA 3IUTA 4PT5A 3PHUA 1BP4A 3WXGA 2R9OA 1GCBA 4P6GA 3TMPA 2AUXA 2Z84A 2WBFX 3PHWA 3MP2A 4CZWA 1O0EA 1U9XA 3KWZA 2FRAA 2HHNA 3MTVA 1ITOA 1MEGA 1F2CA 2BDLA 2E03A 4G54A 4N79A 4ZTBA 3E9SA 4YYVA 3CBJA 3PW3A 1PCIA 1YT7A 4WURA 2DOSA 3BBAA 3AI8A 3MORA 4N4ZA 2UZJA 2FE8A 4OVZB 4OELA 3U8EA 4YYQA 2DZZA 1CB5A 2P7UA 2CIOA 1S4VA 1TL9A 3QT4A 3KX1A 1PBHA 3OQCA 4OEMA 3KSEA 1YZBA 4HWYA 4FIPA 1PE6A 4BS5A 1X9YA 3BCNA 3PRPA 1BY8A 2JQFR 5JA7A 5EZQA 2Y5BA 2BDZA 4I04A 3QSDA 1PXVA 3OVZA 5PADA 1KXRA 2G6DA 2HWKA 3HD3A 4DMYA 1YALA 1ZCMA 1AU0A 4RNAA 1MS6A 3LFYA 2OZ2A 3C9EA 1AU4A 7PCKA 4MI7A 3PBHA 1AYVA 4QRGA 2B1NA 4MZOA 4I07A 1NLJA 3LXSA 4AXMA 1KFUL 1CJLA 4BSQA 2O6XA 2DCAA 2HXZA 3BOWA 3O1GA 3IOQA 4REZA 1EWMA 4YYUA 1ICFA 4RKXA 3DF0A 1PVJA 3P5VA 5A24A 3GCBA 3IFUA 1DEUA 2JRIA 1IWDA 1NL6A 5CVNB 2NQDB 2AUZA 1DF0A 1TLOA 4X6IA 1XKGA 3P5WA 5E6JA 1QDQA 1AYWA 3M99A 2DCBA 2XU4A 2NQGA 1AU2A 3BPMA 1M6DA 3D6SA 4BOZA 4YVAA 4D8EA 3P5UA 3RVVA 3MJ5A 2G8JA 1BGOA 4MM3B 2AYOA 2DCDA 2G7YA 2J7QC 4QRVA 2E02A 1UKFA 3ZNHA 4XZXA 3MHSA 4QH6A 4WA6A 1HUCB 3W30A 4MSXA 3MTNA 1YVBA 4OVZA 2ACTA 2F7DA 3TNXA 2BU3A 2IPPB 1STFE 4BPVA 2C0YA 4CDEB 2FO5A 3N3GA 4X6HA 2AVWA 3N4CA 4W5CA 2HH5A 3BPFA 2DC8A 4IUMA 2J7QA 4D8BA 5EZSA 4CDCB 3OF8A 4KLBA 2DC9A 2DZYA 1CSBB 4BS6A 4Q8HA 3B79A 2E01A 2FQ9A 4D8IA 1KHQA 4A5UA 3IEJA 3ERVA 1PPDA 1MEMA 1VSNA 4W4UA 1K3BB 2B1MA 3O0UA 4BOQA 4CDDB 1JQPA 3USVA 3K9MA 2OULA 3TRKA 3W31A 1GMYA 3OVXA 4X6JA 3KFQA 3ZUAA 2OP3A 4M0WA 3H8BA 5FPWA 3N3KA 3S3QA 4FJCA 4RF0A 2DC6A 2ARYA 3V6EA 2NQIA 1CQDA 4DMXA 2FRQA 4PADA 1QMYA 4OW0A 3NHEA 1BQIA 2PBHA 2VHSA 2YJ2A 2YJ8A 2YJBA 2JQGR 3PRMA 4BOSA 1PPNA 1MIRA 4YYRA 3PHXA 4CDFB 1F2BA 5KO3A 2BTWB 3K24A 5CVOB 2XU1A 3F5VA 3HHIA 1DKIA 2AIMA 1YK8A 2FT2A 3WXEA 1EWLA 4XUIA 4BOPA 3OISA 1CS8A 1PIPA 4HXDB 3F75A 1POPA 2DJFB 3BWKA 2XU3A 4YV8A 3CH3X 4N8WA 4AXLA 3B21A 1PADA 1AECA 2JTCA 2PNSA 5CHTA 1ZIVA 1U9WA 4PP1A 1NPZA 2DCCA 3H6SA 9PAPA 1ME3A 2XU5A 3C0RA 4MZSA 1VJVA 3RVXA 4RY2A 3PDFA 3KKUA 4YYWA 8PCHA 1GLOA 1Y4HA 2P86A 2DC7A 2FUDA 3MHHA 1SP4B 5K16A 3BB7A 4FK5A 3IV2A 1U9VA 3HHAA 2AYNA 1KFXL 4BQVA 4RF1A 2R9MA 1U5IA 1U9QX 4PI3A 1PPPA 5F02A 2Y6EA 3PNRA 2R9FA 3CH2X 1CVZA 5CVMA 4W5BA 3OF9A 3E1ZB 1EF7A 2HD5A 4ZUXU 3HWNA 4IP3A 3I06A 2AS8A 1CV8A 3IHPA 2E00A 4K7CA 4I05A 4PP2E 3CBKA 2AU1A 4GUAA 1ME4A 1QXPA 2H7JA 4P6EA 1AIMA 1Q6KA 1MHWA 3KW9A 1YK7A 1Y08A 2IBIA 1THEA 3H8CA 5EGWA 2YJ9A 3KWBX 2VHFA 1TU6A 5JZEA
chains in the Genus database with same CATH topology
5J94A 4Q8GA 1NB5A 3I3TA 1A6RA 2R9NA 2GFOA 1NB3A 3K8UA 3WXFA 1NQCA 2BSZA 2FYEA 2GHUA 3V6CA 2NQAA 2PREA 1ATKA 3RVWA 3P5XA 2F1GA 3BC3A 3QJ3A 2R9CA 4XR7A 1KHPA 6PADA 2CB5A 1AU3A 3IMAA 3H89A 1QOLA 3S3RA 1EWPA 1F2AA 1PPOA 1E2TA 4YYSA 2FTDA 1MDWA 2G8EA 1F29A 5CHVA 5EF4A 1SNKA 1AYUA 2R6NA 2ATOA 4QBBA 2YJCA 5JH3A 1CPJA 2P0RA 2DJGB 1FH0A 1CTEA 1GECE 4QRXA 1EWOA 2PADA 3H7DA 3IUTA 3WXGA 1BP4A 1W5RA 2R9OA 1GCBA 4P6GA 2AUXA 2WBFX 4CZWA 1O0EA 1U9XA 3KWZA 2FRAA 2HHNA 1ITOA 1MEGA 1F2CA 2BDLA 2E03A 4BGFA 4G54A 4N79A 4YYVA 3CBJA 3PW3A 1PCIA 1YT7A 3AI8A 3MORA 4GUZA 4N4ZA 4OELA 3U8EA 4YYQA 2DZZA 1CB5A 2P7UA 2CIOA 1S4VA 1TL9A 3QT4A 3KX1A 1PBHA 4OEMA 3KSEA 4B55A 4HWYA 4FIPA 1PE6A 4BS5A 1X9YA 3BCNA 1BY8A 2JQFR 5JA7A 2Y5BA 2BDZA 1GX3A 4I04A 3QSDA 1PXVA 3OVZA 5PADA 1KXRA 2G6DA 3HD3A 4DMYA 1YALA 1ZCMA 1AU0A 1MS6A 3LFYA 2OZ2A 3C9EA 1AU4A 7PCKA 3PBHA 1AYVA 4QRGA 2B1NA 4MZOA 4I07A 1NLJA 3LXSA 4AXMA 1KFUL 1CJLA 4BSQA 2O6XA 2DCAA 2HXZA 3BOWA 3O1GA 3IOQA 1EWMA 4YYUA 1ICFA 3DF0A 3P5VA 5A24A 3GCBA 1DEUA 1IWDA 1NL6A 5CVNB 2NQDB 2AUZA 1DF0A 1TLOA 4X6IA 1XKGA 3P5WA 1QDQA 1AYWA 3M99A 2DCBA 2XU4A 2NQGA 1AU2A 3BPMA 1M6DA 3D6SA 4YVAA 3P5UA 3RVVA 2G8JA 1BGOA 2AYOA 2DCDA 2G7YA 4QRVA 2E02A 1W4TA 3MHSA 4QH6A 4WA6A 1HUCB 4MSXA 3MTNA 1YVBA 2ACTA 2F7DA 3TNXA 2IPPB 1STFE 4BPVA 2C0YA 4CDEB 2FO5A 3N3GA 4X6HA 2AVWA 3N4CA 4W5CA 2HH5A 3BPFA 2DC8A 3D9WA 4CDCB 3OF8A 4KLBA 2VFCA 2DC9A 2DZYA 1CSBB 4BS6A 4Q8HA 3B79A 2E01A 2FQ9A 1KHQA 3IEJA 3ERVA 1PPDA 1MEMA 1VSNA 4W4UA 1K3BB 2B1MA 3O0UA 4CDDB 1JQPA 3USVA 3K9MA 2OULA 1GMYA 3OVXA 4X6JA 1W6FA 3KFQA 2OP3A 3ZUAA 3H8BA 5FPWA 3N3KA 3S3QA 4FJCA 2DC6A 2ARYA 3V6EA 2NQIA 1CQDA 4DMXA 2FRQA 4PADA 1QMYA 3NHEA 1BQIA 2PBHA 2VHSA 2YJ2A 2YJ8A 4C5PA 2YJBA 2JQGR 1PPNA 1MIRA 4YYRA 4CDFB 1F2BA 3K24A 5CVOB 2XU1A 3F5VA 3HHIA 2AIMA 1YK8A 2FT2A 3WXEA 1EWLA 4XUIA 3OISA 1CS8A 1PIPA 3F75A 1POPA 2DJFB 3BWKA 2XU3A 2VFBA 4YV8A 3CH3X 4N8WA 4AXLA 1PADA 1AECA 2PNSA 5CHTA 1ZIVA 1U9WA 4PP1A 1NPZA 2DCCA 3H6SA 4NV8A 3LTWA 9PAPA 1ME3A 2XU5A 4MZSA 1VJVA 3RVXA 4RY2A 3PDFA 3KKUA 4YYWA 8PCHA 1GLOA 1Y4HA 2P86A 2DC7A 2FUDA 3MHHA 1SP4B 5K16A 4FK5A 3IV2A 4NV7A 1U9VA 3HHAA 2AYNA 1KFXL 4BQVA 2R9MA 1U5IA 1U9QX 4PI3A 1PPPA 5F02A 2Y6EA 3PNRA 2R9FA 3CH2X 1CVZA 5CVMA 4W5BA 3OF9A 3E1ZB 1EF7A 2HD5A 4ZUXU 3HWNA 3I06A 2AS8A 1CV8A 3IHPA 2E00A 4K7CA 4I05A 4PP2E 3CBKA 2AU1A 1ME4A 1QXPA 2H7JA 4P6EA 1AIMA 1Q6KA 1MHWA 3KW9A 1YK7A 1Y08A 2IBIA 1THEA 3H8CA 5EGWA 2YJ9A 3KWBX 2VHFA 1TU6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5J94 A;  4Q8G A;  1NB5 A;  3I3T A;  1A6R A;  2R9N A;  2GFO A;  1NB3 A;  3K8U A;  3WXF A;  1NQC A;  2FYE A;  2GHU A;  3V6C A;  2NQA A;  2PRE A;  1ATK A;  3RVW A;  3P5X A;  2F1G A;  3BC3 A;  3QJ3 A;  2R9C A;  4XR7 A;  1KHP A;  6PAD A;  2CB5 A;  1AU3 A;  3IMA A;  3H89 A;  1QOL A;  3S3R A;  1EWP A;  1F2A A;  1PPO A;  4YYS A;  2FTD A;  1MDW A;  2G8E A;  1F29 A;  5CHV A;  5EF4 A;  1SNK A;  1AYU A;  2R6N A;  2ATO A;  4QBB A;  2YJC A;  5JH3 A;  1CPJ A;  2P0R A;  2DJG B;  1FH0 A;  1CTE A;  4QRX A;  1GEC E;  1EWO A;  2PAD A;  3H7D A;  3IUT A;  3WXG A;  1BP4 A;  2R9O A;  1GCB A;  4P6G A;  2AUX A;  2WBF X;  4CZW A;  1O0E A;  1U9X A;  3KWZ A;  2FRA A;  2HHN A;  1ITO A;  1MEG A;  1F2C A;  2BDL A;  2E03 A;  4G54 A;  4N79 A;  4YYV A;  3CBJ A;  3PW3 A;  1PCI A;  1YT7 A;  3AI8 A;  3MOR A;  4N4Z A;  4OEL A;  3U8E A;  4YYQ A;  2DZZ A;  1CB5 A;  2P7U A;  2CIO A;  1S4V A;  1TL9 A;  3QT4 A;  3KX1 A;  1PBH A;  4OEM A;  3KSE A;  4HWY A;  4FIP A;  1PE6 A;  4BS5 A;  1X9Y A;  3BCN A;  1BY8 A;  2JQF R;  5JA7 A;  2Y5B A;  2BDZ A;  4I04 A;  3QSD A;  1PXV A;  3OVZ A;  5PAD A;  1KXR A;  2G6D A;  3HD3 A;  4DMY A;  1YAL A;  1ZCM A;  1AU0 A;  1MS6 A;  3LFY A;  2OZ2 A;  3C9E A;  1AU4 A;  7PCK A;  3PBH A;  1AYV A;  4QRG A;  2B1N A;  4MZO A;  4I07 A;  1NLJ A;  3LXS A;  4AXM A;  1KFU L;  1CJL A;  4BSQ A;  2O6X A;  2DCA A;  2HXZ A;  3BOW A;  3O1G A;  3IOQ A;  1EWM A;  4YYU A;  1ICF A;  3DF0 A;  3P5V A;  5A24 A;  3GCB A;  1DEU A;  1IWD A;  1NL6 A;  5CVN B;  2NQD B;  2AUZ A;  1DF0 A;  1TLO A;  4X6I A;  1XKG A;  3P5W A;  1QDQ A;  1AYW A;  3M99 A;  2DCB A;  2XU4 A;  2NQG A;  1AU2 A;  3BPM A;  1M6D A;  3D6S A;  4YVA A;  3P5U A;  3RVV A;  2G8J A;  1BGO A;  2AYO A;  2DCD A;  2G7Y A;  4QRV A;  2E02 A;  3MHS A;  4QH6 A;  4WA6 A;  1HUC B;  4MSX A;  3MTN A;  1YVB A;  2ACT A;  2F7D A;  3TNX A;  2IPP B;  1STF E;  4BPV A;  2C0Y A;  4CDE B;  2FO5 A;  3N3G A;  4X6H A;  2AVW A;  3N4C A;  4W5C A;  2HH5 A;  3BPF A;  2DC8 A;  4CDC B;  3OF8 A;  4KLB A;  2DC9 A;  2DZY A;  1CSB B;  4BS6 A;  4Q8H A;  3B79 A;  2E01 A;  2FQ9 A;  1KHQ A;  3IEJ A;  3ERV A;  1PPD A;  1MEM A;  1VSN A;  4W4U A;  1K3B B;  2B1M A;  3O0U A;  4CDD B;  1JQP A;  3USV A;  3K9M A;  2OUL A;  1GMY A;  3OVX A;  4X6J A;  3KFQ A;  3ZUA A;  2OP3 A;  3H8B A;  5FPW A;  3N3K A;  3S3Q A;  4FJC A;  2DC6 A;  2ARY A;  3V6E A;  2NQI A;  1CQD A;  4DMX A;  2FRQ A;  4PAD A;  1QMY A;  3NHE A;  1BQI A;  2PBH A;  2VHS A;  2YJ2 A;  2YJ8 A;  2YJB A;  2JQG R;  1PPN A;  1MIR A;  4YYR A;  4CDF B;  1F2B A;  3K24 A;  5CVO B;  2XU1 A;  3F5V A;  3HHI A;  2AIM A;  1YK8 A;  2FT2 A;  3WXE A;  1EWL A;  4XUI A;  3OIS A;  1CS8 A;  1PIP A;  3F75 A;  1POP A;  2DJF B;  3BWK A;  2XU3 A;  4YV8 A;  3CH3 X;  4N8W A;  4AXL A;  1PAD A;  1AEC A;  2PNS A;  5CHT A;  1ZIV A;  1U9W A;  4PP1 A;  1NPZ A;  2DCC A;  3H6S A;  9PAP A;  1ME3 A;  2XU5 A;  4MZS A;  1VJV A;  3RVX A;  4RY2 A;  3PDF A;  3KKU A;  4YYW A;  8PCH A;  1GLO A;  1Y4H A;  2P86 A;  2DC7 A;  2FUD A;  3MHH A;  1SP4 B;  5K16 A;  4FK5 A;  3IV2 A;  1U9V A;  3HHA A;  2AYN A;  1KFX L;  4BQV A;  2R9M A;  1U5I A;  1U9Q X;  4PI3 A;  1PPP A;  5F02 A;  2Y6E A;  3PNR A;  2R9F A;  3CH2 X;  1CVZ A;  5CVM A;  4W5B A;  3OF9 A;  3E1Z B;  1EF7 A;  2HD5 A;  4ZUX U;  3HWN A;  3I06 A;  2AS8 A;  1CV8 A;  3IHP A;  2E00 A;  4K7C A;  4I05 A;  4PP2 E;  3CBK A;  2AU1 A;  1ME4 A;  1QXP A;  2H7J A;  4P6E A;  1AIM A;  1Q6K A;  1MHW A;  3KW9 A;  1YK7 A;  1Y08 A;  2IBI A;  1THE A;  3H8C A;  5EGW A;  2YJ9 A;  3KWB X;  2VHF A;  1TU6 A; 
#chains in the Genus database with same CATH topology
 5J94 A;  4Q8G A;  2AGA A;  1NB5 A;  3I3T A;  1A6R A;  2BTW A;  2R9N A;  2GFO A;  1NB3 A;  3K8U A;  3WXF A;  1NQC A;  2FYE A;  2GHU A;  3V6C A;  2NQA A;  2PRE A;  1ATK A;  3RVW A;  3P5X A;  2F1G A;  3BC3 A;  3QJ3 A;  2R9C A;  4XR7 A;  4BOU A;  3PSE A;  1KHP A;  6PAD A;  4P16 A;  2CB5 A;  1AU3 A;  3IMA A;  3H89 A;  4R3D A;  1QOL A;  3S3R A;  1EWP A;  1F2A A;  1PPO A;  4YYS A;  2FTD A;  1MDW A;  2G8E A;  1F29 A;  3O65 A;  5CHV A;  5EF4 A;  1SNK A;  1AYU A;  2R6N A;  2ATO A;  4QBB A;  2YJC A;  3RNV A;  5JH3 A;  1CPJ A;  2P0R A;  2DJG B;  3PT2 A;  1FH0 A;  3BY4 A;  1CTE A;  1GEC E;  4QRX A;  1EWO A;  2PAD A;  3H7D A;  3IUT A;  4PT5 A;  3PHU A;  1BP4 A;  3WXG A;  2R9O A;  1GCB A;  4P6G A;  3TMP A;  2AUX A;  2Z84 A;  2WBF X;  3PHW A;  3MP2 A;  4CZW A;  1O0E A;  1U9X A;  3KWZ A;  2FRA A;  2HHN A;  3MTV A;  1ITO A;  1MEG A;  1F2C A;  2BDL A;  2E03 A;  4G54 A;  4N79 A;  4ZTB A;  3E9S A;  4YYV A;  3CBJ A;  3PW3 A;  1PCI A;  1YT7 A;  4WUR A;  2DOS A;  3BBA A;  3AI8 A;  3MOR A;  4N4Z A;  2UZJ A;  2FE8 A;  4OVZ B;  4OEL A;  3U8E A;  4YYQ A;  2DZZ A;  1CB5 A;  2P7U A;  2CIO A;  1S4V A;  1TL9 A;  3QT4 A;  3KX1 A;  1PBH A;  3OQC A;  4OEM A;  3KSE A;  1YZB A;  4HWY A;  4FIP A;  1PE6 A;  4BS5 A;  1X9Y A;  3BCN A;  3PRP A;  1BY8 A;  2JQF R;  5JA7 A;  5EZQ A;  2Y5B A;  2BDZ A;  4I04 A;  3QSD A;  1PXV A;  3OVZ A;  5PAD A;  1KXR A;  2G6D A;  2HWK A;  3HD3 A;  4DMY A;  1YAL A;  1ZCM A;  1AU0 A;  4RNA A;  1MS6 A;  3LFY A;  2OZ2 A;  3C9E A;  1AU4 A;  7PCK A;  4MI7 A;  3PBH A;  1AYV A;  4QRG A;  2B1N A;  4MZO A;  4I07 A;  1NLJ A;  3LXS A;  4AXM A;  1KFU L;  1CJL A;  4BSQ A;  2O6X A;  2DCA A;  2HXZ A;  3BOW A;  3O1G A;  3IOQ A;  4REZ A;  1EWM A;  4YYU A;  1ICF A;  4RKX A;  3DF0 A;  1PVJ A;  3P5V A;  5A24 A;  3GCB A;  3IFU A;  1DEU A;  2JRI A;  1IWD A;  1NL6 A;  5CVN B;  2NQD B;  2AUZ A;  1DF0 A;  1TLO A;  4X6I A;  1XKG A;  3P5W A;  5E6J A;  1QDQ A;  1AYW A;  3M99 A;  2DCB A;  2XU4 A;  2NQG A;  1AU2 A;  3BPM A;  1M6D A;  3D6S A;  4BOZ A;  4YVA A;  4D8E A;  3P5U A;  3RVV A;  3MJ5 A;  2G8J A;  1BGO A;  4MM3 B;  2AYO A;  2DCD A;  2G7Y A;  2J7Q C;  4QRV A;  2E02 A;  1UKF A;  3ZNH A;  4XZX A;  3MHS A;  4QH6 A;  4WA6 A;  1HUC B;  3W30 A;  4MSX A;  3MTN A;  1YVB A;  4OVZ A;  2ACT A;  2F7D A;  3TNX A;  2BU3 A;  2IPP B;  1STF E;  4BPV A;  2C0Y A;  4CDE B;  2FO5 A;  3N3G A;  4X6H A;  2AVW A;  3N4C A;  4W5C A;  2HH5 A;  3BPF A;  2DC8 A;  4IUM A;  2J7Q A;  4D8B A;  5EZS A;  4CDC B;  3OF8 A;  4KLB A;  2DC9 A;  2DZY A;  1CSB B;  4BS6 A;  4Q8H A;  3B79 A;  2E01 A;  2FQ9 A;  4D8I A;  1KHQ A;  4A5U A;  3IEJ A;  3ERV A;  1PPD A;  1MEM A;  1VSN A;  4W4U A;  1K3B B;  2B1M A;  3O0U A;  4BOQ A;  4CDD B;  1JQP A;  3USV A;  3K9M A;  2OUL A;  3TRK A;  3W31 A;  1GMY A;  3OVX A;  4X6J A;  3KFQ A;  3ZUA A;  2OP3 A;  4M0W A;  3H8B A;  5FPW A;  3N3K A;  3S3Q A;  4FJC A;  4RF0 A;  2DC6 A;  2ARY A;  3V6E A;  2NQI A;  1CQD A;  4DMX A;  2FRQ A;  4PAD A;  1QMY A;  4OW0 A;  3NHE A;  1BQI A;  2PBH A;  2VHS A;  2YJ2 A;  2YJ8 A;  2YJB A;  2JQG R;  3PRM A;  4BOS A;  1PPN A;  1MIR A;  4YYR A;  3PHX A;  4CDF B;  1F2B A;  5KO3 A;  2BTW B;  3K24 A;  5CVO B;  2XU1 A;  3F5V A;  3HHI A;  1DKI A;  2AIM A;  1YK8 A;  2FT2 A;  3WXE A;  1EWL A;  4XUI A;  4BOP A;  3OIS A;  1CS8 A;  1PIP A;  4HXD B;  3F75 A;  1POP A;  2DJF B;  3BWK A;  2XU3 A;  4YV8 A;  3CH3 X;  4N8W A;  4AXL A;  3B21 A;  1PAD A;  1AEC A;  2JTC A;  2PNS A;  5CHT A;  1ZIV A;  1U9W A;  4PP1 A;  1NPZ A;  2DCC A;  3H6S A;  9PAP A;  1ME3 A;  2XU5 A;  3C0R A;  4MZS A;  1VJV A;  3RVX A;  4RY2 A;  3PDF A;  3KKU A;  4YYW A;  8PCH A;  1GLO A;  1Y4H A;  2P86 A;  2DC7 A;  2FUD A;  3MHH A;  1SP4 B;  5K16 A;  3BB7 A;  4FK5 A;  3IV2 A;  1U9V A;  3HHA A;  2AYN A;  1KFX L;  4BQV A;  4RF1 A;  2R9M A;  1U5I A;  1U9Q X;  4PI3 A;  1PPP A;  5F02 A;  2Y6E A;  3PNR A;  2R9F A;  3CH2 X;  1CVZ A;  5CVM A;  4W5B A;  3OF9 A;  3E1Z B;  1EF7 A;  2HD5 A;  4ZUX U;  3HWN A;  4IP3 A;  3I06 A;  2AS8 A;  1CV8 A;  3IHP A;  2E00 A;  4K7C A;  4I05 A;  4PP2 E;  3CBK A;  2AU1 A;  4GUA A;  1ME4 A;  1QXP A;  2H7J A;  4P6E A;  1AIM A;  1Q6K A;  1MHW A;  3KW9 A;  1YK7 A;  1Y08 A;  2IBI A;  1THE A;  3H8C A;  5EGW A;  2YJ9 A;  3KWB X;  2VHF A;  1TU6 A;  5JZE A; 
#chains in the Genus database with same CATH homology
 5J94 A;  4Q8G A;  1NB5 A;  3I3T A;  1A6R A;  2R9N A;  2GFO A;  1NB3 A;  3K8U A;  3WXF A;  1NQC A;  2BSZ A;  2FYE A;  2GHU A;  3V6C A;  2NQA A;  2PRE A;  1ATK A;  3RVW A;  3P5X A;  2F1G A;  3BC3 A;  3QJ3 A;  2R9C A;  4XR7 A;  1KHP A;  6PAD A;  2CB5 A;  1AU3 A;  3IMA A;  3H89 A;  1QOL A;  3S3R A;  1EWP A;  1F2A A;  1PPO A;  1E2T A;  4YYS A;  2FTD A;  1MDW A;  2G8E A;  1F29 A;  5CHV A;  5EF4 A;  1SNK A;  1AYU A;  2R6N A;  2ATO A;  4QBB A;  2YJC A;  5JH3 A;  1CPJ A;  2P0R A;  2DJG B;  1FH0 A;  1CTE A;  1GEC E;  4QRX A;  1EWO A;  2PAD A;  3H7D A;  3IUT A;  3WXG A;  1BP4 A;  1W5R A;  2R9O A;  1GCB A;  4P6G A;  2AUX A;  2WBF X;  4CZW A;  1O0E A;  1U9X A;  3KWZ A;  2FRA A;  2HHN A;  1ITO A;  1MEG A;  1F2C A;  2BDL A;  2E03 A;  4BGF A;  4G54 A;  4N79 A;  4YYV A;  3CBJ A;  3PW3 A;  1PCI A;  1YT7 A;  3AI8 A;  3MOR A;  4GUZ A;  4N4Z A;  4OEL A;  3U8E A;  4YYQ A;  2DZZ A;  1CB5 A;  2P7U A;  2CIO A;  1S4V A;  1TL9 A;  3QT4 A;  3KX1 A;  1PBH A;  4OEM A;  3KSE A;  4B55 A;  4HWY A;  4FIP A;  1PE6 A;  4BS5 A;  1X9Y A;  3BCN A;  1BY8 A;  2JQF R;  5JA7 A;  2Y5B A;  2BDZ A;  1GX3 A;  4I04 A;  3QSD A;  1PXV A;  3OVZ A;  5PAD A;  1KXR A;  2G6D A;  3HD3 A;  4DMY A;  1YAL A;  1ZCM A;  1AU0 A;  1MS6 A;  3LFY A;  2OZ2 A;  3C9E A;  1AU4 A;  7PCK A;  3PBH A;  1AYV A;  4QRG A;  2B1N A;  4MZO A;  4I07 A;  1NLJ A;  3LXS A;  4AXM A;  1KFU L;  1CJL A;  4BSQ A;  2O6X A;  2DCA A;  2HXZ A;  3BOW A;  3O1G A;  3IOQ A;  1EWM A;  4YYU A;  1ICF A;  3DF0 A;  3P5V A;  5A24 A;  3GCB A;  1DEU A;  1IWD A;  1NL6 A;  5CVN B;  2NQD B;  2AUZ A;  1DF0 A;  1TLO A;  4X6I A;  1XKG A;  3P5W A;  1QDQ A;  1AYW A;  3M99 A;  2DCB A;  2XU4 A;  2NQG A;  1AU2 A;  3BPM A;  1M6D A;  3D6S A;  4YVA A;  3P5U A;  3RVV A;  2G8J A;  1BGO A;  2AYO A;  2DCD A;  2G7Y A;  4QRV A;  2E02 A;  1W4T A;  3MHS A;  4QH6 A;  4WA6 A;  1HUC B;  4MSX A;  3MTN A;  1YVB A;  2ACT A;  2F7D A;  3TNX A;  2IPP B;  1STF E;  4BPV A;  2C0Y A;  4CDE B;  2FO5 A;  3N3G A;  4X6H A;  2AVW A;  3N4C A;  4W5C A;  2HH5 A;  3BPF A;  2DC8 A;  3D9W A;  4CDC B;  3OF8 A;  4KLB A;  2VFC A;  2DC9 A;  2DZY A;  1CSB B;  4BS6 A;  4Q8H A;  3B79 A;  2E01 A;  2FQ9 A;  1KHQ A;  3IEJ A;  3ERV A;  1PPD A;  1MEM A;  1VSN A;  4W4U A;  1K3B B;  2B1M A;  3O0U A;  4CDD B;  1JQP A;  3USV A;  3K9M A;  2OUL A;  1GMY A;  3OVX A;  4X6J A;  1W6F A;  3KFQ A;  2OP3 A;  3ZUA A;  3H8B A;  5FPW A;  3N3K A;  3S3Q A;  4FJC A;  2DC6 A;  2ARY A;  3V6E A;  2NQI A;  1CQD A;  4DMX A;  2FRQ A;  4PAD A;  1QMY A;  3NHE A;  1BQI A;  2PBH A;  2VHS A;  2YJ2 A;  2YJ8 A;  4C5P A;  2YJB A;  2JQG R;  1PPN A;  1MIR A;  4YYR A;  4CDF B;  1F2B A;  3K24 A;  5CVO B;  2XU1 A;  3F5V A;  3HHI A;  2AIM A;  1YK8 A;  2FT2 A;  3WXE A;  1EWL A;  4XUI A;  3OIS A;  1CS8 A;  1PIP A;  3F75 A;  1POP A;  2DJF B;  3BWK A;  2XU3 A;  2VFB A;  4YV8 A;  3CH3 X;  4N8W A;  4AXL A;  1PAD A;  1AEC A;  2PNS A;  5CHT A;  1ZIV A;  1U9W A;  4PP1 A;  1NPZ A;  2DCC A;  3H6S A;  4NV8 A;  3LTW A;  9PAP A;  1ME3 A;  2XU5 A;  4MZS A;  1VJV A;  3RVX A;  4RY2 A;  3PDF A;  3KKU A;  4YYW A;  8PCH A;  1GLO A;  1Y4H A;  2P86 A;  2DC7 A;  2FUD A;  3MHH A;  1SP4 B;  5K16 A;  4FK5 A;  3IV2 A;  4NV7 A;  1U9V A;  3HHA A;  2AYN A;  1KFX L;  4BQV A;  2R9M A;  1U5I A;  1U9Q X;  4PI3 A;  1PPP A;  5F02 A;  2Y6E A;  3PNR A;  2R9F A;  3CH2 X;  1CVZ A;  5CVM A;  4W5B A;  3OF9 A;  3E1Z B;  1EF7 A;  2HD5 A;  4ZUX U;  3HWN A;  3I06 A;  2AS8 A;  1CV8 A;  3IHP A;  2E00 A;  4K7C A;  4I05 A;  4PP2 E;  3CBK A;  2AU1 A;  1ME4 A;  1QXP A;  2H7J A;  4P6E A;  1AIM A;  1Q6K A;  1MHW A;  3KW9 A;  1YK7 A;  1Y08 A;  2IBI A;  1THE A;  3H8C A;  5EGW A;  2YJ9 A;  3KWB X;  2VHF A;  1TU6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...