1NPZA

Crystal structures of cathepsin s inhibitor complexes
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
217
structure length
217
Chain Sequence
LPDSVDWREKGCVTEVKYQGSCGACWAFSAVGALEAQLKLKTGKLVTLSAQNLVDCSTEKYGNKGCNGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYDSKYRAATCSKYTELPYGREDVLKEAVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSWGHNFGEEGYIRMARNKGNHCGIASFPSYPEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cathepsin S
publication title Specificity determinants of human cathepsin s revealed by crystal structures of complexes.
pubmed doi rcsb
molecule tags Hydrolase
total genus 68
structure length 217
sequence length 217
chains with identical sequence B
ec nomenclature ec 3.4.22.27: Cathepsin S.
pdb deposition date 2003-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1npzA00
3OF9A 3HHIA 5CHTA 2IPPB 3NHEA 1AIMA 1CTEA 3K9MA 2BDZA 3WXGA 2JQGR 2E02A 3BPFA 4OEMA 1NL6A 4FK5A 3H7DA 5J94A 2R9OA 5FPWA 1BGOA 1SP4B 1CJLA 2HHNA 1MEMA 1MS6A 2B1MA 3OF8A 3M99A 4P6EA 1IWDA 3PNRA 1PIPA 1MEGA 1CS8A 1MHWA 1GMYA 1F2BA 3ZUAA 1PBHA 2DCAA 4YV8A 4FJCA 2NQAA 4CZWA 1XKGA 3WXEA 1U5IA 2R9NA 4HWYA 2FUDA 3IUTA 3N3GA 6PADA 2DCCA 3I3TA 1ME3A 2F1GA 1KFXL 1GECE 1YK7A 2BDLA 4YYVA 5JH3A 3N3KA 3OISA 2ACTA 1YVBA 5PADA 2FQ9A 1NPZA 1PCIA 2XU1A 2PREA 2YJCA 2B1NA 1NB3A 4BQVA 4BS5A 2IBIA 2P86A 1A6RA 3E1ZB 4RY2A 1NB5A 2GHUA 3IV2A 3HWNA 3HD3A 2H7JA 4QRGA 3RVXA 3V6EA 3MTNA 5JA7A 5EF4A 2DCBA 3OVXA 3USVA 1YK8A 2AIMA 1CQDA 3MORA 1DEUA 2DC9A 2JQFR 4CDFB 3KX1A 1MDWA 2XU4A 2PBHA 4MZOA 3U8EA 2P0RA 2CIOA 3HHAA 3IHPA 1DF0A 9PAPA 2DZZA 2DC7A 3I06A 3H8CA 5A24A 1JQPA 2R9FA 2NQIA 3QJ3A 2FRQA 2DJGB 4YYWA 1NQCA 2DC6A 3BCNA 1TU6A 3P5WA 1PADA 1SNKA 3K24A 4AXLA 1U9VA 1M6DA 1QMYA 1ATKA 4BS6A 1EWLA 1BY8A 1PPNA 2ARYA 2HH5A 1EWPA 2NQGA 2YJ2A 1BQIA 3GCBA 4N8WA 3N4CA 3S3RA 1NLJA 1S4VA 2E00A 1YALA 2G7YA 3S3QA 4AXMA 2E01A 4OELA 2FRAA 1ZCMA 3PBHA 1CVZA 4N4ZA 1PPPA 2WBFX 2AYOA 3K8UA 4X6JA 3RVWA 1STFE 1VJVA 3IOQA 1TL9A 2HD5A 1THEA 2FO5A 5EGWA 2VHFA 3IMAA 2C0YA 8PCHA 3ERVA 3KWBX 3MHSA 4QBBA 3O0UA 1HUCB 4X6IA 3P5VA 2GFOA 1VSNA 4MZSA 2OP3A 2E03A 4Q8HA 3V6CA 1BP4A 1FH0A 4YYUA 3QSDA 2YJ8A 3MHHA 3O1GA 2FYEA 1QOLA 3KW9A 2DC8A 4PADA 3BPMA 1AU4A 4Q8GA 5CVMA 4PI3A 1CV8A 4ZUXU 2HXZA 2G8JA 1PPOA 3D6SA 4G54A 2Y5BA 1Y08A 2AUZA 5F02A 3KKUA 4XR7A 4W5BA 2PADA 2DZYA 2OZ2A 3KSEA 1PPDA 2PNSA 7PCKA 1EWOA 3P5UA 3TNXA 1F2CA 2G6DA 4YYSA 2AYNA 2P7UA 4K7CA 4DMXA 3LFYA 5K16A 3CH2X 2NQDB 2G8EA 2R9MA 1TLOA 1K3BB 1GCBA 4P6GA 2AUXA 4QH6A 4QRVA 4N79A 3LXSA 1EF7A 1AYVA 1QDQA 3KWZA 4PP2E 3B79A 1AECA 1ITOA 2VHSA 1Y4HA 2FT2A 1CB5A 1PE6A 1QXPA 3P5XA 1CPJA 1MIRA 2YJ9A 1F2AA 4QRXA 1X9YA 1GLOA 1EWMA 1KHQA 4X6HA 3BOWA 1U9QX 1F29A 3PW3A 2R9CA 1ICFA 2AU1A 2AVWA 4I07A 3CBJA 4XUIA 3OVZA 2XU5A 4W5CA 2O6XA 2OULA 2XU3A 1AU2A 2DCDA 3AI8A 4CDEB 3H89A 1ZIVA 3DF0A 1U9WA 5CVOB 1CSBB 1YT7A 2F7DA 4I04A 1AU3A 2Y6EA 3F75A 3C9EA 3CBKA 1POPA 2AS8A 3PDFA 2ATOA 2CB5A 4I05A 3WXFA 4CDDB 4YYRA 4W4UA 4CDCB 5CVNB 4MSXA 2FTDA 2DJFB 1AU0A 5CHVA 3F5VA 2YJBA 1PXVA 1O0EA 1AYUA 1KFUL 1AYWA 4BSQA 4BPVA 3H8BA 1Q6KA 3BC3A 2R6NA 1U9XA 4PP1A 3RVVA 1KXRA 4DMYA 3H6SA 4YVAA 1KHPA 3QT4A 3IEJA 4WA6A 1ME4A 3BWKA 3CH3X 4KLBA 4YYQA 4FIPA 3KFQA
chains in the Genus database with same CATH superfamily
3OF9A 3HHIA 5CHTA 2IPPB 3NHEA 1AIMA 2JRIA 1CTEA 3K9MA 2BDZA 3WXGA 2JQGR 3PHXA 2E02A 3BPFA 4OEMA 1NL6A 4FK5A 3H7DA 5J94A 2R9OA 5FPWA 1BGOA 1SP4B 1CJLA 3W30A 2HHNA 5EZQA 1MEMA 1MS6A 2B1MA 3OF8A 3M99A 4P6EA 1IWDA 3PNRA 1PIPA 2HWKA 1MEGA 1CS8A 1MHWA 1GMYA 1F2BA 3PSEA 3ZUAA 1PBHA 4BOPA 2DCAA 5EZSA 4YV8A 3MP2A 4FJCA 2NQAA 4CZWA 1XKGA 3WXEA 4ZTBA 1U5IA 3E9SA 2R9NA 4HWYA 2FUDA 3IUTA 3N3GA 6PADA 2DCCA 3I3TA 1ME3A 2F1GA 1KFXL 1GECE 1YK7A 2BDLA 2FE8A 4YYVA 5JH3A 3N3KA 3OISA 2ACTA 1YVBA 4OVZA 5PADA 2FQ9A 1NPZA 3TMPA 1PCIA 2XU1A 2PREA 2YJCA 2UZJA 2B1NA 4RNAA 1NB3A 4R3DA 4BQVA 4BS5A 3O65A 2IBIA 2P86A 1A6RA 3E1ZB 4RY2A 4OVZB 1NB5A 2GHUA 1PVJA 3IV2A 4PT5A 3HWNA 3HD3A 2H7JA 4QRGA 3RVXA 3V6EA 3MTNA 5JA7A 5EF4A 2DCBA 3BY4A 3OVXA 3USVA 1YK8A 2AGAA 4BOZA 2AIMA 1CQDA 3MORA 1DEUA 2J7QC 2DC9A 2JQFR 4CDFB 3KX1A 2BTWA 1MDWA 2XU4A 2PBHA 4MZOA 3U8EA 2P0RA 2CIOA 3HHAA 3IHPA 1DF0A 2JTCA 4P16A 2DZZA 9PAPA 2DC7A 3I06A 3H8CA 3PRMA 5A24A 2BU3A 1JQPA 3OQCA 2R9FA 2NQIA 3QJ3A 2FRQA 2DJGB 4XZXA 4YYWA 1NQCA 2DC6A 4MI7A 3BCNA 1TU6A 3P5WA 1PADA 1SNKA 3K24A 4AXLA 1U9VA 1M6DA 1QMYA 1ATKA 4BS6A 1EWLA 1BY8A 1PPNA 4BOUA 3RNVA 2ARYA 2HH5A 1EWPA 2NQGA 2YJ2A 1BQIA 3GCBA 4N8WA 3N4CA 3S3RA 1NLJA 1S4VA 2E00A 1YALA 3BB7A 2G7YA 3S3QA 4AXMA 2E01A 4OELA 2FRAA 1ZCMA 3PBHA 4A5UA 1CVZA 4N4ZA 3PHWA 1YZBA 1PPPA 2WBFX 2AYOA 3K8UA 4X6JA 3RVWA 1STFE 1VJVA 3MTVA 3IOQA 1TL9A 2HD5A 4REZA 4D8BA 1THEA 2FO5A 5EGWA 2VHFA 1DKIA 3IMAA 2C0YA 8PCHA 3BBAA 3ERVA 3KWBX 3MHSA 4QBBA 3O0UA 3PRPA 4D8EA 1HUCB 4X6IA 3P5VA 2GFOA 1VSNA 4MZSA 2OP3A 2E03A 4Q8HA 4OW0A 3V6CA 1BP4A 3TRKA 1FH0A 4YYUA 3QSDA 2YJ8A 3MHHA 3O1GA 2FYEA 1QOLA 3KW9A 5JZEA 2DC8A 4PADA 5KO3A 3W31A 3BPMA 4GUAA 1AU4A 4Q8GA 3C0RA 5CVMA 4PI3A 1CV8A 4ZUXU 2HXZA 4RF0A 2G8JA 1PPOA 3PHUA 3D6SA 4G54A 2Y5BA 1Y08A 2AUZA 5F02A 3KKUA 4XR7A 4W5BA 2PADA 2DZYA 4RKXA 2BTWB 2OZ2A 3KSEA 1PPDA 4IP3A 2PNSA 7PCKA 1EWOA 3P5UA 5E6JA 3TNXA 1F2CA 2G6DA 4YYSA 2AYNA 2P7UA 4WURA 4K7CA 4DMXA 3LFYA 5K16A 3CH2X 2NQDB 2G8EA 2R9MA 1TLOA 2J7QA 1K3BB 1GCBA 4P6GA 2AUXA 4QH6A 4QRVA 4N79A 3LXSA 1EF7A 1AYVA 1QDQA 3KWZA 4HXDB 4PP2E 3B79A 1AECA 2Z84A 1ITOA 2VHSA 1Y4HA 2FT2A 1CB5A 1PE6A 1QXPA 3P5XA 1CPJA 1MIRA 2YJ9A 1F2AA 3MJ5A 4QRXA 2DOSA 3B21A 1X9YA 1GLOA 1EWMA 1KHQA 4X6HA 3BOWA 1U9QX 1F29A 4BOSA 3PW3A 2R9CA 1UKFA 1ICFA 2AU1A 2AVWA 4I07A 4BOQA 3CBJA 4XUIA 4M0WA 3OVZA 2XU5A 4W5CA 2O6XA 2OULA 2XU3A 1AU2A 2DCDA 3AI8A 4CDEB 3H89A 1ZIVA 3DF0A 4MM3B 1U9WA 5CVOB 1CSBB 1YT7A 2F7DA 4I04A 1AU3A 2Y6EA 3F75A 3ZNHA 3C9EA 3CBKA 1POPA 2AS8A 3PDFA 2ATOA 2CB5A 4I05A 3WXFA 4CDDB 4YYRA 4W4UA 4CDCB 5CVNB 4MSXA 2FTDA 3IFUA 2DJFB 1AU0A 5CHVA 3F5VA 2YJBA 1PXVA 1O0EA 1AYUA 1KFUL 1AYWA 4BSQA 4BPVA 3H8BA 3PT2A 1Q6KA 3BC3A 2R6NA 1U9XA 4PP1A 3RVVA 1KXRA 4DMYA 3H6SA 4YVAA 1KHPA 4IUMA 3QT4A 3IEJA 4RF1A 4WA6A 1ME4A 4D8IA 3BWKA 3CH3X 4KLBA 4YYQA 4FIPA 3KFQA
chains in the Genus database with same CATH topology
3OF9A 3HHIA 5CHTA 2IPPB 3NHEA 1AIMA 1CTEA 3K9MA 4BGFA 2VFBA 2BDZA 3WXGA 2JQGR 2E02A 3BPFA 4OEMA 1NL6A 4FK5A 1W4TA 3H7DA 5J94A 2R9OA 5FPWA 1BGOA 1SP4B 1CJLA 2HHNA 1E2TA 1MEMA 1MS6A 2B1MA 1W5RA 3OF8A 3M99A 4C5PA 4P6EA 1IWDA 3PNRA 1PIPA 1MEGA 1CS8A 1MHWA 1GMYA 1F2BA 3ZUAA 1PBHA 2DCAA 4YV8A 4FJCA 2NQAA 4CZWA 1XKGA 3WXEA 1U5IA 2R9NA 4HWYA 2FUDA 3IUTA 3N3GA 6PADA 2DCCA 3I3TA 1ME3A 2F1GA 1KFXL 1GECE 1YK7A 2BDLA 4YYVA 5JH3A 3N3KA 3OISA 2ACTA 1YVBA 5PADA 2FQ9A 1NPZA 1PCIA 2XU1A 2PREA 2YJCA 2B1NA 1NB3A 4BQVA 4BS5A 2IBIA 2P86A 1A6RA 3E1ZB 4RY2A 1NB5A 2GHUA 3IV2A 3HWNA 3HD3A 2H7JA 4QRGA 3RVXA 3V6EA 3MTNA 5JA7A 5EF4A 2DCBA 3OVXA 3USVA 1YK8A 2AIMA 1CQDA 3MORA 1DEUA 2DC9A 2JQFR 4CDFB 3KX1A 1MDWA 2XU4A 2PBHA 4MZOA 3U8EA 2P0RA 2CIOA 3HHAA 3IHPA 1DF0A 9PAPA 2DZZA 2DC7A 3I06A 4NV7A 3H8CA 5A24A 1JQPA 2R9FA 2NQIA 3QJ3A 2FRQA 2DJGB 4YYWA 1NQCA 2DC6A 3BCNA 1TU6A 3P5WA 1PADA 1SNKA 3K24A 4AXLA 1U9VA 1M6DA 1QMYA 1ATKA 4BS6A 1EWLA 1BY8A 1PPNA 2ARYA 2HH5A 1EWPA 2NQGA 2YJ2A 1BQIA 3GCBA 4N8WA 2BSZA 3N4CA 3S3RA 1NLJA 1S4VA 2E00A 1YALA 2G7YA 3S3QA 4AXMA 2E01A 4OELA 2FRAA 1ZCMA 3PBHA 1CVZA 4N4ZA 1PPPA 2WBFX 2AYOA 3K8UA 4X6JA 3RVWA 1STFE 1VJVA 3IOQA 1TL9A 2HD5A 1THEA 2FO5A 5EGWA 2VHFA 3IMAA 2C0YA 8PCHA 1GX3A 3ERVA 3KWBX 3MHSA 4QBBA 3O0UA 1HUCB 4X6IA 3P5VA 2GFOA 1VSNA 4MZSA 2OP3A 2E03A 4Q8HA 3V6CA 1BP4A 1FH0A 4YYUA 3QSDA 2YJ8A 3MHHA 3O1GA 2FYEA 1QOLA 3KW9A 2DC8A 4PADA 3BPMA 1AU4A 4Q8GA 5CVMA 4PI3A 1CV8A 4ZUXU 2HXZA 2G8JA 1PPOA 3D6SA 4G54A 2Y5BA 1Y08A 2AUZA 5F02A 3KKUA 4XR7A 4W5BA 2PADA 2DZYA 2OZ2A 3KSEA 1PPDA 3LTWA 2PNSA 7PCKA 1EWOA 3P5UA 1W6FA 3TNXA 1F2CA 2G6DA 4YYSA 2AYNA 2P7UA 4K7CA 4DMXA 3LFYA 5K16A 3CH2X 2NQDB 2G8EA 2R9MA 1TLOA 1K3BB 1GCBA 4P6GA 2AUXA 4QH6A 4QRVA 4N79A 3LXSA 1EF7A 1AYVA 1QDQA 3KWZA 4PP2E 3B79A 1AECA 1ITOA 2VHSA 1Y4HA 2FT2A 1CB5A 1PE6A 1QXPA 3P5XA 1CPJA 1MIRA 2YJ9A 1F2AA 4QRXA 1X9YA 1GLOA 1EWMA 1KHQA 4X6HA 2VFCA 3BOWA 1U9QX 1F29A 3PW3A 2R9CA 1ICFA 3D9WA 2AU1A 2AVWA 4I07A 4B55A 3CBJA 4XUIA 3OVZA 2XU5A 4W5CA 2O6XA 2OULA 2XU3A 4GUZA 1AU2A 2DCDA 3AI8A 4CDEB 3H89A 1ZIVA 3DF0A 1U9WA 4NV8A 5CVOB 1CSBB 1YT7A 2F7DA 4I04A 1AU3A 2Y6EA 3F75A 3C9EA 3CBKA 1POPA 2AS8A 3PDFA 2ATOA 2CB5A 4I05A 3WXFA 4CDDB 4YYRA 4W4UA 4CDCB 5CVNB 4MSXA 2FTDA 2DJFB 1AU0A 5CHVA 3F5VA 2YJBA 1PXVA 1O0EA 1AYUA 1KFUL 1AYWA 4BSQA 4BPVA 3H8BA 1Q6KA 3BC3A 2R6NA 1U9XA 4PP1A 3RVVA 1KXRA 4DMYA 3H6SA 4YVAA 1KHPA 3QT4A 3IEJA 4WA6A 1ME4A 3BWKA 3CH3X 4KLBA 4YYQA 4FIPA 3KFQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OF9 A;  3HHI A;  5CHT A;  2IPP B;  3NHE A;  1AIM A;  1CTE A;  3K9M A;  2BDZ A;  3WXG A;  2JQG R;  2E02 A;  3BPF A;  4OEM A;  1NL6 A;  4FK5 A;  3H7D A;  5J94 A;  2R9O A;  5FPW A;  1BGO A;  1SP4 B;  1CJL A;  2HHN A;  1MEM A;  1MS6 A;  2B1M A;  3OF8 A;  3M99 A;  4P6E A;  1IWD A;  3PNR A;  1PIP A;  1MEG A;  1CS8 A;  1MHW A;  1GMY A;  1F2B A;  3ZUA A;  1PBH A;  2DCA A;  4YV8 A;  4FJC A;  2NQA A;  4CZW A;  1XKG A;  3WXE A;  1U5I A;  2R9N A;  4HWY A;  2FUD A;  3IUT A;  3N3G A;  6PAD A;  2DCC A;  3I3T A;  1ME3 A;  2F1G A;  1KFX L;  1GEC E;  1YK7 A;  2BDL A;  4YYV A;  5JH3 A;  3N3K A;  3OIS A;  2ACT A;  1YVB A;  5PAD A;  2FQ9 A;  1NPZ A;  1PCI A;  2XU1 A;  2PRE A;  2YJC A;  2B1N A;  1NB3 A;  4BQV A;  4BS5 A;  2IBI A;  2P86 A;  1A6R A;  3E1Z B;  4RY2 A;  1NB5 A;  2GHU A;  3IV2 A;  3HWN A;  3HD3 A;  2H7J A;  4QRG A;  3RVX A;  3V6E A;  3MTN A;  5JA7 A;  5EF4 A;  2DCB A;  3OVX A;  3USV A;  1YK8 A;  2AIM A;  1CQD A;  3MOR A;  1DEU A;  2DC9 A;  2JQF R;  4CDF B;  3KX1 A;  1MDW A;  2XU4 A;  2PBH A;  4MZO A;  3U8E A;  2P0R A;  2CIO A;  3HHA A;  3IHP A;  1DF0 A;  9PAP A;  2DZZ A;  2DC7 A;  3I06 A;  3H8C A;  5A24 A;  1JQP A;  2R9F A;  2NQI A;  3QJ3 A;  2FRQ A;  2DJG B;  4YYW A;  1NQC A;  2DC6 A;  3BCN A;  1TU6 A;  3P5W A;  1PAD A;  1SNK A;  3K24 A;  4AXL A;  1U9V A;  1M6D A;  1QMY A;  1ATK A;  4BS6 A;  1EWL A;  1BY8 A;  1PPN A;  2ARY A;  2HH5 A;  1EWP A;  2NQG A;  2YJ2 A;  1BQI A;  3GCB A;  4N8W A;  3N4C A;  3S3R A;  1NLJ A;  1S4V A;  2E00 A;  1YAL A;  2G7Y A;  3S3Q A;  4AXM A;  2E01 A;  4OEL A;  2FRA A;  1ZCM A;  3PBH A;  1CVZ A;  4N4Z A;  1PPP A;  2WBF X;  2AYO A;  3K8U A;  4X6J A;  3RVW A;  1STF E;  1VJV A;  3IOQ A;  1TL9 A;  2HD5 A;  1THE A;  2FO5 A;  5EGW A;  2VHF A;  3IMA A;  2C0Y A;  8PCH A;  3ERV A;  3KWB X;  3MHS A;  4QBB A;  3O0U A;  1HUC B;  4X6I A;  3P5V A;  2GFO A;  1VSN A;  4MZS A;  2OP3 A;  2E03 A;  4Q8H A;  3V6C A;  1BP4 A;  1FH0 A;  4YYU A;  3QSD A;  2YJ8 A;  3MHH A;  3O1G A;  2FYE A;  1QOL A;  3KW9 A;  2DC8 A;  4PAD A;  3BPM A;  1AU4 A;  4Q8G A;  5CVM A;  4PI3 A;  1CV8 A;  4ZUX U;  2HXZ A;  2G8J A;  1PPO A;  3D6S A;  4G54 A;  2Y5B A;  1Y08 A;  2AUZ A;  5F02 A;  3KKU A;  4XR7 A;  4W5B A;  2PAD A;  2DZY A;  2OZ2 A;  3KSE A;  1PPD A;  2PNS A;  7PCK A;  1EWO A;  3P5U A;  3TNX A;  1F2C A;  2G6D A;  4YYS A;  2AYN A;  2P7U A;  4K7C A;  4DMX A;  3LFY A;  5K16 A;  3CH2 X;  2NQD B;  2G8E A;  2R9M A;  1TLO A;  1K3B B;  1GCB A;  4P6G A;  2AUX A;  4QH6 A;  4QRV A;  4N79 A;  3LXS A;  1EF7 A;  1AYV A;  1QDQ A;  3KWZ A;  4PP2 E;  3B79 A;  1AEC A;  1ITO A;  2VHS A;  1Y4H A;  2FT2 A;  1CB5 A;  1PE6 A;  1QXP A;  3P5X A;  1CPJ A;  1MIR A;  2YJ9 A;  1F2A A;  4QRX A;  1X9Y A;  1GLO A;  1EWM A;  1KHQ A;  4X6H A;  3BOW A;  1U9Q X;  1F29 A;  3PW3 A;  2R9C A;  1ICF A;  2AU1 A;  2AVW A;  4I07 A;  3CBJ A;  4XUI A;  3OVZ A;  2XU5 A;  4W5C A;  2O6X A;  2OUL A;  2XU3 A;  1AU2 A;  2DCD A;  3AI8 A;  4CDE B;  3H89 A;  1ZIV A;  3DF0 A;  1U9W A;  5CVO B;  1CSB B;  1YT7 A;  2F7D A;  4I04 A;  1AU3 A;  2Y6E A;  3F75 A;  3C9E A;  3CBK A;  1POP A;  2AS8 A;  3PDF A;  2ATO A;  2CB5 A;  4I05 A;  3WXF A;  4CDD B;  4YYR A;  4W4U A;  4CDC B;  5CVN B;  4MSX A;  2FTD A;  2DJF B;  1AU0 A;  5CHV A;  3F5V A;  2YJB A;  1PXV A;  1O0E A;  1AYU A;  1KFU L;  1AYW A;  4BSQ A;  4BPV A;  3H8B A;  1Q6K A;  3BC3 A;  2R6N A;  1U9X A;  4PP1 A;  3RVV A;  1KXR A;  4DMY A;  3H6S A;  4YVA A;  1KHP A;  3QT4 A;  3IEJ A;  4WA6 A;  1ME4 A;  3BWK A;  3CH3 X;  4KLB A;  4YYQ A;  4FIP A;  3KFQ A; 
#chains in the Genus database with same CATH topology
 3OF9 A;  3HHI A;  5CHT A;  2IPP B;  3NHE A;  1AIM A;  2JRI A;  1CTE A;  3K9M A;  2BDZ A;  3WXG A;  2JQG R;  3PHX A;  2E02 A;  3BPF A;  4OEM A;  1NL6 A;  4FK5 A;  3H7D A;  5J94 A;  2R9O A;  5FPW A;  1BGO A;  1SP4 B;  1CJL A;  3W30 A;  2HHN A;  5EZQ A;  1MEM A;  1MS6 A;  2B1M A;  3OF8 A;  3M99 A;  4P6E A;  1IWD A;  3PNR A;  1PIP A;  2HWK A;  1MEG A;  1CS8 A;  1MHW A;  1GMY A;  1F2B A;  3PSE A;  3ZUA A;  1PBH A;  4BOP A;  2DCA A;  5EZS A;  4YV8 A;  3MP2 A;  4FJC A;  2NQA A;  4CZW A;  1XKG A;  3WXE A;  4ZTB A;  1U5I A;  3E9S A;  2R9N A;  4HWY A;  2FUD A;  3IUT A;  3N3G A;  6PAD A;  2DCC A;  3I3T A;  1ME3 A;  2F1G A;  1KFX L;  1GEC E;  1YK7 A;  2BDL A;  2FE8 A;  4YYV A;  5JH3 A;  3N3K A;  3OIS A;  2ACT A;  1YVB A;  4OVZ A;  5PAD A;  2FQ9 A;  1NPZ A;  3TMP A;  1PCI A;  2XU1 A;  2PRE A;  2YJC A;  2UZJ A;  2B1N A;  4RNA A;  1NB3 A;  4R3D A;  4BQV A;  4BS5 A;  3O65 A;  2IBI A;  2P86 A;  1A6R A;  3E1Z B;  4RY2 A;  4OVZ B;  1NB5 A;  2GHU A;  1PVJ A;  3IV2 A;  4PT5 A;  3HWN A;  3HD3 A;  2H7J A;  4QRG A;  3RVX A;  3V6E A;  3MTN A;  5JA7 A;  5EF4 A;  2DCB A;  3BY4 A;  3OVX A;  3USV A;  1YK8 A;  2AGA A;  4BOZ A;  2AIM A;  1CQD A;  3MOR A;  1DEU A;  2J7Q C;  2DC9 A;  2JQF R;  4CDF B;  3KX1 A;  2BTW A;  1MDW A;  2XU4 A;  2PBH A;  4MZO A;  3U8E A;  2P0R A;  2CIO A;  3HHA A;  3IHP A;  1DF0 A;  2JTC A;  4P16 A;  2DZZ A;  9PAP A;  2DC7 A;  3I06 A;  3H8C A;  3PRM A;  5A24 A;  2BU3 A;  1JQP A;  3OQC A;  2R9F A;  2NQI A;  3QJ3 A;  2FRQ A;  2DJG B;  4XZX A;  4YYW A;  1NQC A;  2DC6 A;  4MI7 A;  3BCN A;  1TU6 A;  3P5W A;  1PAD A;  1SNK A;  3K24 A;  4AXL A;  1U9V A;  1M6D A;  1QMY A;  1ATK A;  4BS6 A;  1EWL A;  1BY8 A;  1PPN A;  4BOU A;  3RNV A;  2ARY A;  2HH5 A;  1EWP A;  2NQG A;  2YJ2 A;  1BQI A;  3GCB A;  4N8W A;  3N4C A;  3S3R A;  1NLJ A;  1S4V A;  2E00 A;  1YAL A;  3BB7 A;  2G7Y A;  3S3Q A;  4AXM A;  2E01 A;  4OEL A;  2FRA A;  1ZCM A;  3PBH A;  4A5U A;  1CVZ A;  4N4Z A;  3PHW A;  1YZB A;  1PPP A;  2WBF X;  2AYO A;  3K8U A;  4X6J A;  3RVW A;  1STF E;  1VJV A;  3MTV A;  3IOQ A;  1TL9 A;  2HD5 A;  4REZ A;  4D8B A;  1THE A;  2FO5 A;  5EGW A;  2VHF A;  1DKI A;  3IMA A;  2C0Y A;  8PCH A;  3BBA A;  3ERV A;  3KWB X;  3MHS A;  4QBB A;  3O0U A;  3PRP A;  4D8E A;  1HUC B;  4X6I A;  3P5V A;  2GFO A;  1VSN A;  4MZS A;  2OP3 A;  2E03 A;  4Q8H A;  4OW0 A;  3V6C A;  1BP4 A;  3TRK A;  1FH0 A;  4YYU A;  3QSD A;  2YJ8 A;  3MHH A;  3O1G A;  2FYE A;  1QOL A;  3KW9 A;  5JZE A;  2DC8 A;  4PAD A;  5KO3 A;  3W31 A;  3BPM A;  4GUA A;  1AU4 A;  4Q8G A;  3C0R A;  5CVM A;  4PI3 A;  1CV8 A;  4ZUX U;  2HXZ A;  4RF0 A;  2G8J A;  1PPO A;  3PHU A;  3D6S A;  4G54 A;  2Y5B A;  1Y08 A;  2AUZ A;  5F02 A;  3KKU A;  4XR7 A;  4W5B A;  2PAD A;  2DZY A;  4RKX A;  2BTW B;  2OZ2 A;  3KSE A;  1PPD A;  4IP3 A;  2PNS A;  7PCK A;  1EWO A;  3P5U A;  5E6J A;  3TNX A;  1F2C A;  2G6D A;  4YYS A;  2AYN A;  2P7U A;  4WUR A;  4K7C A;  4DMX A;  3LFY A;  5K16 A;  3CH2 X;  2NQD B;  2G8E A;  2R9M A;  1TLO A;  2J7Q A;  1K3B B;  1GCB A;  4P6G A;  2AUX A;  4QH6 A;  4QRV A;  4N79 A;  3LXS A;  1EF7 A;  1AYV A;  1QDQ A;  3KWZ A;  4HXD B;  4PP2 E;  3B79 A;  1AEC A;  2Z84 A;  1ITO A;  2VHS A;  1Y4H A;  2FT2 A;  1CB5 A;  1PE6 A;  1QXP A;  3P5X A;  1CPJ A;  1MIR A;  2YJ9 A;  1F2A A;  3MJ5 A;  4QRX A;  2DOS A;  3B21 A;  1X9Y A;  1GLO A;  1EWM A;  1KHQ A;  4X6H A;  3BOW A;  1U9Q X;  1F29 A;  4BOS A;  3PW3 A;  2R9C A;  1UKF A;  1ICF A;  2AU1 A;  2AVW A;  4I07 A;  4BOQ A;  3CBJ A;  4XUI A;  4M0W A;  3OVZ A;  2XU5 A;  4W5C A;  2O6X A;  2OUL A;  2XU3 A;  1AU2 A;  2DCD A;  3AI8 A;  4CDE B;  3H89 A;  1ZIV A;  3DF0 A;  4MM3 B;  1U9W A;  5CVO B;  1CSB B;  1YT7 A;  2F7D A;  4I04 A;  1AU3 A;  2Y6E A;  3F75 A;  3ZNH A;  3C9E A;  3CBK A;  1POP A;  2AS8 A;  3PDF A;  2ATO A;  2CB5 A;  4I05 A;  3WXF A;  4CDD B;  4YYR A;  4W4U A;  4CDC B;  5CVN B;  4MSX A;  2FTD A;  3IFU A;  2DJF B;  1AU0 A;  5CHV A;  3F5V A;  2YJB A;  1PXV A;  1O0E A;  1AYU A;  1KFU L;  1AYW A;  4BSQ A;  4BPV A;  3H8B A;  3PT2 A;  1Q6K A;  3BC3 A;  2R6N A;  1U9X A;  4PP1 A;  3RVV A;  1KXR A;  4DMY A;  3H6S A;  4YVA A;  1KHP A;  4IUM A;  3QT4 A;  3IEJ A;  4RF1 A;  4WA6 A;  1ME4 A;  4D8I A;  3BWK A;  3CH3 X;  4KLB A;  4YYQ A;  4FIP A;  3KFQ A; 
#chains in the Genus database with same CATH homology
 3OF9 A;  3HHI A;  5CHT A;  2IPP B;  3NHE A;  1AIM A;  1CTE A;  3K9M A;  4BGF A;  2VFB A;  2BDZ A;  3WXG A;  2JQG R;  2E02 A;  3BPF A;  4OEM A;  1NL6 A;  4FK5 A;  1W4T A;  3H7D A;  5J94 A;  2R9O A;  5FPW A;  1BGO A;  1SP4 B;  1CJL A;  2HHN A;  1E2T A;  1MEM A;  1MS6 A;  2B1M A;  1W5R A;  3OF8 A;  3M99 A;  4C5P A;  4P6E A;  1IWD A;  3PNR A;  1PIP A;  1MEG A;  1CS8 A;  1MHW A;  1GMY A;  1F2B A;  3ZUA A;  1PBH A;  2DCA A;  4YV8 A;  4FJC A;  2NQA A;  4CZW A;  1XKG A;  3WXE A;  1U5I A;  2R9N A;  4HWY A;  2FUD A;  3IUT A;  3N3G A;  6PAD A;  2DCC A;  3I3T A;  1ME3 A;  2F1G A;  1KFX L;  1GEC E;  1YK7 A;  2BDL A;  4YYV A;  5JH3 A;  3N3K A;  3OIS A;  2ACT A;  1YVB A;  5PAD A;  2FQ9 A;  1NPZ A;  1PCI A;  2XU1 A;  2PRE A;  2YJC A;  2B1N A;  1NB3 A;  4BQV A;  4BS5 A;  2IBI A;  2P86 A;  1A6R A;  3E1Z B;  4RY2 A;  1NB5 A;  2GHU A;  3IV2 A;  3HWN A;  3HD3 A;  2H7J A;  4QRG A;  3RVX A;  3V6E A;  3MTN A;  5JA7 A;  5EF4 A;  2DCB A;  3OVX A;  3USV A;  1YK8 A;  2AIM A;  1CQD A;  3MOR A;  1DEU A;  2DC9 A;  2JQF R;  4CDF B;  3KX1 A;  1MDW A;  2XU4 A;  2PBH A;  4MZO A;  3U8E A;  2P0R A;  2CIO A;  3HHA A;  3IHP A;  1DF0 A;  9PAP A;  2DZZ A;  2DC7 A;  3I06 A;  4NV7 A;  3H8C A;  5A24 A;  1JQP A;  2R9F A;  2NQI A;  3QJ3 A;  2FRQ A;  2DJG B;  4YYW A;  1NQC A;  2DC6 A;  3BCN A;  1TU6 A;  3P5W A;  1PAD A;  1SNK A;  3K24 A;  4AXL A;  1U9V A;  1M6D A;  1QMY A;  1ATK A;  4BS6 A;  1EWL A;  1BY8 A;  1PPN A;  2ARY A;  2HH5 A;  1EWP A;  2NQG A;  2YJ2 A;  1BQI A;  3GCB A;  4N8W A;  2BSZ A;  3N4C A;  3S3R A;  1NLJ A;  1S4V A;  2E00 A;  1YAL A;  2G7Y A;  3S3Q A;  4AXM A;  2E01 A;  4OEL A;  2FRA A;  1ZCM A;  3PBH A;  1CVZ A;  4N4Z A;  1PPP A;  2WBF X;  2AYO A;  3K8U A;  4X6J A;  3RVW A;  1STF E;  1VJV A;  3IOQ A;  1TL9 A;  2HD5 A;  1THE A;  2FO5 A;  5EGW A;  2VHF A;  3IMA A;  2C0Y A;  8PCH A;  1GX3 A;  3ERV A;  3KWB X;  3MHS A;  4QBB A;  3O0U A;  1HUC B;  4X6I A;  3P5V A;  2GFO A;  1VSN A;  4MZS A;  2OP3 A;  2E03 A;  4Q8H A;  3V6C A;  1BP4 A;  1FH0 A;  4YYU A;  3QSD A;  2YJ8 A;  3MHH A;  3O1G A;  2FYE A;  1QOL A;  3KW9 A;  2DC8 A;  4PAD A;  3BPM A;  1AU4 A;  4Q8G A;  5CVM A;  4PI3 A;  1CV8 A;  4ZUX U;  2HXZ A;  2G8J A;  1PPO A;  3D6S A;  4G54 A;  2Y5B A;  1Y08 A;  2AUZ A;  5F02 A;  3KKU A;  4XR7 A;  4W5B A;  2PAD A;  2DZY A;  2OZ2 A;  3KSE A;  1PPD A;  3LTW A;  2PNS A;  7PCK A;  1EWO A;  3P5U A;  1W6F A;  3TNX A;  1F2C A;  2G6D A;  4YYS A;  2AYN A;  2P7U A;  4K7C A;  4DMX A;  3LFY A;  5K16 A;  3CH2 X;  2NQD B;  2G8E A;  2R9M A;  1TLO A;  1K3B B;  1GCB A;  4P6G A;  2AUX A;  4QH6 A;  4QRV A;  4N79 A;  3LXS A;  1EF7 A;  1AYV A;  1QDQ A;  3KWZ A;  4PP2 E;  3B79 A;  1AEC A;  1ITO A;  2VHS A;  1Y4H A;  2FT2 A;  1CB5 A;  1PE6 A;  1QXP A;  3P5X A;  1CPJ A;  1MIR A;  2YJ9 A;  1F2A A;  4QRX A;  1X9Y A;  1GLO A;  1EWM A;  1KHQ A;  4X6H A;  2VFC A;  3BOW A;  1U9Q X;  1F29 A;  3PW3 A;  2R9C A;  1ICF A;  3D9W A;  2AU1 A;  2AVW A;  4I07 A;  4B55 A;  3CBJ A;  4XUI A;  3OVZ A;  2XU5 A;  4W5C A;  2O6X A;  2OUL A;  2XU3 A;  4GUZ A;  1AU2 A;  2DCD A;  3AI8 A;  4CDE B;  3H89 A;  1ZIV A;  3DF0 A;  1U9W A;  4NV8 A;  5CVO B;  1CSB B;  1YT7 A;  2F7D A;  4I04 A;  1AU3 A;  2Y6E A;  3F75 A;  3C9E A;  3CBK A;  1POP A;  2AS8 A;  3PDF A;  2ATO A;  2CB5 A;  4I05 A;  3WXF A;  4CDD B;  4YYR A;  4W4U A;  4CDC B;  5CVN B;  4MSX A;  2FTD A;  2DJF B;  1AU0 A;  5CHV A;  3F5V A;  2YJB A;  1PXV A;  1O0E A;  1AYU A;  1KFU L;  1AYW A;  4BSQ A;  4BPV A;  3H8B A;  1Q6K A;  3BC3 A;  2R6N A;  1U9X A;  4PP1 A;  3RVV A;  1KXR A;  4DMY A;  3H6S A;  4YVA A;  1KHP A;  3QT4 A;  3IEJ A;  4WA6 A;  1ME4 A;  3BWK A;  3CH3 X;  4KLB A;  4YYQ A;  4FIP A;  3KFQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...