3KWZA

Cathepsin k in complex with a non-selective 2-cyano-pyrimidine inhibitor
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
215
structure length
215
Chain Sequence
APDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cathepsin K
publication title Design and optimization of a series of novel 2-cyano-pyrimidines as cathepsin K inhibitors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 62
structure length 215
sequence length 215
ec nomenclature ec 3.4.22.38: Cathepsin K.
pdb deposition date 2009-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3kwzA00
1TU6A 4QRXA 1AYWA 1TL9A 1AYVA 1Y4HA 5EGWA 4W5BA 1YT7A 4QH6A 1PXVA 1S4VA 3I3TA 3IEJA 1AECA 1SP4B 3BWKA 3OF9A 2PBHA 1CPJA 2BDZA 2XU5A 1IWDA 1KXRA 2PREA 4QBBA 1FH0A 1DEUA 4N4ZA 1TLOA 2AS8A 2R9CA 6PADA 4DMYA 1XKGA 4OEMA 3K9MA 4P6GA 2DCBA 3V6EA 3BC3A 2CIOA 2JQFR 3IV2A 1PBHA 2G8EA 3P5VA 2F1GA 4X6HA 1BY8A 5CVMA 4MZSA 4YYVA 1M6DA 4YV8A 1NB5A 2VHSA 3GCBA 1QOLA 4PI3A 3S3RA 3KW9A 2C0YA 1KHPA 1KFXL 3I06A 1QMYA 4MZOA 2FQ9A 1KHQA 1HUCB 2YJ9A 3KWBX 1U9QX 1F2CA 2BDLA 3V6CA 3H8BA 1MEMA 2DCDA 4BS6A 4QRGA 1NB3A 4PADA 4YYUA 3LXSA 1PIPA 1QDQA 5CVNB 2B1NA 1BP4A 4YYSA 3PBHA 2FTDA 2GFOA 3CBKA 3H6SA 1AU4A 1PPOA 1CQDA 1MHWA 1PCIA 4MSXA 3QT4A 1VJVA 3RVVA 2DJFB 1EWPA 4QRVA 4N8WA 1PADA 1F2BA 2FUDA 4Q8GA 4FK5A 4W5CA 1A6RA 1YK7A 1CVZA 4YYWA 3WXFA 3K24A 3M99A 1ATKA 2FRQA 2YJ8A 4CDCB 3HHIA 3OISA 2B1MA 3PNRA 2Y6EA 2P86A 3N3GA 3F75A 3KX1A 1GMYA 2AYNA 3PDFA 4G54A 2DC6A 3TNXA 2G7YA 2DC7A 2AVWA 2GHUA 2JQGR 4CDFB 3H8CA 2PNSA 2NQDB 3IHPA 1PE6A 2AUXA 2R9NA 3RVXA 2FO5A 3KFQA 3C9EA 2P7UA 1QXPA 1MDWA 3BCNA 3S3QA 2WBFX 2DCAA 3P5UA 3P5WA 3OVZA 1THEA 1CV8A 3ERVA 3O0UA 4N79A 3NHEA 2HXZA 1EF7A 1PPDA 1EWMA 1AIMA 1ZIVA 2Y5BA 1MS6A 1PPPA 4PP1A 3QJ3A 1STFE 3N4CA 4BS5A 1JQPA 3H89A 3PW3A 1AU3A 4XUIA 2DCCA 4YYRA 9PAPA 3HD3A 1MEGA 2AUZA 2AIMA 1AYUA 5JA7A 5K16A 2R9FA 3CH3X 2G8JA 4AXMA 2FT2A 3ZUAA 2FYEA 4ZUXU 2R9MA 2YJBA 3MORA 4BSQA 3BOWA 3D6SA 2VHFA 4FIPA 4I07A 3N3KA 3OVXA 4I04A 4CDEB 1POPA 2ARYA 1ICFA 4W4UA 4BPVA 2F7DA 4CZWA 3WXEA 1ITOA 1DF0A 3E1ZB 3IMAA 2OP3A 1GLOA 4AXLA 2HD5A 2NQAA 2P0RA 4Q8HA 2YJCA 2OULA 3AI8A 2O6XA 1CS8A 3MTNA 3H7DA 5JH3A 3F5VA 4KLBA 2E02A 2ATOA 1CTEA 1YK8A 3P5XA 1SNKA 4OELA 8PCHA 2HHNA 4X6IA 2R9OA 3HWNA 1YVBA 4RY2A 2OZ2A 2XU3A 3KWZA 3KSEA 1U9VA 2G6DA 3USVA 4PP2E 4YVAA 1Y08A 2ACTA 1AU0A 3CBJA 2AU1A 1VSNA 3IUTA 1NQCA 1O0EA 2R6NA 1F29A 1KFUL 3K8UA 1CSBB 2DZZA 4DMXA 3QSDA 3B79A 1ZCMA 3O1GA 4P6EA 3BPMA 3MHSA 4XR7A 2PADA 1NPZA 2NQGA 2XU4A 3IOQA 1AU2A 3LFYA 3HHAA 5CVOB 1YALA 7PCKA 4BQVA 2IPPB 2DC8A 1NLJA 3BPFA 4X6JA 1CJLA 1K3BB 2CB5A 3U8EA 3CH2X 2HH5A 4I05A 5J94A 3WXGA 4FJCA 1F2AA 3DF0A 1ME4A 1BGOA 5F02A 1EWOA 2E00A 1PPNA 4HWYA 3KKUA 4K7CA 2NQIA 2E01A 1GCBA 5CHVA 2DJGB 2FRAA 5FPWA 1BQIA 5A24A 1NL6A 1MIRA 2AYOA 3OF8A 5PADA 1U5IA 3MHHA 2DZYA 1EWLA 5CHTA 1X9YA 2H7JA 5EF4A 3RVWA 2YJ2A 1GECE 1ME3A 2E03A 2XU1A 2IBIA 4WA6A 1Q6KA 1U9XA 4CDDB 4YYQA 2DC9A 1U9WA 1CB5A
chains in the Genus database with same CATH superfamily
1TU6A 4QRXA 1AYWA 1TL9A 1AYVA 1Y4HA 5EGWA 4W5BA 1YT7A 4QH6A 1PXVA 3PHWA 1S4VA 3I3TA 3IEJA 1AECA 1SP4B 3BWKA 4IUMA 3OF9A 2PBHA 4RF0A 1CPJA 2BDZA 2XU5A 1IWDA 1KXRA 2PREA 4QBBA 1FH0A 1DEUA 4N4ZA 1TLOA 4HXDB 2AS8A 2R9CA 6PADA 3BBAA 4DMYA 1XKGA 4OEMA 3K9MA 4P6GA 2DCBA 2Z84A 3V6EA 3E9SA 5E6JA 3BC3A 4R3DA 2CIOA 2JQFR 3IV2A 4BOSA 1PBHA 2G8EA 3P5VA 2F1GA 4X6HA 1BY8A 5CVMA 4MZSA 4YYVA 4REZA 1M6DA 4YV8A 4BOQA 1PVJA 1NB5A 2VHSA 3GCBA 1QOLA 3PRPA 4PI3A 3S3RA 3KW9A 2C0YA 1KHPA 1KFXL 3I06A 1QMYA 4MZOA 2FQ9A 1KHQA 1HUCB 2YJ9A 3KWBX 1U9QX 4D8IA 1F2CA 2BDLA 3V6CA 3H8BA 1MEMA 2DCDA 4BS6A 4QRGA 1NB3A 4PADA 4YYUA 3PT2A 3LXSA 1PIPA 1QDQA 5CVNB 2B1NA 1BP4A 3PHUA 4YYSA 3PBHA 2FTDA 2GFOA 3CBKA 3H6SA 1AU4A 1PPOA 4WURA 1CQDA 1MHWA 4RKXA 1PCIA 3ZNHA 4MSXA 3QT4A 1VJVA 3RVVA 4MM3B 2DJFB 2BTWA 2DOSA 1EWPA 4QRVA 4N8WA 1PADA 1F2BA 2FUDA 4Q8GA 4FK5A 4W5CA 1A6RA 1YK7A 1CVZA 4YYWA 3WXFA 3K24A 3M99A 3O65A 4A5UA 1ATKA 2FRQA 2YJ8A 4CDCB 3HHIA 3OISA 2B1MA 3PNRA 2Y6EA 2P86A 3N3GA 3F75A 3KX1A 1GMYA 2AYNA 3PDFA 4G54A 2DC6A 3TNXA 2G7YA 2DC7A 2AVWA 4IP3A 2GHUA 2JQGR 4CDFB 3H8CA 2PNSA 2NQDB 3IHPA 1PE6A 2AUXA 2AGAA 2J7QA 2R9NA 3PHXA 5EZQA 3RVXA 2FO5A 3KFQA 3C9EA 3PSEA 2P7UA 1QXPA 1MDWA 3BCNA 2FE8A 3S3QA 2WBFX 2DCAA 3PRMA 3P5UA 3P5WA 3OVZA 1THEA 1CV8A 3ERVA 3O0UA 4N79A 3NHEA 2HWKA 2HXZA 1EF7A 1PPDA 1EWMA 1AIMA 1ZIVA 2Y5BA 1MS6A 1PPPA 4PP1A 3TRKA 3QJ3A 1STFE 3N4CA 3W31A 4BS5A 2JTCA 1JQPA 3H89A 3PW3A 1AU3A 4D8EA 3BY4A 4XUIA 2DCCA 4YYRA 3C0RA 9PAPA 3HD3A 1MEGA 2AUZA 2AIMA 1AYUA 5EZSA 5JA7A 5K16A 2R9FA 5JZEA 3CH3X 2G8JA 4AXMA 2FT2A 3TMPA 3ZUAA 2FYEA 4ZUXU 2R9MA 2YJBA 3MORA 4BSQA 3BOWA 3W30A 3D6SA 3MJ5A 3MTVA 2VHFA 4FIPA 4I07A 3N3KA 3OVXA 4I04A 4CDEB 1POPA 2ARYA 1ICFA 4W4UA 4BPVA 2F7DA 4CZWA 3WXEA 1ITOA 1DF0A 3E1ZB 3IMAA 4BOZA 2OP3A 1GLOA 4AXLA 2HD5A 2NQAA 4M0WA 2P0RA 4Q8HA 2YJCA 2OULA 3AI8A 2O6XA 1CS8A 3MTNA 4OVZB 3H7DA 5KO3A 2J7QC 5JH3A 3F5VA 4KLBA 2E02A 2ATOA 1CTEA 4OVZA 1YK8A 3P5XA 1SNKA 4OELA 8PCHA 2HHNA 4X6IA 2R9OA 3HWNA 1YVBA 3BB7A 4RY2A 2JRIA 2OZ2A 4MI7A 2XU3A 4P16A 3KWZA 3KSEA 1U9VA 2G6DA 4RNAA 3USVA 4PP2E 4YVAA 1Y08A 3IFUA 2ACTA 1AU0A 3CBJA 2AU1A 4BOUA 1VSNA 3IUTA 1NQCA 1O0EA 2R6NA 1F29A 1KFUL 3K8UA 1CSBB 2DZZA 4DMXA 2BU3A 3QSDA 3B79A 1ZCMA 3O1GA 4P6EA 3OQCA 3BPMA 3MHSA 4XR7A 2PADA 1NPZA 2NQGA 4GUAA 2XU4A 3IOQA 1AU2A 3LFYA 3HHAA 5CVOB 1YALA 7PCKA 4BQVA 2IPPB 2DC8A 1NLJA 3BPFA 4X6JA 1CJLA 1K3BB 2CB5A 3U8EA 3CH2X 2HH5A 4I05A 5J94A 1DKIA 3B21A 3WXGA 4FJCA 1F2AA 3DF0A 3RNVA 1ME4A 1BGOA 5F02A 1EWOA 4OW0A 2E00A 1PPNA 2UZJA 4HWYA 4BOPA 3KKUA 4K7CA 2NQIA 2E01A 1GCBA 5CHVA 4RF1A 1UKFA 1YZBA 2DJGB 2FRAA 5FPWA 1BQIA 4XZXA 5A24A 1NL6A 1MIRA 2AYOA 3OF8A 5PADA 1U5IA 3MHHA 2DZYA 1EWLA 3MP2A 5CHTA 4D8BA 1X9YA 2H7JA 4PT5A 5EF4A 3RVWA 2BTWB 2YJ2A 1GECE 1ME3A 2E03A 2XU1A 2IBIA 4WA6A 1Q6KA 1U9XA 4CDDB 4YYQA 2DC9A 1U9WA 1CB5A 4ZTBA
chains in the Genus database with same CATH topology
1TU6A 4QRXA 1AYWA 1TL9A 1AYVA 1Y4HA 5EGWA 4W5BA 1YT7A 4QH6A 1PXVA 1S4VA 3I3TA 3IEJA 1AECA 1SP4B 3BWKA 3OF9A 2PBHA 4C5PA 1CPJA 2BDZA 2XU5A 2VFCA 1IWDA 1KXRA 1GX3A 2PREA 4QBBA 1FH0A 1DEUA 4N4ZA 1TLOA 2AS8A 2R9CA 6PADA 4DMYA 1XKGA 4OEMA 3K9MA 4P6GA 2DCBA 3V6EA 3BC3A 2CIOA 2JQFR 3IV2A 1PBHA 2G8EA 3P5VA 2F1GA 4X6HA 1BY8A 1E2TA 5CVMA 4MZSA 4YYVA 1M6DA 4YV8A 1NB5A 2VHSA 3GCBA 4B55A 1QOLA 1W6FA 4PI3A 3S3RA 3KW9A 2C0YA 1KHPA 1KFXL 3I06A 1QMYA 4MZOA 2FQ9A 1KHQA 1HUCB 2YJ9A 3KWBX 1U9QX 4GUZA 1F2CA 2BDLA 3V6CA 3H8BA 1MEMA 2DCDA 4BS6A 4QRGA 1NB3A 4PADA 4YYUA 3LXSA 1PIPA 1QDQA 5CVNB 2B1NA 1BP4A 4YYSA 3PBHA 2FTDA 2GFOA 3CBKA 4NV7A 3H6SA 1AU4A 1PPOA 1CQDA 1MHWA 1PCIA 4MSXA 3QT4A 1VJVA 3RVVA 2DJFB 1EWPA 4QRVA 4N8WA 1PADA 1F2BA 2FUDA 4Q8GA 4FK5A 4W5CA 1A6RA 1YK7A 1CVZA 4YYWA 3WXFA 3K24A 3M99A 1ATKA 2FRQA 2YJ8A 4CDCB 3HHIA 3OISA 2B1MA 3PNRA 2Y6EA 2P86A 3N3GA 3F75A 3KX1A 1GMYA 2AYNA 3PDFA 4G54A 2DC6A 3TNXA 2G7YA 2DC7A 2AVWA 2GHUA 2JQGR 4CDFB 3H8CA 2PNSA 2NQDB 3IHPA 1PE6A 2AUXA 2R9NA 3RVXA 2FO5A 3KFQA 3C9EA 2P7UA 1QXPA 1MDWA 3BCNA 3S3QA 2WBFX 2DCAA 3P5UA 3P5WA 3OVZA 1THEA 1CV8A 3ERVA 3O0UA 4N79A 3NHEA 2HXZA 1EF7A 1PPDA 1EWMA 1AIMA 1ZIVA 2Y5BA 1MS6A 1PPPA 4PP1A 3QJ3A 1STFE 3N4CA 4BS5A 1JQPA 3H89A 2VFBA 3PW3A 1AU3A 4XUIA 2DCCA 4YYRA 9PAPA 3HD3A 1MEGA 2AUZA 2AIMA 1AYUA 5JA7A 5K16A 2R9FA 3CH3X 2G8JA 4AXMA 2FT2A 3ZUAA 4NV8A 2FYEA 4ZUXU 2R9MA 2YJBA 3MORA 4BSQA 3BOWA 3D6SA 2VHFA 4FIPA 4I07A 3N3KA 3OVXA 4I04A 4CDEB 1POPA 2ARYA 1ICFA 4W4UA 4BPVA 2F7DA 4CZWA 3WXEA 1ITOA 1DF0A 3LTWA 3E1ZB 3IMAA 2OP3A 1GLOA 4AXLA 2HD5A 2NQAA 2P0RA 4Q8HA 2YJCA 2OULA 3AI8A 2O6XA 1CS8A 3MTNA 3H7DA 5JH3A 3F5VA 4KLBA 2E02A 2ATOA 1CTEA 1YK8A 3P5XA 1SNKA 4OELA 8PCHA 2HHNA 4X6IA 2R9OA 3HWNA 1YVBA 4RY2A 2OZ2A 2XU3A 3KWZA 3KSEA 1U9VA 2G6DA 3USVA 4PP2E 4YVAA 1Y08A 2ACTA 1AU0A 3CBJA 2AU1A 1VSNA 1W5RA 3D9WA 3IUTA 1NQCA 1O0EA 2R6NA 1F29A 1KFUL 3K8UA 1CSBB 2DZZA 4DMXA 3QSDA 3B79A 1ZCMA 3O1GA 4P6EA 3BPMA 3MHSA 4XR7A 2PADA 1NPZA 2NQGA 2XU4A 3IOQA 1AU2A 3LFYA 3HHAA 5CVOB 1YALA 7PCKA 4BQVA 2IPPB 2DC8A 1NLJA 3BPFA 4X6JA 1CJLA 1K3BB 2CB5A 3U8EA 3CH2X 2HH5A 4I05A 5J94A 3WXGA 4FJCA 1F2AA 3DF0A 1ME4A 1BGOA 5F02A 1EWOA 2E00A 1PPNA 4HWYA 4BGFA 3KKUA 4K7CA 2NQIA 2E01A 1GCBA 5CHVA 2DJGB 2FRAA 1W4TA 5FPWA 1BQIA 5A24A 1NL6A 1MIRA 2AYOA 3OF8A 5PADA 1U5IA 3MHHA 2DZYA 1EWLA 5CHTA 1X9YA 2H7JA 2BSZA 5EF4A 3RVWA 2YJ2A 1GECE 1ME3A 2E03A 2XU1A 2IBIA 4WA6A 1Q6KA 1U9XA 4CDDB 4YYQA 2DC9A 1U9WA 1CB5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TU6 A;  4QRX A;  1AYW A;  1TL9 A;  1AYV A;  1Y4H A;  5EGW A;  4W5B A;  1YT7 A;  4QH6 A;  1PXV A;  1S4V A;  3I3T A;  3IEJ A;  1AEC A;  1SP4 B;  3BWK A;  3OF9 A;  2PBH A;  1CPJ A;  2BDZ A;  2XU5 A;  1IWD A;  1KXR A;  2PRE A;  4QBB A;  1FH0 A;  1DEU A;  4N4Z A;  1TLO A;  2AS8 A;  2R9C A;  6PAD A;  4DMY A;  1XKG A;  4OEM A;  3K9M A;  4P6G A;  2DCB A;  3V6E A;  3BC3 A;  2CIO A;  2JQF R;  3IV2 A;  1PBH A;  2G8E A;  3P5V A;  2F1G A;  4X6H A;  1BY8 A;  5CVM A;  4MZS A;  4YYV A;  1M6D A;  4YV8 A;  1NB5 A;  2VHS A;  3GCB A;  1QOL A;  4PI3 A;  3S3R A;  3KW9 A;  2C0Y A;  1KHP A;  1KFX L;  3I06 A;  1QMY A;  4MZO A;  2FQ9 A;  1KHQ A;  1HUC B;  2YJ9 A;  3KWB X;  1U9Q X;  1F2C A;  2BDL A;  3V6C A;  3H8B A;  1MEM A;  2DCD A;  4BS6 A;  4QRG A;  1NB3 A;  4PAD A;  4YYU A;  3LXS A;  1PIP A;  1QDQ A;  5CVN B;  2B1N A;  1BP4 A;  4YYS A;  3PBH A;  2FTD A;  2GFO A;  3CBK A;  3H6S A;  1AU4 A;  1PPO A;  1CQD A;  1MHW A;  1PCI A;  4MSX A;  3QT4 A;  1VJV A;  3RVV A;  2DJF B;  1EWP A;  4QRV A;  4N8W A;  1PAD A;  1F2B A;  2FUD A;  4Q8G A;  4FK5 A;  4W5C A;  1A6R A;  1YK7 A;  1CVZ A;  4YYW A;  3WXF A;  3K24 A;  3M99 A;  1ATK A;  2FRQ A;  2YJ8 A;  4CDC B;  3HHI A;  3OIS A;  2B1M A;  3PNR A;  2Y6E A;  2P86 A;  3N3G A;  3F75 A;  3KX1 A;  1GMY A;  2AYN A;  3PDF A;  4G54 A;  2DC6 A;  3TNX A;  2G7Y A;  2DC7 A;  2AVW A;  2GHU A;  2JQG R;  4CDF B;  3H8C A;  2PNS A;  2NQD B;  3IHP A;  1PE6 A;  2AUX A;  2R9N A;  3RVX A;  2FO5 A;  3KFQ A;  3C9E A;  2P7U A;  1QXP A;  1MDW A;  3BCN A;  3S3Q A;  2WBF X;  2DCA A;  3P5U A;  3P5W A;  3OVZ A;  1THE A;  1CV8 A;  3ERV A;  3O0U A;  4N79 A;  3NHE A;  2HXZ A;  1EF7 A;  1PPD A;  1EWM A;  1AIM A;  1ZIV A;  2Y5B A;  1MS6 A;  1PPP A;  4PP1 A;  3QJ3 A;  1STF E;  3N4C A;  4BS5 A;  1JQP A;  3H89 A;  3PW3 A;  1AU3 A;  4XUI A;  2DCC A;  4YYR A;  9PAP A;  3HD3 A;  1MEG A;  2AUZ A;  2AIM A;  1AYU A;  5JA7 A;  5K16 A;  2R9F A;  3CH3 X;  2G8J A;  4AXM A;  2FT2 A;  3ZUA A;  2FYE A;  4ZUX U;  2R9M A;  2YJB A;  3MOR A;  4BSQ A;  3BOW A;  3D6S A;  2VHF A;  4FIP A;  4I07 A;  3N3K A;  3OVX A;  4I04 A;  4CDE B;  1POP A;  2ARY A;  1ICF A;  4W4U A;  4BPV A;  2F7D A;  4CZW A;  3WXE A;  1ITO A;  1DF0 A;  3E1Z B;  3IMA A;  2OP3 A;  1GLO A;  4AXL A;  2HD5 A;  2NQA A;  2P0R A;  4Q8H A;  2YJC A;  2OUL A;  3AI8 A;  2O6X A;  1CS8 A;  3MTN A;  3H7D A;  5JH3 A;  3F5V A;  4KLB A;  2E02 A;  2ATO A;  1CTE A;  1YK8 A;  3P5X A;  1SNK A;  4OEL A;  8PCH A;  2HHN A;  4X6I A;  2R9O A;  3HWN A;  1YVB A;  4RY2 A;  2OZ2 A;  2XU3 A;  3KWZ A;  3KSE A;  1U9V A;  2G6D A;  3USV A;  4PP2 E;  4YVA A;  1Y08 A;  2ACT A;  1AU0 A;  3CBJ A;  2AU1 A;  1VSN A;  3IUT A;  1NQC A;  1O0E A;  2R6N A;  1F29 A;  1KFU L;  3K8U A;  1CSB B;  2DZZ A;  4DMX A;  3QSD A;  3B79 A;  1ZCM A;  3O1G A;  4P6E A;  3BPM A;  3MHS A;  4XR7 A;  2PAD A;  1NPZ A;  2NQG A;  2XU4 A;  3IOQ A;  1AU2 A;  3LFY A;  3HHA A;  5CVO B;  1YAL A;  7PCK A;  4BQV A;  2IPP B;  2DC8 A;  1NLJ A;  3BPF A;  4X6J A;  1CJL A;  1K3B B;  2CB5 A;  3U8E A;  3CH2 X;  2HH5 A;  4I05 A;  5J94 A;  3WXG A;  4FJC A;  1F2A A;  3DF0 A;  1ME4 A;  1BGO A;  5F02 A;  1EWO A;  2E00 A;  1PPN A;  4HWY A;  3KKU A;  4K7C A;  2NQI A;  2E01 A;  1GCB A;  5CHV A;  2DJG B;  2FRA A;  5FPW A;  1BQI A;  5A24 A;  1NL6 A;  1MIR A;  2AYO A;  3OF8 A;  5PAD A;  1U5I A;  3MHH A;  2DZY A;  1EWL A;  5CHT A;  1X9Y A;  2H7J A;  5EF4 A;  3RVW A;  2YJ2 A;  1GEC E;  1ME3 A;  2E03 A;  2XU1 A;  2IBI A;  4WA6 A;  1Q6K A;  1U9X A;  4CDD B;  4YYQ A;  2DC9 A;  1U9W A;  1CB5 A; 
#chains in the Genus database with same CATH topology
 1TU6 A;  4QRX A;  1AYW A;  1TL9 A;  1AYV A;  1Y4H A;  5EGW A;  4W5B A;  1YT7 A;  4QH6 A;  1PXV A;  3PHW A;  1S4V A;  3I3T A;  3IEJ A;  1AEC A;  1SP4 B;  3BWK A;  4IUM A;  3OF9 A;  2PBH A;  4RF0 A;  1CPJ A;  2BDZ A;  2XU5 A;  1IWD A;  1KXR A;  2PRE A;  4QBB A;  1FH0 A;  1DEU A;  4N4Z A;  1TLO A;  4HXD B;  2AS8 A;  2R9C A;  6PAD A;  3BBA A;  4DMY A;  1XKG A;  4OEM A;  3K9M A;  4P6G A;  2DCB A;  2Z84 A;  3V6E A;  3E9S A;  5E6J A;  3BC3 A;  4R3D A;  2CIO A;  2JQF R;  3IV2 A;  4BOS A;  1PBH A;  2G8E A;  3P5V A;  2F1G A;  4X6H A;  1BY8 A;  5CVM A;  4MZS A;  4YYV A;  4REZ A;  1M6D A;  4YV8 A;  4BOQ A;  1PVJ A;  1NB5 A;  2VHS A;  3GCB A;  1QOL A;  3PRP A;  4PI3 A;  3S3R A;  3KW9 A;  2C0Y A;  1KHP A;  1KFX L;  3I06 A;  1QMY A;  4MZO A;  2FQ9 A;  1KHQ A;  1HUC B;  2YJ9 A;  3KWB X;  1U9Q X;  4D8I A;  1F2C A;  2BDL A;  3V6C A;  3H8B A;  1MEM A;  2DCD A;  4BS6 A;  4QRG A;  1NB3 A;  4PAD A;  4YYU A;  3PT2 A;  3LXS A;  1PIP A;  1QDQ A;  5CVN B;  2B1N A;  1BP4 A;  3PHU A;  4YYS A;  3PBH A;  2FTD A;  2GFO A;  3CBK A;  3H6S A;  1AU4 A;  1PPO A;  4WUR A;  1CQD A;  1MHW A;  4RKX A;  1PCI A;  3ZNH A;  4MSX A;  3QT4 A;  1VJV A;  3RVV A;  4MM3 B;  2DJF B;  2BTW A;  2DOS A;  1EWP A;  4QRV A;  4N8W A;  1PAD A;  1F2B A;  2FUD A;  4Q8G A;  4FK5 A;  4W5C A;  1A6R A;  1YK7 A;  1CVZ A;  4YYW A;  3WXF A;  3K24 A;  3M99 A;  3O65 A;  4A5U A;  1ATK A;  2FRQ A;  2YJ8 A;  4CDC B;  3HHI A;  3OIS A;  2B1M A;  3PNR A;  2Y6E A;  2P86 A;  3N3G A;  3F75 A;  3KX1 A;  1GMY A;  2AYN A;  3PDF A;  4G54 A;  2DC6 A;  3TNX A;  2G7Y A;  2DC7 A;  2AVW A;  4IP3 A;  2GHU A;  2JQG R;  4CDF B;  3H8C A;  2PNS A;  2NQD B;  3IHP A;  1PE6 A;  2AUX A;  2AGA A;  2J7Q A;  2R9N A;  3PHX A;  5EZQ A;  3RVX A;  2FO5 A;  3KFQ A;  3C9E A;  3PSE A;  2P7U A;  1QXP A;  1MDW A;  3BCN A;  2FE8 A;  3S3Q A;  2WBF X;  2DCA A;  3PRM A;  3P5U A;  3P5W A;  3OVZ A;  1THE A;  1CV8 A;  3ERV A;  3O0U A;  4N79 A;  3NHE A;  2HWK A;  2HXZ A;  1EF7 A;  1PPD A;  1EWM A;  1AIM A;  1ZIV A;  2Y5B A;  1MS6 A;  1PPP A;  4PP1 A;  3TRK A;  3QJ3 A;  1STF E;  3N4C A;  3W31 A;  4BS5 A;  2JTC A;  1JQP A;  3H89 A;  3PW3 A;  1AU3 A;  4D8E A;  3BY4 A;  4XUI A;  2DCC A;  4YYR A;  3C0R A;  9PAP A;  3HD3 A;  1MEG A;  2AUZ A;  2AIM A;  1AYU A;  5EZS A;  5JA7 A;  5K16 A;  2R9F A;  5JZE A;  3CH3 X;  2G8J A;  4AXM A;  2FT2 A;  3TMP A;  3ZUA A;  2FYE A;  4ZUX U;  2R9M A;  2YJB A;  3MOR A;  4BSQ A;  3BOW A;  3W30 A;  3D6S A;  3MJ5 A;  3MTV A;  2VHF A;  4FIP A;  4I07 A;  3N3K A;  3OVX A;  4I04 A;  4CDE B;  1POP A;  2ARY A;  1ICF A;  4W4U A;  4BPV A;  2F7D A;  4CZW A;  3WXE A;  1ITO A;  1DF0 A;  3E1Z B;  3IMA A;  4BOZ A;  2OP3 A;  1GLO A;  4AXL A;  2HD5 A;  2NQA A;  4M0W A;  2P0R A;  4Q8H A;  2YJC A;  2OUL A;  3AI8 A;  2O6X A;  1CS8 A;  3MTN A;  4OVZ B;  3H7D A;  5KO3 A;  2J7Q C;  5JH3 A;  3F5V A;  4KLB A;  2E02 A;  2ATO A;  1CTE A;  4OVZ A;  1YK8 A;  3P5X A;  1SNK A;  4OEL A;  8PCH A;  2HHN A;  4X6I A;  2R9O A;  3HWN A;  1YVB A;  3BB7 A;  4RY2 A;  2JRI A;  2OZ2 A;  4MI7 A;  2XU3 A;  4P16 A;  3KWZ A;  3KSE A;  1U9V A;  2G6D A;  4RNA A;  3USV A;  4PP2 E;  4YVA A;  1Y08 A;  3IFU A;  2ACT A;  1AU0 A;  3CBJ A;  2AU1 A;  4BOU A;  1VSN A;  3IUT A;  1NQC A;  1O0E A;  2R6N A;  1F29 A;  1KFU L;  3K8U A;  1CSB B;  2DZZ A;  4DMX A;  2BU3 A;  3QSD A;  3B79 A;  1ZCM A;  3O1G A;  4P6E A;  3OQC A;  3BPM A;  3MHS A;  4XR7 A;  2PAD A;  1NPZ A;  2NQG A;  4GUA A;  2XU4 A;  3IOQ A;  1AU2 A;  3LFY A;  3HHA A;  5CVO B;  1YAL A;  7PCK A;  4BQV A;  2IPP B;  2DC8 A;  1NLJ A;  3BPF A;  4X6J A;  1CJL A;  1K3B B;  2CB5 A;  3U8E A;  3CH2 X;  2HH5 A;  4I05 A;  5J94 A;  1DKI A;  3B21 A;  3WXG A;  4FJC A;  1F2A A;  3DF0 A;  3RNV A;  1ME4 A;  1BGO A;  5F02 A;  1EWO A;  4OW0 A;  2E00 A;  1PPN A;  2UZJ A;  4HWY A;  4BOP A;  3KKU A;  4K7C A;  2NQI A;  2E01 A;  1GCB A;  5CHV A;  4RF1 A;  1UKF A;  1YZB A;  2DJG B;  2FRA A;  5FPW A;  1BQI A;  4XZX A;  5A24 A;  1NL6 A;  1MIR A;  2AYO A;  3OF8 A;  5PAD A;  1U5I A;  3MHH A;  2DZY A;  1EWL A;  3MP2 A;  5CHT A;  4D8B A;  1X9Y A;  2H7J A;  4PT5 A;  5EF4 A;  3RVW A;  2BTW B;  2YJ2 A;  1GEC E;  1ME3 A;  2E03 A;  2XU1 A;  2IBI A;  4WA6 A;  1Q6K A;  1U9X A;  4CDD B;  4YYQ A;  2DC9 A;  1U9W A;  1CB5 A;  4ZTB A; 
#chains in the Genus database with same CATH homology
 1TU6 A;  4QRX A;  1AYW A;  1TL9 A;  1AYV A;  1Y4H A;  5EGW A;  4W5B A;  1YT7 A;  4QH6 A;  1PXV A;  1S4V A;  3I3T A;  3IEJ A;  1AEC A;  1SP4 B;  3BWK A;  3OF9 A;  2PBH A;  4C5P A;  1CPJ A;  2BDZ A;  2XU5 A;  2VFC A;  1IWD A;  1KXR A;  1GX3 A;  2PRE A;  4QBB A;  1FH0 A;  1DEU A;  4N4Z A;  1TLO A;  2AS8 A;  2R9C A;  6PAD A;  4DMY A;  1XKG A;  4OEM A;  3K9M A;  4P6G A;  2DCB A;  3V6E A;  3BC3 A;  2CIO A;  2JQF R;  3IV2 A;  1PBH A;  2G8E A;  3P5V A;  2F1G A;  4X6H A;  1BY8 A;  1E2T A;  5CVM A;  4MZS A;  4YYV A;  1M6D A;  4YV8 A;  1NB5 A;  2VHS A;  3GCB A;  4B55 A;  1QOL A;  1W6F A;  4PI3 A;  3S3R A;  3KW9 A;  2C0Y A;  1KHP A;  1KFX L;  3I06 A;  1QMY A;  4MZO A;  2FQ9 A;  1KHQ A;  1HUC B;  2YJ9 A;  3KWB X;  1U9Q X;  4GUZ A;  1F2C A;  2BDL A;  3V6C A;  3H8B A;  1MEM A;  2DCD A;  4BS6 A;  4QRG A;  1NB3 A;  4PAD A;  4YYU A;  3LXS A;  1PIP A;  1QDQ A;  5CVN B;  2B1N A;  1BP4 A;  4YYS A;  3PBH A;  2FTD A;  2GFO A;  3CBK A;  4NV7 A;  3H6S A;  1AU4 A;  1PPO A;  1CQD A;  1MHW A;  1PCI A;  4MSX A;  3QT4 A;  1VJV A;  3RVV A;  2DJF B;  1EWP A;  4QRV A;  4N8W A;  1PAD A;  1F2B A;  2FUD A;  4Q8G A;  4FK5 A;  4W5C A;  1A6R A;  1YK7 A;  1CVZ A;  4YYW A;  3WXF A;  3K24 A;  3M99 A;  1ATK A;  2FRQ A;  2YJ8 A;  4CDC B;  3HHI A;  3OIS A;  2B1M A;  3PNR A;  2Y6E A;  2P86 A;  3N3G A;  3F75 A;  3KX1 A;  1GMY A;  2AYN A;  3PDF A;  4G54 A;  2DC6 A;  3TNX A;  2G7Y A;  2DC7 A;  2AVW A;  2GHU A;  2JQG R;  4CDF B;  3H8C A;  2PNS A;  2NQD B;  3IHP A;  1PE6 A;  2AUX A;  2R9N A;  3RVX A;  2FO5 A;  3KFQ A;  3C9E A;  2P7U A;  1QXP A;  1MDW A;  3BCN A;  3S3Q A;  2WBF X;  2DCA A;  3P5U A;  3P5W A;  3OVZ A;  1THE A;  1CV8 A;  3ERV A;  3O0U A;  4N79 A;  3NHE A;  2HXZ A;  1EF7 A;  1PPD A;  1EWM A;  1AIM A;  1ZIV A;  2Y5B A;  1MS6 A;  1PPP A;  4PP1 A;  3QJ3 A;  1STF E;  3N4C A;  4BS5 A;  1JQP A;  3H89 A;  2VFB A;  3PW3 A;  1AU3 A;  4XUI A;  2DCC A;  4YYR A;  9PAP A;  3HD3 A;  1MEG A;  2AUZ A;  2AIM A;  1AYU A;  5JA7 A;  5K16 A;  2R9F A;  3CH3 X;  2G8J A;  4AXM A;  2FT2 A;  3ZUA A;  4NV8 A;  2FYE A;  4ZUX U;  2R9M A;  2YJB A;  3MOR A;  4BSQ A;  3BOW A;  3D6S A;  2VHF A;  4FIP A;  4I07 A;  3N3K A;  3OVX A;  4I04 A;  4CDE B;  1POP A;  2ARY A;  1ICF A;  4W4U A;  4BPV A;  2F7D A;  4CZW A;  3WXE A;  1ITO A;  1DF0 A;  3LTW A;  3E1Z B;  3IMA A;  2OP3 A;  1GLO A;  4AXL A;  2HD5 A;  2NQA A;  2P0R A;  4Q8H A;  2YJC A;  2OUL A;  3AI8 A;  2O6X A;  1CS8 A;  3MTN A;  3H7D A;  5JH3 A;  3F5V A;  4KLB A;  2E02 A;  2ATO A;  1CTE A;  1YK8 A;  3P5X A;  1SNK A;  4OEL A;  8PCH A;  2HHN A;  4X6I A;  2R9O A;  3HWN A;  1YVB A;  4RY2 A;  2OZ2 A;  2XU3 A;  3KWZ A;  3KSE A;  1U9V A;  2G6D A;  3USV A;  4PP2 E;  4YVA A;  1Y08 A;  2ACT A;  1AU0 A;  3CBJ A;  2AU1 A;  1VSN A;  1W5R A;  3D9W A;  3IUT A;  1NQC A;  1O0E A;  2R6N A;  1F29 A;  1KFU L;  3K8U A;  1CSB B;  2DZZ A;  4DMX A;  3QSD A;  3B79 A;  1ZCM A;  3O1G A;  4P6E A;  3BPM A;  3MHS A;  4XR7 A;  2PAD A;  1NPZ A;  2NQG A;  2XU4 A;  3IOQ A;  1AU2 A;  3LFY A;  3HHA A;  5CVO B;  1YAL A;  7PCK A;  4BQV A;  2IPP B;  2DC8 A;  1NLJ A;  3BPF A;  4X6J A;  1CJL A;  1K3B B;  2CB5 A;  3U8E A;  3CH2 X;  2HH5 A;  4I05 A;  5J94 A;  3WXG A;  4FJC A;  1F2A A;  3DF0 A;  1ME4 A;  1BGO A;  5F02 A;  1EWO A;  2E00 A;  1PPN A;  4HWY A;  4BGF A;  3KKU A;  4K7C A;  2NQI A;  2E01 A;  1GCB A;  5CHV A;  2DJG B;  2FRA A;  1W4T A;  5FPW A;  1BQI A;  5A24 A;  1NL6 A;  1MIR A;  2AYO A;  3OF8 A;  5PAD A;  1U5I A;  3MHH A;  2DZY A;  1EWL A;  5CHT A;  1X9Y A;  2H7J A;  2BSZ A;  5EF4 A;  3RVW A;  2YJ2 A;  1GEC E;  1ME3 A;  2E03 A;  2XU1 A;  2IBI A;  4WA6 A;  1Q6K A;  1U9X A;  4CDD B;  4YYQ A;  2DC9 A;  1U9W A;  1CB5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...