3KWZA

Cathepsin k in complex with a non-selective 2-cyano-pyrimidine inhibitor
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
215
structure length
215
Chain Sequence
APDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design and optimization of a series of novel 2-cyano-pyrimidines as cathepsin K inhibitors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Cathepsin K
total genus 62
structure length 215
sequence length 215
ec nomenclature ec 3.4.22.38: Cathepsin K.
pdb deposition date 2009-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3kwzA00
3CBKA 1DF0A 2YJ9A 2OULA 1CVZA 5CVMA 4AXMA 2NQIA 3CH2X 3PW3A 1VJVA 2ACTA 1AU2A 1PIPA 1PPDA 4XUIA 2FO5A 2FRAA 1GECE 4N79A 5JA7A 1NB5A 1DEUA 1ME3A 3HWNA 3I06A 1A6RA 2G8EA 4CDCB 2FT2A 3BPFA 4W5BA 3P5WA 2P0RA 2XU1A 1PADA 1FH0A 3NHEA 2P7UA 3H7DA 1SNKA 4W5CA 1XKGA 1F29A 2R9CA 3V6EA 4BSQA 4YVAA 3TNXA 1U5IA 4P6EA 1PE6A 3KWZA 2P86A 3IOQA 2GFOA 1EWMA 2B1MA 2DC6A 1CJLA 2HHNA 2NQGA 2IPPB 4QBBA 2H7JA 4QRVA 4YYWA 1STFE 2HXZA 4MZSA 3K9MA 1F2CA 3IMAA 1JQPA 4FJCA 2PBHA 3F75A 4DMXA 2R9MA 3QSDA 1QDQA 1Y08A 2BDLA 1MIRA 1AYUA 3MORA 4BPVA 1CTEA 1F2BA 1PPNA 2G7YA 3P5UA 4CZWA 4Q8GA 1X9YA 3HHIA 4RY2A 3S3QA 1ATKA 2AYNA 3O0UA 1Q6KA 3WXGA 5CVNB 4W4UA 3WXFA 1EWLA 4PP2E 3IHPA 2AVWA 1BQIA 4CDDB 2DCCA 3HHAA 1K3BB 5J94A 1ICFA 2CB5A 2DJFB 4OEMA 5EGWA 1POPA 3F5VA 2VHFA 3ZUAA 3N3GA 3M99A 2JQFR 4YYSA 1KFUL 1MS6A 1U9XA 3LFYA 1QXPA 3IEJA 2Y6EA 4CDEB 2DCAA 3K8UA 4MZOA 1ZIVA 3V6CA 1CB5A 2AUZA 4G54A 4K7CA 2DZYA 2XU4A 2GHUA 3KX1A 1TU6A 2G6DA 2AS8A 1ZCMA 1BY8A 1BGOA 4I04A 1CQDA 1AU0A 2FTDA 1Y4HA 4YV8A 4YYQA 1AU4A 2DJGB 3RVXA 1KHQA 3QJ3A 3PNRA 3IUTA 3OF8A 3AI8A 1AYVA 2DCBA 4BQVA 3USVA 5JH3A 3BC3A 2PADA 3OVZA 3LXSA 2YJ8A 2E02A 4YYVA 3KFQA 1TLOA 1PPOA 2R9FA 1YVBA 1KXRA 2R6NA 1S4VA 1MHWA 2FQ9A 3H89A 3H6SA 2FRQA 4Q8HA 3KKUA 2ATOA 4BS6A 6PADA 4QRXA 8PCHA 4BS5A 3N3KA 1PCIA 3OF9A 2XU3A 2NQAA 2G8JA 4KLBA 2AYOA 2F1GA 3BWKA 1NB3A 3WXEA 3RVWA 4YYUA 1KHPA 3BCNA 3CBJA 4MSXA 1EWPA 2JQGR 1THEA 2ARYA 4FIPA 2AUXA 2R9NA 2C0YA 3D6SA 3DF0A 2YJCA 1PPPA 1BP4A 1PXVA 2DC8A 1HUCB 1KFXL 1CPJA 2DZZA 3H8BA 4YYRA 3MHHA 1U9WA 3OISA 3BPMA 4X6HA 1NLJA 1PBHA 3KW9A 1ITOA 1CSBB 5EF4A 4X6JA 2DC7A 3KSEA 3HD3A 2DC9A 2VHSA 5PADA 3H8CA 3K24A 3CH3X 4QRGA 3MHSA 3KWBX 2XU5A 3BOWA 1ME4A 1NPZA 4HWYA 1MDWA 1GCBA 3OVXA 2Y5BA 2E00A 1O0EA 4PADA 3PDFA 3MTNA 4P6GA 9PAPA 4QH6A 2WBFX 3S3RA 1GMYA 1U9VA 7PCKA 1YK7A 4I05A 1YT7A 1AU3A 2NQDB 2F7DA 5K16A 1IWDA 4AXLA 1VSNA 2CIOA 1QOLA 4I07A 5FPWA 2E01A 3P5XA 1U9QX 1TL9A 1AECA 5CHTA 4CDFB 1AIMA 3PBHA 3QT4A 2YJ2A 3IV2A 3N4CA 2O6XA 2BDZA 2YJBA 3P5VA 3I3TA 1NQCA 2E03A 2AIMA 4WA6A 1NL6A 1EF7A 4OELA 1M6DA 5F02A 1EWOA 2AU1A 4ZUXU 3U8EA 2FUDA 1AYWA 3C9EA 1QMYA 2HD5A 3RVVA 4PP1A 3B79A 3GCBA 1GLOA 2FYEA 4PI3A 2DCDA 5CVOB 2HH5A 2OP3A 5A24A 2PREA 2IBIA 4N8WA 1MEGA 4FK5A 4N4ZA 3O1GA 4XR7A 1YK8A 1YALA 1CV8A 2OZ2A 1F2AA 4X6IA 3E1ZB 4DMYA 2B1NA 2R9OA 3ERVA 1MEMA 1SP4B 2PNSA 5CHVA 1CS8A
chains in the Genus database with same CATH superfamily
3CBKA 1DF0A 3OQCA 2JTCA 4OW0A 2YJ9A 4PT5A 2Z84A 2OULA 1CVZA 5CVMA 4AXMA 2NQIA 4GUAA 3CH2X 3PW3A 1VJVA 3ZNHA 2ACTA 1AU2A 1PIPA 1PPDA 3PRMA 4XUIA 2FO5A 2FRAA 1GECE 4N79A 5JA7A 1NB5A 1DEUA 1ME3A 3HWNA 3I06A 3TMPA 3W30A 1A6RA 2G8EA 4CDCB 2FT2A 3BPFA 4W5BA 3P5WA 2P0RA 2XU1A 4XZXA 1PADA 1FH0A 3NHEA 2P7UA 4MM3B 1YZBA 3H7DA 1SNKA 4W5CA 1XKGA 1F29A 2R9CA 4OVZB 3V6EA 4D8EA 4BSQA 4YVAA 3TNXA 1U5IA 4P6EA 1PE6A 3KWZA 2P86A 3IOQA 4RF1A 2GFOA 1EWMA 2B1MA 2DC6A 1CJLA 3MP2A 2HHNA 2NQGA 3O65A 2BTWA 2IPPB 4QBBA 2H7JA 4QRVA 4YYWA 1STFE 2HXZA 4MZSA 5E6JA 3K9MA 1F2CA 3IMAA 1JQPA 5EZQA 3MJ5A 4FJCA 2PBHA 3F75A 4DMXA 2R9MA 3QSDA 1QDQA 1Y08A 2BDLA 1MIRA 1AYUA 3MORA 4IUMA 2DOSA 4REZA 1CTEA 4BPVA 1F2BA 1PPNA 4D8BA 2G7YA 3P5UA 4CZWA 4Q8GA 1X9YA 3HHIA 4RY2A 3S3QA 1ATKA 2AYNA 3O0UA 1Q6KA 3WXGA 5CVNB 4W4UA 3WXFA 1EWLA 4PP2E 3IHPA 2AVWA 1BQIA 4CDDB 2DCCA 3HHAA 1K3BB 5J94A 1ICFA 2CB5A 2DJFB 4OEMA 3PHUA 5EGWA 1POPA 3F5VA 2VHFA 3ZUAA 3N3GA 3M99A 2JQFR 4YYSA 1KFUL 1MS6A 1U9XA 3LFYA 1QXPA 3IEJA 2Y6EA 4CDEB 2DCAA 3K8UA 4MZOA 1ZIVA 3V6CA 1CB5A 2AUZA 4G54A 4IP3A 4K7CA 4ZTBA 2DZYA 2XU4A 2GHUA 3KX1A 1TU6A 3PHWA 2G6DA 2AS8A 1ZCMA 1BY8A 4BOQA 1BGOA 4I04A 1CQDA 1AU0A 2FTDA 1Y4HA 4YV8A 4D8IA 4YYQA 1PVJA 1AU4A 2DJGB 3RVXA 1KHQA 2AGAA 3QJ3A 3PNRA 3IUTA 3OF8A 3AI8A 1AYVA 2DCBA 4BQVA 3USVA 5JH3A 4BOSA 2HWKA 3BC3A 2PADA 3OVZA 3LXSA 2YJ8A 3PHXA 2E02A 4YYVA 4RF0A 3KFQA 4RKXA 1TLOA 1PPOA 2R9FA 1YVBA 1KXRA 2R6NA 1S4VA 1MHWA 4BOPA 2FQ9A 3H89A 3H6SA 2FRQA 4Q8HA 3KKUA 2ATOA 4BS6A 6PADA 3BB7A 4QRXA 4HXDB 8PCHA 4BS5A 3N3KA 1PCIA 3OF9A 2XU3A 2NQAA 2G8JA 4KLBA 2AYOA 2F1GA 3B21A 1DKIA 3BWKA 1NB3A 3C0RA 3WXEA 3RVWA 4YYUA 1KHPA 3BCNA 3CBJA 4MSXA 1EWPA 2JQGR 1THEA 2ARYA 4FIPA 2AUXA 1UKFA 2R9NA 4MI7A 2C0YA 3D6SA 3DF0A 2YJCA 1PPPA 3RNVA 2J7QC 1BP4A 1PXVA 2DC8A 1HUCB 1KFXL 1CPJA 2DZZA 3H8BA 4YYRA 3MHHA 1U9WA 3OISA 3BPMA 4X6HA 1NLJA 1PBHA 3KW9A 4BOZA 1ITOA 1CSBB 5EF4A 4X6JA 2DC7A 3KSEA 2UZJA 3HD3A 3PSEA 3W31A 2DC9A 2VHSA 5PADA 3H8CA 3K24A 3CH3X 4QRGA 3MHSA 3IFUA 3KWBX 2XU5A 3BOWA 1ME4A 1NPZA 4HWYA 1MDWA 5JZEA 1GCBA 3OVXA 2Y5BA 2E00A 1O0EA 4PADA 3PDFA 3MTNA 4P6GA 9PAPA 4QH6A 4A5UA 2WBFX 3S3RA 1GMYA 1U9VA 7PCKA 1YK7A 4I05A 1YT7A 1AU3A 2NQDB 2F7DA 5K16A 5EZSA 5KO3A 1IWDA 4AXLA 1VSNA 2CIOA 2J7QA 1QOLA 4I07A 5FPWA 2E01A 4WURA 3P5XA 4R3DA 1U9QX 3PT2A 1TL9A 1AECA 5CHTA 3BY4A 4CDFB 1AIMA 3PBHA 3QT4A 2JRIA 3E9SA 2YJ2A 3IV2A 3N4CA 2O6XA 4P16A 2BDZA 2YJBA 3P5VA 3I3TA 3BBAA 1NQCA 2E03A 2AIMA 4WA6A 4RNAA 1NL6A 1EF7A 4OELA 2FE8A 1M6DA 5F02A 1EWOA 2AU1A 4M0WA 4ZUXU 3U8EA 2FUDA 1AYWA 3C9EA 1QMYA 2HD5A 3RVVA 4PP1A 3B79A 3GCBA 4BOUA 1GLOA 2FYEA 4PI3A 2DCDA 4OVZA 5CVOB 2HH5A 2OP3A 5A24A 2PREA 2IBIA 4N8WA 1MEGA 4FK5A 2BTWB 4N4ZA 3O1GA 4XR7A 1YK8A 1YALA 1CV8A 2OZ2A 1F2AA 4X6IA 3E1ZB 4DMYA 2B1NA 2R9OA 3PRPA 3MTVA 3ERVA 1MEMA 2BU3A 3TRKA 1SP4B 2PNSA 5CHVA 1CS8A
chains in the Genus database with same CATH topology
3CBKA 1DF0A 4NV8A 2YJ9A 2OULA 1CVZA 5CVMA 4AXMA 2NQIA 3CH2X 3PW3A 1VJVA 2ACTA 1AU2A 1PIPA 1PPDA 4XUIA 2FO5A 2FRAA 1GECE 4N79A 5JA7A 1NB5A 1DEUA 1ME3A 3HWNA 3I06A 1A6RA 2G8EA 4CDCB 2FT2A 3BPFA 4W5BA 3P5WA 2P0RA 2XU1A 1PADA 1FH0A 3NHEA 2P7UA 3H7DA 1SNKA 4W5CA 1XKGA 1F29A 2R9CA 3V6EA 4BSQA 4YVAA 3TNXA 4BGFA 1U5IA 4P6EA 1PE6A 3KWZA 2P86A 3IOQA 2GFOA 1EWMA 2B1MA 2DC6A 1CJLA 2HHNA 2NQGA 2IPPB 4QBBA 2H7JA 4QRVA 4YYWA 1STFE 2HXZA 4MZSA 3D9WA 3K9MA 1F2CA 3IMAA 1JQPA 4FJCA 2PBHA 3F75A 4DMXA 2R9MA 3QSDA 1QDQA 1Y08A 2BDLA 1MIRA 1AYUA 3MORA 4BPVA 1CTEA 1F2BA 1PPNA 2G7YA 3P5UA 4CZWA 4Q8GA 1X9YA 3HHIA 4RY2A 3S3QA 1ATKA 2AYNA 1E2TA 3O0UA 1Q6KA 3WXGA 5CVNB 4W4UA 3WXFA 1EWLA 4PP2E 3IHPA 2AVWA 1BQIA 4CDDB 2DCCA 3HHAA 1K3BB 5J94A 1ICFA 2CB5A 2DJFB 4OEMA 5EGWA 1POPA 1GX3A 3F5VA 2VHFA 3ZUAA 3N3GA 3M99A 2JQFR 4YYSA 1KFUL 1MS6A 1U9XA 3LFYA 1QXPA 3IEJA 2Y6EA 4CDEB 2DCAA 3K8UA 4MZOA 1ZIVA 3V6CA 1CB5A 2AUZA 4G54A 2VFCA 4K7CA 2DZYA 2XU4A 2GHUA 4NV7A 3KX1A 1TU6A 1W4TA 2G6DA 2AS8A 1ZCMA 1BY8A 1BGOA 4I04A 1CQDA 1AU0A 2FTDA 1Y4HA 4YV8A 4YYQA 1AU4A 2DJGB 3RVXA 1KHQA 3QJ3A 3PNRA 3IUTA 3OF8A 3AI8A 1AYVA 2DCBA 4BQVA 3USVA 5JH3A 3BC3A 2PADA 3OVZA 3LXSA 2YJ8A 2E02A 4YYVA 3KFQA 1TLOA 1PPOA 2R9FA 1YVBA 1KXRA 2R6NA 1S4VA 1MHWA 2FQ9A 3H89A 3H6SA 2FRQA 4Q8HA 3KKUA 2ATOA 4BS6A 6PADA 4QRXA 8PCHA 4BS5A 3N3KA 1PCIA 3OF9A 2XU3A 2NQAA 2G8JA 4KLBA 2AYOA 2F1GA 3BWKA 1NB3A 3WXEA 3RVWA 2BSZA 4YYUA 1KHPA 3BCNA 3CBJA 4MSXA 1EWPA 2JQGR 1W5RA 1THEA 2ARYA 4FIPA 2AUXA 2R9NA 2C0YA 3D6SA 3LTWA 3DF0A 2YJCA 1PPPA 1BP4A 1PXVA 2DC8A 1HUCB 1KFXL 1CPJA 2DZZA 3H8BA 4YYRA 4GUZA 3MHHA 1U9WA 3OISA 3BPMA 4X6HA 1NLJA 1PBHA 3KW9A 1ITOA 1CSBB 5EF4A 4X6JA 2DC7A 3KSEA 3HD3A 2VFBA 2DC9A 2VHSA 5PADA 3H8CA 3K24A 3CH3X 4QRGA 3MHSA 3KWBX 2XU5A 3BOWA 1ME4A 1NPZA 4HWYA 1MDWA 1GCBA 3OVXA 2Y5BA 2E00A 1O0EA 4PADA 3PDFA 3MTNA 4P6GA 9PAPA 4QH6A 2WBFX 3S3RA 1GMYA 1U9VA 7PCKA 1YK7A 4I05A 1YT7A 4C5PA 1AU3A 2NQDB 2F7DA 5K16A 1IWDA 4AXLA 1VSNA 2CIOA 1QOLA 4I07A 5FPWA 2E01A 3P5XA 1U9QX 1TL9A 1AECA 5CHTA 4CDFB 1AIMA 3PBHA 3QT4A 2YJ2A 3IV2A 3N4CA 2O6XA 2BDZA 2YJBA 3P5VA 3I3TA 1NQCA 2E03A 2AIMA 4WA6A 1NL6A 1EF7A 4OELA 1M6DA 5F02A 1EWOA 2AU1A 4ZUXU 3U8EA 2FUDA 4B55A 1AYWA 3C9EA 1QMYA 2HD5A 3RVVA 4PP1A 3B79A 3GCBA 1GLOA 2FYEA 4PI3A 2DCDA 5CVOB 2HH5A 2OP3A 5A24A 2PREA 2IBIA 4N8WA 1MEGA 4FK5A 1W6FA 4N4ZA 3O1GA 4XR7A 1YK8A 1YALA 1CV8A 2OZ2A 1F2AA 4X6IA 3E1ZB 4DMYA 2B1NA 2R9OA 3ERVA 1MEMA 1SP4B 2PNSA 5CHVA 1CS8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CBK A;  1DF0 A;  2YJ9 A;  2OUL A;  1CVZ A;  5CVM A;  4AXM A;  2NQI A;  3CH2 X;  3PW3 A;  1VJV A;  2ACT A;  1AU2 A;  1PIP A;  1PPD A;  4XUI A;  2FO5 A;  2FRA A;  1GEC E;  4N79 A;  5JA7 A;  1NB5 A;  1DEU A;  1ME3 A;  3HWN A;  3I06 A;  1A6R A;  2G8E A;  4CDC B;  2FT2 A;  3BPF A;  4W5B A;  3P5W A;  2P0R A;  2XU1 A;  1PAD A;  1FH0 A;  3NHE A;  2P7U A;  3H7D A;  1SNK A;  4W5C A;  1XKG A;  1F29 A;  2R9C A;  3V6E A;  4BSQ A;  4YVA A;  3TNX A;  1U5I A;  4P6E A;  1PE6 A;  3KWZ A;  2P86 A;  3IOQ A;  2GFO A;  1EWM A;  2B1M A;  2DC6 A;  1CJL A;  2HHN A;  2NQG A;  2IPP B;  4QBB A;  2H7J A;  4QRV A;  4YYW A;  1STF E;  2HXZ A;  4MZS A;  3K9M A;  1F2C A;  3IMA A;  1JQP A;  4FJC A;  2PBH A;  3F75 A;  4DMX A;  2R9M A;  3QSD A;  1QDQ A;  1Y08 A;  2BDL A;  1MIR A;  1AYU A;  3MOR A;  4BPV A;  1CTE A;  1F2B A;  1PPN A;  2G7Y A;  3P5U A;  4CZW A;  4Q8G A;  1X9Y A;  3HHI A;  4RY2 A;  3S3Q A;  1ATK A;  2AYN A;  3O0U A;  1Q6K A;  3WXG A;  5CVN B;  4W4U A;  3WXF A;  1EWL A;  4PP2 E;  3IHP A;  2AVW A;  1BQI A;  4CDD B;  2DCC A;  3HHA A;  1K3B B;  5J94 A;  1ICF A;  2CB5 A;  2DJF B;  4OEM A;  5EGW A;  1POP A;  3F5V A;  2VHF A;  3ZUA A;  3N3G A;  3M99 A;  2JQF R;  4YYS A;  1KFU L;  1MS6 A;  1U9X A;  3LFY A;  1QXP A;  3IEJ A;  2Y6E A;  4CDE B;  2DCA A;  3K8U A;  4MZO A;  1ZIV A;  3V6C A;  1CB5 A;  2AUZ A;  4G54 A;  4K7C A;  2DZY A;  2XU4 A;  2GHU A;  3KX1 A;  1TU6 A;  2G6D A;  2AS8 A;  1ZCM A;  1BY8 A;  1BGO A;  4I04 A;  1CQD A;  1AU0 A;  2FTD A;  1Y4H A;  4YV8 A;  4YYQ A;  1AU4 A;  2DJG B;  3RVX A;  1KHQ A;  3QJ3 A;  3PNR A;  3IUT A;  3OF8 A;  3AI8 A;  1AYV A;  2DCB A;  4BQV A;  3USV A;  5JH3 A;  3BC3 A;  2PAD A;  3OVZ A;  3LXS A;  2YJ8 A;  2E02 A;  4YYV A;  3KFQ A;  1TLO A;  1PPO A;  2R9F A;  1YVB A;  1KXR A;  2R6N A;  1S4V A;  1MHW A;  2FQ9 A;  3H89 A;  3H6S A;  2FRQ A;  4Q8H A;  3KKU A;  2ATO A;  4BS6 A;  6PAD A;  4QRX A;  8PCH A;  4BS5 A;  3N3K A;  1PCI A;  3OF9 A;  2XU3 A;  2NQA A;  2G8J A;  4KLB A;  2AYO A;  2F1G A;  3BWK A;  1NB3 A;  3WXE A;  3RVW A;  4YYU A;  1KHP A;  3BCN A;  3CBJ A;  4MSX A;  1EWP A;  2JQG R;  1THE A;  2ARY A;  4FIP A;  2AUX A;  2R9N A;  2C0Y A;  3D6S A;  3DF0 A;  2YJC A;  1PPP A;  1BP4 A;  1PXV A;  2DC8 A;  1HUC B;  1KFX L;  1CPJ A;  2DZZ A;  3H8B A;  4YYR A;  3MHH A;  1U9W A;  3OIS A;  3BPM A;  4X6H A;  1NLJ A;  1PBH A;  3KW9 A;  1ITO A;  1CSB B;  5EF4 A;  4X6J A;  2DC7 A;  3KSE A;  3HD3 A;  2DC9 A;  2VHS A;  5PAD A;  3H8C A;  3K24 A;  3CH3 X;  4QRG A;  3MHS A;  3KWB X;  2XU5 A;  3BOW A;  1ME4 A;  1NPZ A;  4HWY A;  1MDW A;  1GCB A;  3OVX A;  2Y5B A;  2E00 A;  1O0E A;  4PAD A;  3PDF A;  3MTN A;  4P6G A;  9PAP A;  4QH6 A;  2WBF X;  3S3R A;  1GMY A;  1U9V A;  7PCK A;  1YK7 A;  4I05 A;  1YT7 A;  1AU3 A;  2NQD B;  2F7D A;  5K16 A;  1IWD A;  4AXL A;  1VSN A;  2CIO A;  1QOL A;  4I07 A;  5FPW A;  2E01 A;  3P5X A;  1U9Q X;  1TL9 A;  1AEC A;  5CHT A;  4CDF B;  1AIM A;  3PBH A;  3QT4 A;  2YJ2 A;  3IV2 A;  3N4C A;  2O6X A;  2BDZ A;  2YJB A;  3P5V A;  3I3T A;  1NQC A;  2E03 A;  2AIM A;  4WA6 A;  1NL6 A;  1EF7 A;  4OEL A;  1M6D A;  5F02 A;  1EWO A;  2AU1 A;  4ZUX U;  3U8E A;  2FUD A;  1AYW A;  3C9E A;  1QMY A;  2HD5 A;  3RVV A;  4PP1 A;  3B79 A;  3GCB A;  1GLO A;  2FYE A;  4PI3 A;  2DCD A;  5CVO B;  2HH5 A;  2OP3 A;  5A24 A;  2PRE A;  2IBI A;  4N8W A;  1MEG A;  4FK5 A;  4N4Z A;  3O1G A;  4XR7 A;  1YK8 A;  1YAL A;  1CV8 A;  2OZ2 A;  1F2A A;  4X6I A;  3E1Z B;  4DMY A;  2B1N A;  2R9O A;  3ERV A;  1MEM A;  1SP4 B;  2PNS A;  5CHV A;  1CS8 A; 
#chains in the Genus database with same CATH topology
 3CBK A;  1DF0 A;  3OQC A;  2JTC A;  4OW0 A;  2YJ9 A;  4PT5 A;  2Z84 A;  2OUL A;  1CVZ A;  5CVM A;  4AXM A;  2NQI A;  4GUA A;  3CH2 X;  3PW3 A;  1VJV A;  3ZNH A;  2ACT A;  1AU2 A;  1PIP A;  1PPD A;  3PRM A;  4XUI A;  2FO5 A;  2FRA A;  1GEC E;  4N79 A;  5JA7 A;  1NB5 A;  1DEU A;  1ME3 A;  3HWN A;  3I06 A;  3TMP A;  3W30 A;  1A6R A;  2G8E A;  4CDC B;  2FT2 A;  3BPF A;  4W5B A;  3P5W A;  2P0R A;  2XU1 A;  4XZX A;  1PAD A;  1FH0 A;  3NHE A;  2P7U A;  4MM3 B;  1YZB A;  3H7D A;  1SNK A;  4W5C A;  1XKG A;  1F29 A;  2R9C A;  4OVZ B;  3V6E A;  4D8E A;  4BSQ A;  4YVA A;  3TNX A;  1U5I A;  4P6E A;  1PE6 A;  3KWZ A;  2P86 A;  3IOQ A;  4RF1 A;  2GFO A;  1EWM A;  2B1M A;  2DC6 A;  1CJL A;  3MP2 A;  2HHN A;  2NQG A;  3O65 A;  2BTW A;  2IPP B;  4QBB A;  2H7J A;  4QRV A;  4YYW A;  1STF E;  2HXZ A;  4MZS A;  5E6J A;  3K9M A;  1F2C A;  3IMA A;  1JQP A;  5EZQ A;  3MJ5 A;  4FJC A;  2PBH A;  3F75 A;  4DMX A;  2R9M A;  3QSD A;  1QDQ A;  1Y08 A;  2BDL A;  1MIR A;  1AYU A;  3MOR A;  4IUM A;  2DOS A;  4REZ A;  1CTE A;  4BPV A;  1F2B A;  1PPN A;  4D8B A;  2G7Y A;  3P5U A;  4CZW A;  4Q8G A;  1X9Y A;  3HHI A;  4RY2 A;  3S3Q A;  1ATK A;  2AYN A;  3O0U A;  1Q6K A;  3WXG A;  5CVN B;  4W4U A;  3WXF A;  1EWL A;  4PP2 E;  3IHP A;  2AVW A;  1BQI A;  4CDD B;  2DCC A;  3HHA A;  1K3B B;  5J94 A;  1ICF A;  2CB5 A;  2DJF B;  4OEM A;  3PHU A;  5EGW A;  1POP A;  3F5V A;  2VHF A;  3ZUA A;  3N3G A;  3M99 A;  2JQF R;  4YYS A;  1KFU L;  1MS6 A;  1U9X A;  3LFY A;  1QXP A;  3IEJ A;  2Y6E A;  4CDE B;  2DCA A;  3K8U A;  4MZO A;  1ZIV A;  3V6C A;  1CB5 A;  2AUZ A;  4G54 A;  4IP3 A;  4K7C A;  4ZTB A;  2DZY A;  2XU4 A;  2GHU A;  3KX1 A;  1TU6 A;  3PHW A;  2G6D A;  2AS8 A;  1ZCM A;  1BY8 A;  4BOQ A;  1BGO A;  4I04 A;  1CQD A;  1AU0 A;  2FTD A;  1Y4H A;  4YV8 A;  4D8I A;  4YYQ A;  1PVJ A;  1AU4 A;  2DJG B;  3RVX A;  1KHQ A;  2AGA A;  3QJ3 A;  3PNR A;  3IUT A;  3OF8 A;  3AI8 A;  1AYV A;  2DCB A;  4BQV A;  3USV A;  5JH3 A;  4BOS A;  2HWK A;  3BC3 A;  2PAD A;  3OVZ A;  3LXS A;  2YJ8 A;  3PHX A;  2E02 A;  4YYV A;  4RF0 A;  3KFQ A;  4RKX A;  1TLO A;  1PPO A;  2R9F A;  1YVB A;  1KXR A;  2R6N A;  1S4V A;  1MHW A;  4BOP A;  2FQ9 A;  3H89 A;  3H6S A;  2FRQ A;  4Q8H A;  3KKU A;  2ATO A;  4BS6 A;  6PAD A;  3BB7 A;  4QRX A;  4HXD B;  8PCH A;  4BS5 A;  3N3K A;  1PCI A;  3OF9 A;  2XU3 A;  2NQA A;  2G8J A;  4KLB A;  2AYO A;  2F1G A;  3B21 A;  1DKI A;  3BWK A;  1NB3 A;  3C0R A;  3WXE A;  3RVW A;  4YYU A;  1KHP A;  3BCN A;  3CBJ A;  4MSX A;  1EWP A;  2JQG R;  1THE A;  2ARY A;  4FIP A;  2AUX A;  1UKF A;  2R9N A;  4MI7 A;  2C0Y A;  3D6S A;  3DF0 A;  2YJC A;  1PPP A;  3RNV A;  2J7Q C;  1BP4 A;  1PXV A;  2DC8 A;  1HUC B;  1KFX L;  1CPJ A;  2DZZ A;  3H8B A;  4YYR A;  3MHH A;  1U9W A;  3OIS A;  3BPM A;  4X6H A;  1NLJ A;  1PBH A;  3KW9 A;  4BOZ A;  1ITO A;  1CSB B;  5EF4 A;  4X6J A;  2DC7 A;  3KSE A;  2UZJ A;  3HD3 A;  3PSE A;  3W31 A;  2DC9 A;  2VHS A;  5PAD A;  3H8C A;  3K24 A;  3CH3 X;  4QRG A;  3MHS A;  3IFU A;  3KWB X;  2XU5 A;  3BOW A;  1ME4 A;  1NPZ A;  4HWY A;  1MDW A;  5JZE A;  1GCB A;  3OVX A;  2Y5B A;  2E00 A;  1O0E A;  4PAD A;  3PDF A;  3MTN A;  4P6G A;  9PAP A;  4QH6 A;  4A5U A;  2WBF X;  3S3R A;  1GMY A;  1U9V A;  7PCK A;  1YK7 A;  4I05 A;  1YT7 A;  1AU3 A;  2NQD B;  2F7D A;  5K16 A;  5EZS A;  5KO3 A;  1IWD A;  4AXL A;  1VSN A;  2CIO A;  2J7Q A;  1QOL A;  4I07 A;  5FPW A;  2E01 A;  4WUR A;  3P5X A;  4R3D A;  1U9Q X;  3PT2 A;  1TL9 A;  1AEC A;  5CHT A;  3BY4 A;  4CDF B;  1AIM A;  3PBH A;  3QT4 A;  2JRI A;  3E9S A;  2YJ2 A;  3IV2 A;  3N4C A;  2O6X A;  4P16 A;  2BDZ A;  2YJB A;  3P5V A;  3I3T A;  3BBA A;  1NQC A;  2E03 A;  2AIM A;  4WA6 A;  4RNA A;  1NL6 A;  1EF7 A;  4OEL A;  2FE8 A;  1M6D A;  5F02 A;  1EWO A;  2AU1 A;  4M0W A;  4ZUX U;  3U8E A;  2FUD A;  1AYW A;  3C9E A;  1QMY A;  2HD5 A;  3RVV A;  4PP1 A;  3B79 A;  3GCB A;  4BOU A;  1GLO A;  2FYE A;  4PI3 A;  2DCD A;  4OVZ A;  5CVO B;  2HH5 A;  2OP3 A;  5A24 A;  2PRE A;  2IBI A;  4N8W A;  1MEG A;  4FK5 A;  2BTW B;  4N4Z A;  3O1G A;  4XR7 A;  1YK8 A;  1YAL A;  1CV8 A;  2OZ2 A;  1F2A A;  4X6I A;  3E1Z B;  4DMY A;  2B1N A;  2R9O A;  3PRP A;  3MTV A;  3ERV A;  1MEM A;  2BU3 A;  3TRK A;  1SP4 B;  2PNS A;  5CHV A;  1CS8 A; 
#chains in the Genus database with same CATH homology
 3CBK A;  1DF0 A;  4NV8 A;  2YJ9 A;  2OUL A;  1CVZ A;  5CVM A;  4AXM A;  2NQI A;  3CH2 X;  3PW3 A;  1VJV A;  2ACT A;  1AU2 A;  1PIP A;  1PPD A;  4XUI A;  2FO5 A;  2FRA A;  1GEC E;  4N79 A;  5JA7 A;  1NB5 A;  1DEU A;  1ME3 A;  3HWN A;  3I06 A;  1A6R A;  2G8E A;  4CDC B;  2FT2 A;  3BPF A;  4W5B A;  3P5W A;  2P0R A;  2XU1 A;  1PAD A;  1FH0 A;  3NHE A;  2P7U A;  3H7D A;  1SNK A;  4W5C A;  1XKG A;  1F29 A;  2R9C A;  3V6E A;  4BSQ A;  4YVA A;  3TNX A;  4BGF A;  1U5I A;  4P6E A;  1PE6 A;  3KWZ A;  2P86 A;  3IOQ A;  2GFO A;  1EWM A;  2B1M A;  2DC6 A;  1CJL A;  2HHN A;  2NQG A;  2IPP B;  4QBB A;  2H7J A;  4QRV A;  4YYW A;  1STF E;  2HXZ A;  4MZS A;  3D9W A;  3K9M A;  1F2C A;  3IMA A;  1JQP A;  4FJC A;  2PBH A;  3F75 A;  4DMX A;  2R9M A;  3QSD A;  1QDQ A;  1Y08 A;  2BDL A;  1MIR A;  1AYU A;  3MOR A;  4BPV A;  1CTE A;  1F2B A;  1PPN A;  2G7Y A;  3P5U A;  4CZW A;  4Q8G A;  1X9Y A;  3HHI A;  4RY2 A;  3S3Q A;  1ATK A;  2AYN A;  1E2T A;  3O0U A;  1Q6K A;  3WXG A;  5CVN B;  4W4U A;  3WXF A;  1EWL A;  4PP2 E;  3IHP A;  2AVW A;  1BQI A;  4CDD B;  2DCC A;  3HHA A;  1K3B B;  5J94 A;  1ICF A;  2CB5 A;  2DJF B;  4OEM A;  5EGW A;  1POP A;  1GX3 A;  3F5V A;  2VHF A;  3ZUA A;  3N3G A;  3M99 A;  2JQF R;  4YYS A;  1KFU L;  1MS6 A;  1U9X A;  3LFY A;  1QXP A;  3IEJ A;  2Y6E A;  4CDE B;  2DCA A;  3K8U A;  4MZO A;  1ZIV A;  3V6C A;  1CB5 A;  2AUZ A;  4G54 A;  2VFC A;  4K7C A;  2DZY A;  2XU4 A;  2GHU A;  4NV7 A;  3KX1 A;  1TU6 A;  1W4T A;  2G6D A;  2AS8 A;  1ZCM A;  1BY8 A;  1BGO A;  4I04 A;  1CQD A;  1AU0 A;  2FTD A;  1Y4H A;  4YV8 A;  4YYQ A;  1AU4 A;  2DJG B;  3RVX A;  1KHQ A;  3QJ3 A;  3PNR A;  3IUT A;  3OF8 A;  3AI8 A;  1AYV A;  2DCB A;  4BQV A;  3USV A;  5JH3 A;  3BC3 A;  2PAD A;  3OVZ A;  3LXS A;  2YJ8 A;  2E02 A;  4YYV A;  3KFQ A;  1TLO A;  1PPO A;  2R9F A;  1YVB A;  1KXR A;  2R6N A;  1S4V A;  1MHW A;  2FQ9 A;  3H89 A;  3H6S A;  2FRQ A;  4Q8H A;  3KKU A;  2ATO A;  4BS6 A;  6PAD A;  4QRX A;  8PCH A;  4BS5 A;  3N3K A;  1PCI A;  3OF9 A;  2XU3 A;  2NQA A;  2G8J A;  4KLB A;  2AYO A;  2F1G A;  3BWK A;  1NB3 A;  3WXE A;  3RVW A;  2BSZ A;  4YYU A;  1KHP A;  3BCN A;  3CBJ A;  4MSX A;  1EWP A;  2JQG R;  1W5R A;  1THE A;  2ARY A;  4FIP A;  2AUX A;  2R9N A;  2C0Y A;  3D6S A;  3LTW A;  3DF0 A;  2YJC A;  1PPP A;  1BP4 A;  1PXV A;  2DC8 A;  1HUC B;  1KFX L;  1CPJ A;  2DZZ A;  3H8B A;  4YYR A;  4GUZ A;  3MHH A;  1U9W A;  3OIS A;  3BPM A;  4X6H A;  1NLJ A;  1PBH A;  3KW9 A;  1ITO A;  1CSB B;  5EF4 A;  4X6J A;  2DC7 A;  3KSE A;  3HD3 A;  2VFB A;  2DC9 A;  2VHS A;  5PAD A;  3H8C A;  3K24 A;  3CH3 X;  4QRG A;  3MHS A;  3KWB X;  2XU5 A;  3BOW A;  1ME4 A;  1NPZ A;  4HWY A;  1MDW A;  1GCB A;  3OVX A;  2Y5B A;  2E00 A;  1O0E A;  4PAD A;  3PDF A;  3MTN A;  4P6G A;  9PAP A;  4QH6 A;  2WBF X;  3S3R A;  1GMY A;  1U9V A;  7PCK A;  1YK7 A;  4I05 A;  1YT7 A;  4C5P A;  1AU3 A;  2NQD B;  2F7D A;  5K16 A;  1IWD A;  4AXL A;  1VSN A;  2CIO A;  1QOL A;  4I07 A;  5FPW A;  2E01 A;  3P5X A;  1U9Q X;  1TL9 A;  1AEC A;  5CHT A;  4CDF B;  1AIM A;  3PBH A;  3QT4 A;  2YJ2 A;  3IV2 A;  3N4C A;  2O6X A;  2BDZ A;  2YJB A;  3P5V A;  3I3T A;  1NQC A;  2E03 A;  2AIM A;  4WA6 A;  1NL6 A;  1EF7 A;  4OEL A;  1M6D A;  5F02 A;  1EWO A;  2AU1 A;  4ZUX U;  3U8E A;  2FUD A;  4B55 A;  1AYW A;  3C9E A;  1QMY A;  2HD5 A;  3RVV A;  4PP1 A;  3B79 A;  3GCB A;  1GLO A;  2FYE A;  4PI3 A;  2DCD A;  5CVO B;  2HH5 A;  2OP3 A;  5A24 A;  2PRE A;  2IBI A;  4N8W A;  1MEG A;  4FK5 A;  1W6F A;  4N4Z A;  3O1G A;  4XR7 A;  1YK8 A;  1YAL A;  1CV8 A;  2OZ2 A;  1F2A A;  4X6I A;  3E1Z B;  4DMY A;  2B1N A;  2R9O A;  3ERV A;  1MEM A;  1SP4 B;  2PNS A;  5CHV A;  1CS8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...