3KWZA

Cathepsin k in complex with a non-selective 2-cyano-pyrimidine inhibitor
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
215
structure length
215
Chain Sequence
b'APDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cathepsin K
publication title Design and optimization of a series of novel 2-cyano-pyrimidines as cathepsin K inhibitors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 62
structure length 215
sequence length 215
ec nomenclature ec 3.4.22.38: Cathepsin K.
pdb deposition date 2009-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3kwzA00
3KSEA 3O0UA 1M6DA 3TNXA 4N4ZA 4BPVA 3RVWA 1F29A 3PDFA 2E01A 4CDDB 5FPWA 4I04A 1CQDA 3IHPA 3PNRA 3IV2A 2ARYA 2NQGA 1AECA 1AYVA 3LXSA 6PADA 1AYUA 1KFUL 3MORA 1CSBB 2OZ2A 3S3RA 1U9QX 1U9WA 4KLBA 1NQCA 1THEA 1PCIA 1ICFA 3I3TA 2FYEA 1X9YA 4P6EA 4QRXA 2OP3A 4FJCA 1QXPA 2DZYA 1SNKA 1MDWA 2VHSA 2JQFR 1POPA 3OISA 1DF0A 4K7CA 1HUCB 3CBKA 1S4VA 5CHVA 2E00A 4BSQA 5A24A 5JH3A 4DMYA 2AYNA 1MEGA 1ME3A 2Y6EA 3BOWA 1U9VA 2YJCA 5K16A 4AXLA 5CVMA 1F2BA 4QRGA 1QMYA 1MHWA 2PREA 2DZZA 2IPPB 4YVAA 1VSNA 3ZUAA 4XR7A 3H7DA 1PADA 1QDQA 3HD3A 1QOLA 3LFYA 2ACTA 4X6JA 4Q8GA 4OEMA 1BY8A 1F2CA 2HXZA 3C9EA 2VHFA 3V6EA 2GFOA 4X6HA 3N3KA 3N4CA 4PP1A 2Y5BA 2FRAA 1SP4B 3E1ZB 2YJ9A 1PXVA 3MHHA 2DC9A 3P5XA 3M99A 7PCKA 1YK7A 2B1NA 1XKGA 4MZSA 1MEMA 3P5UA 1CB5A 3B79A 1KHQA 4BS5A 3WXGA 2P0RA 1GCBA 1YT7A 1AYWA 1EWMA 5CHTA 4FK5A 4DMXA 1AU0A 1U9XA 1Y08A 2DCAA 4YYRA 2E02A 3QT4A 1EWOA 2JQGR 4I05A 3IEJA 4FIPA 1EWLA 1CS8A 1MIRA 1TU6A 2DCCA 2E03A 2R6NA 4PP2E 4OELA 5F02A 4PADA 2P7UA 3K9MA 2NQAA 4MZOA 2YJBA 2DC6A 4MSXA 3WXFA 4RY2A 2R9OA 3OF8A 3OVZA 1STFE 2WBFX 2DJFB 2OULA 1KFXL 3HHIA 2BDLA 1FH0A 2XU5A 1NLJA 3MTNA 4QH6A 3NHEA 1EF7A 2HD5A 3H89A 1PPNA 1Y4HA 1PPOA 1GECE 4YYSA 3PW3A 1BQIA 2NQIA 4CZWA 3BWKA 1VJVA 2NQDB 3BC3A 1CPJA 3IMAA 1YK8A 3KWBX 2G8EA 5J94A 2R9CA 1O0EA 2GHUA 3O1GA 1F2AA 3PBHA 3QJ3A 2CB5A 4XUIA 2YJ8A 2XU3A 4X6IA 4HWYA 1ATKA 1CV8A 2FRQA 4Q8HA 3WXEA 1GLOA 1DEUA 2H7JA 4QRVA 2PBHA 4I07A 5CVOB 1PBHA 5EF4A 4BQVA 2DCDA 2AYOA 2B1MA 2F1GA 4N79A 3V6CA 2DCBA 2BDZA 3KX1A 1AU4A 1CJLA 2P86A 3GCBA 4YYUA 3USVA 2PADA 1TL9A 3BPMA 3BCNA 3CH3X 1NPZA 4ZUXU 1PE6A 2O6XA 1JQPA 3P5VA 1ME4A 2FT2A 2AUZA 1YALA 2YJ2A 3QSDA 1CVZA 3RVVA 4W5CA 2XU4A 3U8EA 3IOQA 4WA6A 3KW9A 2DC7A 3ERVA 2FQ9A 3K8UA 4W5BA 2HH5A 1ZCMA 3DF0A 2HHNA 4YYVA 5CVNB 1U5IA 2AU1A 4QBBA 3IUTA 5PADA 3S3QA 3OF9A 1KHPA 2IBIA 1AIMA 1ZIVA 4W4UA 3HWNA 2AUXA 2AIMA 3I06A 3P5WA 2CIOA 3AI8A 1NB5A 3MHSA 1YVBA 3K24A 2R9NA 1MS6A 1PPPA 2F7DA 1GMYA 3H8BA 4P6GA 2C0YA 3KWZA 5EGWA 2AVWA 1AU3A 3H8CA 1TLOA 4CDEB 3F5VA 1ITOA 4PI3A 1IWDA 2XU1A 3KFQA 2DC8A 8PCHA 2DJGB 3KKUA 1PPDA 2G7YA 1NB3A 2ATOA 3CH2X 1Q6KA 3HHAA 2R9FA 9PAPA 1NL6A 3BPFA 2R9MA 3H6SA 1BGOA 5JA7A 1PIPA 3D6SA 3N3GA 4YYQA 2FO5A 3OVXA 4CDCB 2FUDA 4N8WA 3RVXA 1EWPA 1CTEA 3F75A 4YV8A 4CDFB 1KXRA 4AXMA 2PNSA 4G54A 2G8JA 2G6DA 1BP4A 4YYWA 2FTDA 4BS6A 1A6RA 1K3BB 1AU2A 2AS8A 3CBJA
chains in the Genus database with same CATH superfamily
3KSEA 3O0UA 1M6DA 3TNXA 4N4ZA 4BPVA 3RVWA 1F29A 3PDFA 2E01A 4CDDB 5FPWA 4I04A 1CQDA 3IHPA 3PNRA 3IV2A 2ARYA 2NQGA 1AECA 1AYVA 5EZSA 4BOPA 3LXSA 6PADA 1AYUA 2J7QC 1KFUL 3MORA 1CSBB 2OZ2A 3MP2A 3S3RA 1U9QX 1U9WA 4KLBA 5JZEA 1NQCA 1THEA 1PCIA 1ICFA 4RKXA 3I3TA 2FYEA 1X9YA 4P6EA 4QRXA 2OP3A 4FJCA 1QXPA 2DZYA 2BTWB 4D8IA 1SNKA 1MDWA 2VHSA 2JQFR 1POPA 3OISA 1DF0A 4K7CA 1HUCB 3CBKA 1S4VA 5CHVA 4P16A 3W31A 2Z84A 2E00A 3PRPA 4BSQA 4BOQA 5A24A 5JH3A 4DMYA 2AYNA 1MEGA 1ME3A 2Y6EA 3BOWA 1U9VA 2FE8A 2YJCA 4REZA 5K16A 4AXLA 5CVMA 2JRIA 1F2BA 4QRGA 1QMYA 3MJ5A 1MHWA 2PREA 4D8EA 2DZZA 2IPPB 4YVAA 1VSNA 3ZUAA 4XR7A 3H7DA 1PADA 1QDQA 3HD3A 1QOLA 5E6JA 3LFYA 3PHWA 2ACTA 4X6JA 4Q8GA 4OEMA 1BY8A 1F2CA 2HXZA 3C9EA 2VHFA 3V6EA 4RF0A 2GFOA 4X6HA 3N3KA 3N4CA 4PP1A 2JTCA 4XZXA 2Y5BA 4BOSA 2FRAA 1SP4B 3E1ZB 2YJ9A 4D8BA 1PXVA 3MHHA 3ZNHA 2DC9A 3P5XA 3M99A 7PCKA 1YK7A 2B1NA 1XKGA 3BY4A 4MZSA 1MEMA 3P5UA 1CB5A 3B79A 1KHQA 4BS5A 3WXGA 3TRKA 2P0RA 1PVJA 1GCBA 1YT7A 1AYWA 1DKIA 1EWMA 5CHTA 4ZTBA 4FK5A 4DMXA 1AU0A 1U9XA 4OVZA 1Y08A 2DCAA 4YYRA 2E02A 3QT4A 3TMPA 3C0RA 1EWOA 2JQGR 4I05A 3IEJA 4FIPA 1EWLA 4MM3B 1CS8A 1MIRA 1TU6A 2DCCA 2E03A 3BBAA 3B21A 2R6NA 4R3DA 4PP2E 4PT5A 4OELA 5EZQA 5F02A 4PADA 2P7UA 3K9MA 2NQAA 4MZOA 2YJBA 2DC6A 4MSXA 4GUAA 3WXFA 4RY2A 2AGAA 2R9OA 3OF8A 3OQCA 3OVZA 1STFE 2WBFX 2DJFB 2OULA 1KFXL 3PHXA 3HHIA 2UZJA 2BDLA 1FH0A 4WURA 2XU5A 1NLJA 3MTNA 4QH6A 3NHEA 4OW0A 1EF7A 2HD5A 3H89A 1PPNA 1Y4HA 1PPOA 1GECE 3RNVA 4YYSA 3PW3A 1BQIA 2NQIA 3PHUA 4CZWA 3BWKA 3W30A 1VJVA 2NQDB 3O65A 3BC3A 1CPJA 3IMAA 1YK8A 3KWBX 2G8EA 5J94A 2R9CA 1O0EA 2GHUA 3O1GA 4HXDB 1F2AA 3PBHA 3QJ3A 2CB5A 4XUIA 2YJ8A 3PRMA 2XU3A 4X6IA 4HWYA 1ATKA 1CV8A 2FRQA 4Q8HA 3WXEA 1GLOA 1DEUA 1YZBA 2H7JA 4QRVA 2PBHA 4I07A 5CVOB 1PBHA 3IFUA 5EF4A 4BQVA 2DCDA 2AYOA 2B1MA 2F1GA 4N79A 3V6CA 2DCBA 2BDZA 3KX1A 1AU4A 4A5UA 1CJLA 2P86A 3GCBA 4YYUA 4IP3A 3USVA 2PADA 1TL9A 3BPMA 3BCNA 3MTVA 3CH3X 1NPZA 3BB7A 4ZUXU 1PE6A 2O6XA 1JQPA 3P5VA 1ME4A 2FT2A 2AUZA 1YALA 2YJ2A 3QSDA 1CVZA 3RVVA 2BU3A 4W5CA 2XU4A 3U8EA 3IOQA 4WA6A 3KW9A 2DC7A 3ERVA 2FQ9A 3K8UA 4OVZB 4W5BA 2HH5A 1ZCMA 3DF0A 2HHNA 4YYVA 5KO3A 5CVNB 1U5IA 2AU1A 4QBBA 3IUTA 4BOUA 5PADA 3S3QA 3OF9A 1KHPA 2IBIA 1AIMA 1ZIVA 3E9SA 4W4UA 3HWNA 2AUXA 2AIMA 3I06A 3P5WA 1UKFA 2CIOA 3AI8A 1NB5A 3MHSA 1YVBA 3K24A 4BOZA 2R9NA 1MS6A 1PPPA 2BTWA 2F7DA 1GMYA 3H8BA 4P6GA 2C0YA 3KWZA 5EGWA 2AVWA 1AU3A 4M0WA 3H8CA 1TLOA 3PT2A 4CDEB 4MI7A 3F5VA 1ITOA 4PI3A 1IWDA 2XU1A 3KFQA 2DC8A 8PCHA 2DJGB 3KKUA 1PPDA 2G7YA 1NB3A 2ATOA 3CH2X 1Q6KA 3HHAA 2R9FA 9PAPA 1NL6A 2J7QA 3BPFA 2R9MA 3H6SA 1BGOA 5JA7A 3PSEA 1PIPA 3D6SA 3N3GA 4YYQA 2FO5A 3OVXA 4CDCB 2HWKA 2FUDA 4N8WA 3RVXA 1EWPA 1CTEA 3F75A 4YV8A 4CDFB 2DOSA 1KXRA 4AXMA 4RF1A 2PNSA 4G54A 2G8JA 4IUMA 2G6DA 1BP4A 4YYWA 2FTDA 4BS6A 1A6RA 4RNAA 1K3BB 1AU2A 2AS8A 3CBJA
chains in the Genus database with same CATH topology
3KSEA 3O0UA 1M6DA 3TNXA 2VFCA 4N4ZA 4BPVA 3RVWA 1F29A 3PDFA 2E01A 4CDDB 5FPWA 2VFBA 4I04A 1CQDA 3LTWA 3IHPA 3PNRA 3IV2A 2ARYA 2NQGA 1AECA 1AYVA 3LXSA 6PADA 1AYUA 1KFUL 3MORA 1CSBB 2OZ2A 3S3RA 1U9QX 1U9WA 4KLBA 1NQCA 1THEA 1PCIA 1ICFA 3I3TA 2FYEA 1X9YA 4P6EA 4QRXA 2OP3A 4FJCA 1QXPA 2DZYA 1SNKA 1MDWA 2VHSA 2JQFR 1POPA 3OISA 1DF0A 4K7CA 1HUCB 3CBKA 1S4VA 5CHVA 2E00A 4BSQA 5A24A 5JH3A 4DMYA 2AYNA 1MEGA 1ME3A 2Y6EA 3BOWA 1U9VA 2YJCA 5K16A 4AXLA 5CVMA 1F2BA 4QRGA 1QMYA 1MHWA 2PREA 2DZZA 2IPPB 4YVAA 1VSNA 3ZUAA 4XR7A 3H7DA 1PADA 1QDQA 3HD3A 1QOLA 3LFYA 2ACTA 4X6JA 4Q8GA 4OEMA 1BY8A 1F2CA 2HXZA 3C9EA 2VHFA 3V6EA 1W5RA 2GFOA 4X6HA 3N3KA 3N4CA 4PP1A 2Y5BA 2FRAA 1SP4B 3E1ZB 2YJ9A 1PXVA 3MHHA 2DC9A 3P5XA 3M99A 7PCKA 1YK7A 2B1NA 1XKGA 4MZSA 1MEMA 3P5UA 1CB5A 3B79A 1KHQA 4BS5A 3WXGA 2P0RA 1GCBA 1YT7A 1AYWA 1EWMA 5CHTA 1W6FA 4FK5A 4DMXA 1AU0A 1U9XA 1Y08A 2DCAA 4YYRA 2E02A 3QT4A 1EWOA 2JQGR 4I05A 3IEJA 4FIPA 1EWLA 1CS8A 1MIRA 1TU6A 2DCCA 2E03A 2R6NA 4PP2E 4OELA 5F02A 4PADA 2P7UA 3K9MA 2NQAA 4MZOA 2YJBA 2DC6A 4MSXA 3WXFA 4RY2A 2R9OA 3OF8A 3OVZA 1STFE 2WBFX 2DJFB 2OULA 1KFXL 3HHIA 2BDLA 1FH0A 2XU5A 1NLJA 3MTNA 4QH6A 3NHEA 1EF7A 2HD5A 3H89A 1PPNA 1Y4HA 1PPOA 1GECE 4YYSA 3PW3A 1BQIA 2NQIA 4CZWA 3BWKA 1VJVA 2NQDB 3BC3A 1CPJA 3IMAA 1YK8A 3KWBX 2G8EA 5J94A 2R9CA 1O0EA 2GHUA 3O1GA 1GX3A 1F2AA 3PBHA 3QJ3A 2CB5A 4XUIA 2YJ8A 2XU3A 4X6IA 4HWYA 1ATKA 4BGFA 1CV8A 2FRQA 4Q8HA 3WXEA 1GLOA 1DEUA 2H7JA 4GUZA 4QRVA 2PBHA 4I07A 5CVOB 1PBHA 5EF4A 4BQVA 2DCDA 2AYOA 2B1MA 2F1GA 4N79A 3V6CA 2DCBA 2BDZA 3KX1A 1AU4A 1CJLA 2P86A 3GCBA 4YYUA 4NV7A 3USVA 2PADA 1TL9A 3BPMA 3BCNA 3CH3X 3D9WA 1NPZA 4ZUXU 1PE6A 2O6XA 4B55A 1JQPA 3P5VA 1ME4A 2FT2A 2AUZA 1YALA 2YJ2A 1W4TA 3QSDA 1CVZA 3RVVA 4W5CA 2XU4A 3U8EA 3IOQA 4WA6A 3KW9A 2DC7A 3ERVA 2FQ9A 3K8UA 4W5BA 2HH5A 1ZCMA 3DF0A 2HHNA 4YYVA 5CVNB 1U5IA 2AU1A 4QBBA 3IUTA 5PADA 3S3QA 3OF9A 1KHPA 2IBIA 1AIMA 4C5PA 1ZIVA 4W4UA 3HWNA 2AUXA 2AIMA 3I06A 3P5WA 2CIOA 3AI8A 1NB5A 3MHSA 1YVBA 3K24A 2R9NA 1MS6A 1PPPA 2F7DA 1GMYA 3H8BA 4P6GA 2C0YA 3KWZA 5EGWA 2AVWA 1AU3A 3H8CA 1TLOA 4CDEB 3F5VA 1ITOA 1E2TA 4PI3A 1IWDA 2XU1A 3KFQA 2DC8A 8PCHA 2DJGB 3KKUA 1PPDA 2G7YA 1NB3A 2ATOA 3CH2X 1Q6KA 3HHAA 2R9FA 9PAPA 1NL6A 3BPFA 2R9MA 3H6SA 1BGOA 5JA7A 1PIPA 3D6SA 3N3GA 4YYQA 2FO5A 3OVXA 4CDCB 2FUDA 4N8WA 3RVXA 1EWPA 4NV8A 1CTEA 3F75A 4YV8A 4CDFB 1KXRA 4AXMA 2PNSA 4G54A 2G8JA 2G6DA 1BP4A 2BSZA 4YYWA 2FTDA 4BS6A 1A6RA 1K3BB 1AU2A 2AS8A 3CBJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KSE A;  3O0U A;  1M6D A;  3TNX A;  4N4Z A;  4BPV A;  3RVW A;  1F29 A;  3PDF A;  2E01 A;  4CDD B;  5FPW A;  4I04 A;  1CQD A;  3IHP A;  3PNR A;  3IV2 A;  2ARY A;  2NQG A;  1AEC A;  1AYV A;  3LXS A;  6PAD A;  1AYU A;  1KFU L;  3MOR A;  1CSB B;  2OZ2 A;  3S3R A;  1U9Q X;  1U9W A;  4KLB A;  1NQC A;  1THE A;  1PCI A;  1ICF A;  3I3T A;  2FYE A;  1X9Y A;  4P6E A;  4QRX A;  2OP3 A;  4FJC A;  1QXP A;  2DZY A;  1SNK A;  1MDW A;  2VHS A;  2JQF R;  1POP A;  3OIS A;  1DF0 A;  4K7C A;  1HUC B;  3CBK A;  1S4V A;  5CHV A;  2E00 A;  4BSQ A;  5A24 A;  5JH3 A;  4DMY A;  2AYN A;  1MEG A;  1ME3 A;  2Y6E A;  3BOW A;  1U9V A;  2YJC A;  5K16 A;  4AXL A;  5CVM A;  1F2B A;  4QRG A;  1QMY A;  1MHW A;  2PRE A;  2DZZ A;  2IPP B;  4YVA A;  1VSN A;  3ZUA A;  4XR7 A;  3H7D A;  1PAD A;  1QDQ A;  3HD3 A;  1QOL A;  3LFY A;  2ACT A;  4X6J A;  4Q8G A;  4OEM A;  1BY8 A;  1F2C A;  2HXZ A;  3C9E A;  2VHF A;  3V6E A;  2GFO A;  4X6H A;  3N3K A;  3N4C A;  4PP1 A;  2Y5B A;  2FRA A;  1SP4 B;  3E1Z B;  2YJ9 A;  1PXV A;  3MHH A;  2DC9 A;  3P5X A;  3M99 A;  7PCK A;  1YK7 A;  2B1N A;  1XKG A;  4MZS A;  1MEM A;  3P5U A;  1CB5 A;  3B79 A;  1KHQ A;  4BS5 A;  3WXG A;  2P0R A;  1GCB A;  1YT7 A;  1AYW A;  1EWM A;  5CHT A;  4FK5 A;  4DMX A;  1AU0 A;  1U9X A;  1Y08 A;  2DCA A;  4YYR A;  2E02 A;  3QT4 A;  1EWO A;  2JQG R;  4I05 A;  3IEJ A;  4FIP A;  1EWL A;  1CS8 A;  1MIR A;  1TU6 A;  2DCC A;  2E03 A;  2R6N A;  4PP2 E;  4OEL A;  5F02 A;  4PAD A;  2P7U A;  3K9M A;  2NQA A;  4MZO A;  2YJB A;  2DC6 A;  4MSX A;  3WXF A;  4RY2 A;  2R9O A;  3OF8 A;  3OVZ A;  1STF E;  2WBF X;  2DJF B;  2OUL A;  1KFX L;  3HHI A;  2BDL A;  1FH0 A;  2XU5 A;  1NLJ A;  3MTN A;  4QH6 A;  3NHE A;  1EF7 A;  2HD5 A;  3H89 A;  1PPN A;  1Y4H A;  1PPO A;  1GEC E;  4YYS A;  3PW3 A;  1BQI A;  2NQI A;  4CZW A;  3BWK A;  1VJV A;  2NQD B;  3BC3 A;  1CPJ A;  3IMA A;  1YK8 A;  3KWB X;  2G8E A;  5J94 A;  2R9C A;  1O0E A;  2GHU A;  3O1G A;  1F2A A;  3PBH A;  3QJ3 A;  2CB5 A;  4XUI A;  2YJ8 A;  2XU3 A;  4X6I A;  4HWY A;  1ATK A;  1CV8 A;  2FRQ A;  4Q8H A;  3WXE A;  1GLO A;  1DEU A;  2H7J A;  4QRV A;  2PBH A;  4I07 A;  5CVO B;  1PBH A;  5EF4 A;  4BQV A;  2DCD A;  2AYO A;  2B1M A;  2F1G A;  4N79 A;  3V6C A;  2DCB A;  2BDZ A;  3KX1 A;  1AU4 A;  1CJL A;  2P86 A;  3GCB A;  4YYU A;  3USV A;  2PAD A;  1TL9 A;  3BPM A;  3BCN A;  3CH3 X;  1NPZ A;  4ZUX U;  1PE6 A;  2O6X A;  1JQP A;  3P5V A;  1ME4 A;  2FT2 A;  2AUZ A;  1YAL A;  2YJ2 A;  3QSD A;  1CVZ A;  3RVV A;  4W5C A;  2XU4 A;  3U8E A;  3IOQ A;  4WA6 A;  3KW9 A;  2DC7 A;  3ERV A;  2FQ9 A;  3K8U A;  4W5B A;  2HH5 A;  1ZCM A;  3DF0 A;  2HHN A;  4YYV A;  5CVN B;  1U5I A;  2AU1 A;  4QBB A;  3IUT A;  5PAD A;  3S3Q A;  3OF9 A;  1KHP A;  2IBI A;  1AIM A;  1ZIV A;  4W4U A;  3HWN A;  2AUX A;  2AIM A;  3I06 A;  3P5W A;  2CIO A;  3AI8 A;  1NB5 A;  3MHS A;  1YVB A;  3K24 A;  2R9N A;  1MS6 A;  1PPP A;  2F7D A;  1GMY A;  3H8B A;  4P6G A;  2C0Y A;  3KWZ A;  5EGW A;  2AVW A;  1AU3 A;  3H8C A;  1TLO A;  4CDE B;  3F5V A;  1ITO A;  4PI3 A;  1IWD A;  2XU1 A;  3KFQ A;  2DC8 A;  8PCH A;  2DJG B;  3KKU A;  1PPD A;  2G7Y A;  1NB3 A;  2ATO A;  3CH2 X;  1Q6K A;  3HHA A;  2R9F A;  9PAP A;  1NL6 A;  3BPF A;  2R9M A;  3H6S A;  1BGO A;  5JA7 A;  1PIP A;  3D6S A;  3N3G A;  4YYQ A;  2FO5 A;  3OVX A;  4CDC B;  2FUD A;  4N8W A;  3RVX A;  1EWP A;  1CTE A;  3F75 A;  4YV8 A;  4CDF B;  1KXR A;  4AXM A;  2PNS A;  4G54 A;  2G8J A;  2G6D A;  1BP4 A;  4YYW A;  2FTD A;  4BS6 A;  1A6R A;  1K3B B;  1AU2 A;  2AS8 A;  3CBJ A; 
#chains in the Genus database with same CATH topology
 3KSE A;  3O0U A;  1M6D A;  3TNX A;  4N4Z A;  4BPV A;  3RVW A;  1F29 A;  3PDF A;  2E01 A;  4CDD B;  5FPW A;  4I04 A;  1CQD A;  3IHP A;  3PNR A;  3IV2 A;  2ARY A;  2NQG A;  1AEC A;  1AYV A;  5EZS A;  4BOP A;  3LXS A;  6PAD A;  1AYU A;  2J7Q C;  1KFU L;  3MOR A;  1CSB B;  2OZ2 A;  3MP2 A;  3S3R A;  1U9Q X;  1U9W A;  4KLB A;  5JZE A;  1NQC A;  1THE A;  1PCI A;  1ICF A;  4RKX A;  3I3T A;  2FYE A;  1X9Y A;  4P6E A;  4QRX A;  2OP3 A;  4FJC A;  1QXP A;  2DZY A;  2BTW B;  4D8I A;  1SNK A;  1MDW A;  2VHS A;  2JQF R;  1POP A;  3OIS A;  1DF0 A;  4K7C A;  1HUC B;  3CBK A;  1S4V A;  5CHV A;  4P16 A;  3W31 A;  2Z84 A;  2E00 A;  3PRP A;  4BSQ A;  4BOQ A;  5A24 A;  5JH3 A;  4DMY A;  2AYN A;  1MEG A;  1ME3 A;  2Y6E A;  3BOW A;  1U9V A;  2FE8 A;  2YJC A;  4REZ A;  5K16 A;  4AXL A;  5CVM A;  2JRI A;  1F2B A;  4QRG A;  1QMY A;  3MJ5 A;  1MHW A;  2PRE A;  4D8E A;  2DZZ A;  2IPP B;  4YVA A;  1VSN A;  3ZUA A;  4XR7 A;  3H7D A;  1PAD A;  1QDQ A;  3HD3 A;  1QOL A;  5E6J A;  3LFY A;  3PHW A;  2ACT A;  4X6J A;  4Q8G A;  4OEM A;  1BY8 A;  1F2C A;  2HXZ A;  3C9E A;  2VHF A;  3V6E A;  4RF0 A;  2GFO A;  4X6H A;  3N3K A;  3N4C A;  4PP1 A;  2JTC A;  4XZX A;  2Y5B A;  4BOS A;  2FRA A;  1SP4 B;  3E1Z B;  2YJ9 A;  4D8B A;  1PXV A;  3MHH A;  3ZNH A;  2DC9 A;  3P5X A;  3M99 A;  7PCK A;  1YK7 A;  2B1N A;  1XKG A;  3BY4 A;  4MZS A;  1MEM A;  3P5U A;  1CB5 A;  3B79 A;  1KHQ A;  4BS5 A;  3WXG A;  3TRK A;  2P0R A;  1PVJ A;  1GCB A;  1YT7 A;  1AYW A;  1DKI A;  1EWM A;  5CHT A;  4ZTB A;  4FK5 A;  4DMX A;  1AU0 A;  1U9X A;  4OVZ A;  1Y08 A;  2DCA A;  4YYR A;  2E02 A;  3QT4 A;  3TMP A;  3C0R A;  1EWO A;  2JQG R;  4I05 A;  3IEJ A;  4FIP A;  1EWL A;  4MM3 B;  1CS8 A;  1MIR A;  1TU6 A;  2DCC A;  2E03 A;  3BBA A;  3B21 A;  2R6N A;  4R3D A;  4PP2 E;  4PT5 A;  4OEL A;  5EZQ A;  5F02 A;  4PAD A;  2P7U A;  3K9M A;  2NQA A;  4MZO A;  2YJB A;  2DC6 A;  4MSX A;  4GUA A;  3WXF A;  4RY2 A;  2AGA A;  2R9O A;  3OF8 A;  3OQC A;  3OVZ A;  1STF E;  2WBF X;  2DJF B;  2OUL A;  1KFX L;  3PHX A;  3HHI A;  2UZJ A;  2BDL A;  1FH0 A;  4WUR A;  2XU5 A;  1NLJ A;  3MTN A;  4QH6 A;  3NHE A;  4OW0 A;  1EF7 A;  2HD5 A;  3H89 A;  1PPN A;  1Y4H A;  1PPO A;  1GEC E;  3RNV A;  4YYS A;  3PW3 A;  1BQI A;  2NQI A;  3PHU A;  4CZW A;  3BWK A;  3W30 A;  1VJV A;  2NQD B;  3O65 A;  3BC3 A;  1CPJ A;  3IMA A;  1YK8 A;  3KWB X;  2G8E A;  5J94 A;  2R9C A;  1O0E A;  2GHU A;  3O1G A;  4HXD B;  1F2A A;  3PBH A;  3QJ3 A;  2CB5 A;  4XUI A;  2YJ8 A;  3PRM A;  2XU3 A;  4X6I A;  4HWY A;  1ATK A;  1CV8 A;  2FRQ A;  4Q8H A;  3WXE A;  1GLO A;  1DEU A;  1YZB A;  2H7J A;  4QRV A;  2PBH A;  4I07 A;  5CVO B;  1PBH A;  3IFU A;  5EF4 A;  4BQV A;  2DCD A;  2AYO A;  2B1M A;  2F1G A;  4N79 A;  3V6C A;  2DCB A;  2BDZ A;  3KX1 A;  1AU4 A;  4A5U A;  1CJL A;  2P86 A;  3GCB A;  4YYU A;  4IP3 A;  3USV A;  2PAD A;  1TL9 A;  3BPM A;  3BCN A;  3MTV A;  3CH3 X;  1NPZ A;  3BB7 A;  4ZUX U;  1PE6 A;  2O6X A;  1JQP A;  3P5V A;  1ME4 A;  2FT2 A;  2AUZ A;  1YAL A;  2YJ2 A;  3QSD A;  1CVZ A;  3RVV A;  2BU3 A;  4W5C A;  2XU4 A;  3U8E A;  3IOQ A;  4WA6 A;  3KW9 A;  2DC7 A;  3ERV A;  2FQ9 A;  3K8U A;  4OVZ B;  4W5B A;  2HH5 A;  1ZCM A;  3DF0 A;  2HHN A;  4YYV A;  5KO3 A;  5CVN B;  1U5I A;  2AU1 A;  4QBB A;  3IUT A;  4BOU A;  5PAD A;  3S3Q A;  3OF9 A;  1KHP A;  2IBI A;  1AIM A;  1ZIV A;  3E9S A;  4W4U A;  3HWN A;  2AUX A;  2AIM A;  3I06 A;  3P5W A;  1UKF A;  2CIO A;  3AI8 A;  1NB5 A;  3MHS A;  1YVB A;  3K24 A;  4BOZ A;  2R9N A;  1MS6 A;  1PPP A;  2BTW A;  2F7D A;  1GMY A;  3H8B A;  4P6G A;  2C0Y A;  3KWZ A;  5EGW A;  2AVW A;  1AU3 A;  4M0W A;  3H8C A;  1TLO A;  3PT2 A;  4CDE B;  4MI7 A;  3F5V A;  1ITO A;  4PI3 A;  1IWD A;  2XU1 A;  3KFQ A;  2DC8 A;  8PCH A;  2DJG B;  3KKU A;  1PPD A;  2G7Y A;  1NB3 A;  2ATO A;  3CH2 X;  1Q6K A;  3HHA A;  2R9F A;  9PAP A;  1NL6 A;  2J7Q A;  3BPF A;  2R9M A;  3H6S A;  1BGO A;  5JA7 A;  3PSE A;  1PIP A;  3D6S A;  3N3G A;  4YYQ A;  2FO5 A;  3OVX A;  4CDC B;  2HWK A;  2FUD A;  4N8W A;  3RVX A;  1EWP A;  1CTE A;  3F75 A;  4YV8 A;  4CDF B;  2DOS A;  1KXR A;  4AXM A;  4RF1 A;  2PNS A;  4G54 A;  2G8J A;  4IUM A;  2G6D A;  1BP4 A;  4YYW A;  2FTD A;  4BS6 A;  1A6R A;  4RNA A;  1K3B B;  1AU2 A;  2AS8 A;  3CBJ A; 
#chains in the Genus database with same CATH homology
 3KSE A;  3O0U A;  1M6D A;  3TNX A;  2VFC A;  4N4Z A;  4BPV A;  3RVW A;  1F29 A;  3PDF A;  2E01 A;  4CDD B;  5FPW A;  2VFB A;  4I04 A;  1CQD A;  3LTW A;  3IHP A;  3PNR A;  3IV2 A;  2ARY A;  2NQG A;  1AEC A;  1AYV A;  3LXS A;  6PAD A;  1AYU A;  1KFU L;  3MOR A;  1CSB B;  2OZ2 A;  3S3R A;  1U9Q X;  1U9W A;  4KLB A;  1NQC A;  1THE A;  1PCI A;  1ICF A;  3I3T A;  2FYE A;  1X9Y A;  4P6E A;  4QRX A;  2OP3 A;  4FJC A;  1QXP A;  2DZY A;  1SNK A;  1MDW A;  2VHS A;  2JQF R;  1POP A;  3OIS A;  1DF0 A;  4K7C A;  1HUC B;  3CBK A;  1S4V A;  5CHV A;  2E00 A;  4BSQ A;  5A24 A;  5JH3 A;  4DMY A;  2AYN A;  1MEG A;  1ME3 A;  2Y6E A;  3BOW A;  1U9V A;  2YJC A;  5K16 A;  4AXL A;  5CVM A;  1F2B A;  4QRG A;  1QMY A;  1MHW A;  2PRE A;  2DZZ A;  2IPP B;  4YVA A;  1VSN A;  3ZUA A;  4XR7 A;  3H7D A;  1PAD A;  1QDQ A;  3HD3 A;  1QOL A;  3LFY A;  2ACT A;  4X6J A;  4Q8G A;  4OEM A;  1BY8 A;  1F2C A;  2HXZ A;  3C9E A;  2VHF A;  3V6E A;  1W5R A;  2GFO A;  4X6H A;  3N3K A;  3N4C A;  4PP1 A;  2Y5B A;  2FRA A;  1SP4 B;  3E1Z B;  2YJ9 A;  1PXV A;  3MHH A;  2DC9 A;  3P5X A;  3M99 A;  7PCK A;  1YK7 A;  2B1N A;  1XKG A;  4MZS A;  1MEM A;  3P5U A;  1CB5 A;  3B79 A;  1KHQ A;  4BS5 A;  3WXG A;  2P0R A;  1GCB A;  1YT7 A;  1AYW A;  1EWM A;  5CHT A;  1W6F A;  4FK5 A;  4DMX A;  1AU0 A;  1U9X A;  1Y08 A;  2DCA A;  4YYR A;  2E02 A;  3QT4 A;  1EWO A;  2JQG R;  4I05 A;  3IEJ A;  4FIP A;  1EWL A;  1CS8 A;  1MIR A;  1TU6 A;  2DCC A;  2E03 A;  2R6N A;  4PP2 E;  4OEL A;  5F02 A;  4PAD A;  2P7U A;  3K9M A;  2NQA A;  4MZO A;  2YJB A;  2DC6 A;  4MSX A;  3WXF A;  4RY2 A;  2R9O A;  3OF8 A;  3OVZ A;  1STF E;  2WBF X;  2DJF B;  2OUL A;  1KFX L;  3HHI A;  2BDL A;  1FH0 A;  2XU5 A;  1NLJ A;  3MTN A;  4QH6 A;  3NHE A;  1EF7 A;  2HD5 A;  3H89 A;  1PPN A;  1Y4H A;  1PPO A;  1GEC E;  4YYS A;  3PW3 A;  1BQI A;  2NQI A;  4CZW A;  3BWK A;  1VJV A;  2NQD B;  3BC3 A;  1CPJ A;  3IMA A;  1YK8 A;  3KWB X;  2G8E A;  5J94 A;  2R9C A;  1O0E A;  2GHU A;  3O1G A;  1GX3 A;  1F2A A;  3PBH A;  3QJ3 A;  2CB5 A;  4XUI A;  2YJ8 A;  2XU3 A;  4X6I A;  4HWY A;  1ATK A;  4BGF A;  1CV8 A;  2FRQ A;  4Q8H A;  3WXE A;  1GLO A;  1DEU A;  2H7J A;  4GUZ A;  4QRV A;  2PBH A;  4I07 A;  5CVO B;  1PBH A;  5EF4 A;  4BQV A;  2DCD A;  2AYO A;  2B1M A;  2F1G A;  4N79 A;  3V6C A;  2DCB A;  2BDZ A;  3KX1 A;  1AU4 A;  1CJL A;  2P86 A;  3GCB A;  4YYU A;  4NV7 A;  3USV A;  2PAD A;  1TL9 A;  3BPM A;  3BCN A;  3CH3 X;  3D9W A;  1NPZ A;  4ZUX U;  1PE6 A;  2O6X A;  4B55 A;  1JQP A;  3P5V A;  1ME4 A;  2FT2 A;  2AUZ A;  1YAL A;  2YJ2 A;  1W4T A;  3QSD A;  1CVZ A;  3RVV A;  4W5C A;  2XU4 A;  3U8E A;  3IOQ A;  4WA6 A;  3KW9 A;  2DC7 A;  3ERV A;  2FQ9 A;  3K8U A;  4W5B A;  2HH5 A;  1ZCM A;  3DF0 A;  2HHN A;  4YYV A;  5CVN B;  1U5I A;  2AU1 A;  4QBB A;  3IUT A;  5PAD A;  3S3Q A;  3OF9 A;  1KHP A;  2IBI A;  1AIM A;  4C5P A;  1ZIV A;  4W4U A;  3HWN A;  2AUX A;  2AIM A;  3I06 A;  3P5W A;  2CIO A;  3AI8 A;  1NB5 A;  3MHS A;  1YVB A;  3K24 A;  2R9N A;  1MS6 A;  1PPP A;  2F7D A;  1GMY A;  3H8B A;  4P6G A;  2C0Y A;  3KWZ A;  5EGW A;  2AVW A;  1AU3 A;  3H8C A;  1TLO A;  4CDE B;  3F5V A;  1ITO A;  1E2T A;  4PI3 A;  1IWD A;  2XU1 A;  3KFQ A;  2DC8 A;  8PCH A;  2DJG B;  3KKU A;  1PPD A;  2G7Y A;  1NB3 A;  2ATO A;  3CH2 X;  1Q6K A;  3HHA A;  2R9F A;  9PAP A;  1NL6 A;  3BPF A;  2R9M A;  3H6S A;  1BGO A;  5JA7 A;  1PIP A;  3D6S A;  3N3G A;  4YYQ A;  2FO5 A;  3OVX A;  4CDC B;  2FUD A;  4N8W A;  3RVX A;  1EWP A;  4NV8 A;  1CTE A;  3F75 A;  4YV8 A;  4CDF B;  1KXR A;  4AXM A;  2PNS A;  4G54 A;  2G8J A;  2G6D A;  1BP4 A;  2BSZ A;  4YYW A;  2FTD A;  4BS6 A;  1A6R A;  1K3B B;  1AU2 A;  2AS8 A;  3CBJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...