3KWZA

Cathepsin k in complex with a non-selective 2-cyano-pyrimidine inhibitor
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
215
structure length
215
Chain Sequence
APDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Cathepsin K
publication title Design and optimization of a series of novel 2-cyano-pyrimidines as cathepsin K inhibitors
pubmed doi rcsb
source organism Homo sapiens
total genus 62
structure length 215
sequence length 215
ec nomenclature ec 3.4.22.38: Cathepsin K.
pdb deposition date 2009-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3kwzA00
1YVBA 1VJVA 5J94A 2PREA 2JQFR 3H89A 3OF8A 2AIMA 1YALA 3O1GA 3B79A 4Q8HA 1CS8A 1QXPA 3BPMA 6PADA 4P6EA 1CPJA 4ZUXU 3MTNA 2JQGR 3U8EA 3H8BA 1AU2A 3N3KA 3P5WA 3IV2A 3IHPA 1ZCMA 1POPA 3IMAA 4P6GA 4YVAA 4RY2A 3S3RA 2DC9A 1BY8A 5A24A 2XU4A 2O6XA 3K9MA 1Q6KA 1QOLA 1S4VA 2DC7A 1PBHA 1GECE 3ZUAA 2YJ8A 2E00A 4I04A 3KFQA 1GCBA 3V6CA 4BS6A 1PPOA 2E03A 1CJLA 1MEMA 2FT2A 2R9OA 2AYOA 3KX1A 4DMXA 1MDWA 1Y08A 4YYQA 3OVZA 3F5VA 1PE6A 4XR7A 3S3QA 4YYWA 2DCCA 2FUDA 3N4CA 4YV8A 4AXMA 4N79A 3CBJA 2OULA 4YYSA 3OVXA 2R9NA 1AIMA 3MORA 2G8JA 2HXZA 3BC3A 5JH3A 1PPPA 1F2BA 2E02A 3I3TA 3O0UA 4KLBA 1CB5A 4PADA 4QH6A 2R9CA 2IPPB 3F75A 1AYUA 1U9XA 1VSNA 3P5XA 5CVOB 2PNSA 2WBFX 4OELA 4BS5A 4X6HA 1NQCA 2DZYA 3PDFA 1CTEA 4HWYA 3GCBA 1ICFA 1KXRA 1PADA 3D6SA 3HWNA 3KKUA 4X6JA 3TNXA 3PW3A 4DMYA 2Y6EA 2AUXA 2FTDA 5CHVA 5EF4A 2DC6A 3DF0A 3HHAA 2VHSA 3BCNA 1A6RA 1M6DA 1PCIA 2XU1A 3KWBX 1YK7A 3AI8A 2DC8A 1KFXL 1BQIA 2AUZA 2B1NA 9PAPA 3MHHA 5CVNB 3WXEA 4PP2E 3H6SA 1KHPA 4N4ZA 3NHEA 4BQVA 1PXVA 4CZWA 4QRGA 1SNKA 5JA7A 4I05A 3OF9A 2R9FA 4MSXA 1EWOA 3HHIA 2YJ2A 2DJFB 2FRAA 2H7JA 4CDDB 1X9YA 5F02A 3LXSA 1EWLA 2F1GA 2GHUA 1FH0A 1TLOA 3KWZA 3IEJA 2HH5A 1NPZA 1MEGA 3KSEA 2DCAA 3HD3A 1JQPA 1NLJA 7PCKA 2FO5A 1STFE 1AECA 5FPWA 1NL6A 2P86A 1YK8A 1CQDA 2HHNA 4Q8GA 1F2AA 1ME3A 1MS6A 4FK5A 3WXFA 4YYVA 1ME4A 3H8CA 2FQ9A 4OEMA 3QSDA 4YYUA 1K3BB 4WA6A 3RVWA 1IWDA 5CHTA 1DF0A 3BWKA 3PBHA 2BDLA 2AU1A 4CDCB 3K24A 2OP3A 1PIPA 1MIRA 1ATKA 2DCDA 2DZZA 1PPNA 2YJCA 2AYNA 3ERVA 2AS8A 2E01A 3C9EA 5K16A 1THEA 4W5BA 1KFUL 1NB5A 1U9VA 2OZ2A 2HD5A 4CDEB 4QRVA 2XU3A 1AU3A 3I06A 2C0YA 2PADA 1U9QX 2CIOA 1TL9A 4BSQA 4I07A 1SP4B 3IOQA 1F29A 5PADA 4FIPA 4PP1A 3BOWA 4QBBA 4MZSA 4N8WA 2Y5BA 2ATOA 4MZOA 2PBHA 1CSBB 2VHFA 2NQAA 2FRQA 2IBIA 1KHQA 1ZIVA 4W5CA 4YYRA 1HUCB 3P5VA 3LFYA 2F7DA 3P5UA 4CDFB 2GFOA 8PCHA 1YT7A 4X6IA 4FJCA 1XKGA 2G8EA 1PPDA 1AYWA 1O0EA 4AXLA 2G7YA 2R6NA 3V6EA 3QT4A 2CB5A 1AU4A 2R9MA 2YJBA 1F2CA 3PNRA 1QDQA 2P7UA 4K7CA 4W4UA 3QJ3A 5EGWA 2NQDB 2NQGA 1MHWA 2DCBA 1BGOA 1U5IA 1CVZA 3CBKA 1AU0A 1DEUA 2XU5A 2ARYA 2YJ9A 3CH2X 2NQIA 2ACTA 3CH3X 1NB3A 2FYEA 1TU6A 2P0RA 3OISA 3KW9A 1EF7A 4XUIA 1BP4A 3K8UA 1U9WA 4PI3A 1QMYA 3RVVA 3RVXA 1AYVA 2AVWA 3H7DA 1EWMA 1Y4HA 3IUTA 4G54A 1CV8A 1EWPA 4BPVA 4QRXA 3N3GA 2B1MA 3M99A 5CVMA 3USVA 3WXGA 1ITOA 3BPFA 2DJGB 2BDZA 1GLOA 3E1ZB 2G6DA 1GMYA 3MHSA
chains in the Genus database with same CATH superfamily
1YVBA 3RNVA 1VJVA 5J94A 2PREA 2JQFR 3H89A 3OF8A 2AIMA 1YALA 3O1GA 3B79A 4Q8HA 1CS8A 1QXPA 3BPMA 4IP3A 6PADA 4P6EA 1CPJA 4ZUXU 3MTNA 2JQGR 4RKXA 3U8EA 3H8BA 1AU2A 3N3KA 3P5WA 3IV2A 3IHPA 1ZCMA 5JZEA 1POPA 3IMAA 4P6GA 4YVAA 4RY2A 3S3RA 2DC9A 1BY8A 5A24A 2XU4A 2O6XA 3K9MA 1Q6KA 1QOLA 1S4VA 2DC7A 5EZSA 1PBHA 1GECE 3ZUAA 2YJ8A 2E00A 4I04A 3KFQA 5EZQA 1GCBA 3MTVA 3V6CA 4BS6A 1PPOA 2E03A 1CJLA 4RF1A 1MEMA 2FT2A 2R9OA 2AYOA 3KX1A 4DMXA 1MDWA 1Y08A 4YYQA 3OVZA 3F5VA 4D8EA 1PE6A 4XR7A 3S3QA 4HXDB 4D8BA 4YYWA 2DCCA 2FUDA 3N4CA 4YV8A 4AXMA 4N79A 3CBJA 2OULA 3BB7A 2Z84A 4YYSA 3OVXA 2R9NA 1AIMA 3MORA 2G8JA 2HXZA 3BC3A 5JH3A 1PPPA 1F2BA 2E02A 3OQCA 3I3TA 3O0UA 4PT5A 4KLBA 1CB5A 4PADA 3PT2A 4QH6A 2R9CA 2IPPB 3F75A 1AYUA 1U9XA 1VSNA 3P5XA 5CVOB 2PNSA 2WBFX 3BY4A 4OELA 4BS5A 4X6HA 1NQCA 2DZYA 3PDFA 1CTEA 4OVZB 4HWYA 3GCBA 1ICFA 4BOPA 1KXRA 3W30A 1PADA 3D6SA 3HWNA 3KKUA 4X6JA 2AGAA 3TNXA 4BOZA 3PW3A 4DMYA 2Y6EA 2AUXA 2FTDA 1PVJA 3E9SA 2DC6A 5CHVA 5EF4A 1DKIA 5KO3A 3DF0A 3HHAA 2VHSA 3BBAA 3BCNA 1A6RA 1M6DA 1PCIA 2XU1A 3KWBX 1YK7A 3AI8A 2DC8A 1KFXL 2JTCA 4D8IA 5E6JA 1BQIA 2AUZA 2B1NA 9PAPA 3MHHA 5CVNB 3WXEA 4PP2E 3H6SA 1KHPA 3PSEA 3PRPA 4N4ZA 3NHEA 4BQVA 1PXVA 4CZWA 4QRGA 2JRIA 1SNKA 5JA7A 4I05A 3OF9A 4REZA 2R9FA 3IFUA 4MSXA 1EWOA 3HHIA 4BOSA 2YJ2A 2DJFB 4GUAA 2FRAA 2H7JA 4CDDB 1X9YA 2J7QA 5F02A 3LXSA 1EWLA 2F1GA 2GHUA 1FH0A 1TLOA 3KWZA 3IEJA 2HH5A 1NPZA 1MEGA 3KSEA 4IUMA 2DCAA 3HD3A 3MP2A 1JQPA 1NLJA 3TMPA 7PCKA 2FO5A 1STFE 3O65A 1AECA 5FPWA 1NL6A 2HWKA 2P86A 1YK8A 1CQDA 2HHNA 3PHXA 4Q8GA 1F2AA 3B21A 1ME3A 1MS6A 4FK5A 3WXFA 4YYVA 3C0RA 1ME4A 3H8CA 1YZBA 2FQ9A 4OEMA 3QSDA 4YYUA 1K3BB 4WA6A 3RVWA 4XZXA 1IWDA 5CHTA 1DF0A 3BWKA 4P16A 3PRMA 3PBHA 2BDLA 1UKFA 4BOUA 2AU1A 4CDCB 3K24A 2OP3A 1PIPA 1MIRA 4OVZA 1ATKA 2DCDA 2DZZA 1PPNA 2YJCA 2AYNA 3ERVA 2AS8A 2E01A 3C9EA 5K16A 4RNAA 3W31A 1THEA 4W5BA 1KFUL 1NB5A 1U9VA 2BTWB 2OZ2A 2HD5A 4CDEB 4QRVA 2XU3A 1AU3A 2UZJA 3I06A 2C0YA 2PADA 1U9QX 2CIOA 1TL9A 4BSQA 4I07A 1SP4B 3IOQA 1F29A 5PADA 4FIPA 4PP1A 3BOWA 4QBBA 4MZSA 4N8WA 2Y5BA 2ATOA 4ZTBA 4MZOA 2PBHA 1CSBB 2VHFA 2NQAA 2FRQA 2IBIA 1KHQA 3ZNHA 1ZIVA 4W5CA 4MM3B 4R3DA 4YYRA 1HUCB 3P5VA 3LFYA 2F7DA 3P5UA 4CDFB 2GFOA 8PCHA 1YT7A 4X6IA 4FJCA 1XKGA 4MI7A 2G8EA 1PPDA 1AYWA 1O0EA 4AXLA 2G7YA 2R6NA 3V6EA 3MJ5A 2CB5A 3PHUA 3QT4A 1AU4A 2R9MA 2YJBA 2FE8A 4OW0A 1F2CA 3PNRA 1QDQA 2P7UA 4K7CA 4W4UA 3QJ3A 5EGWA 2NQDB 2NQGA 1MHWA 4A5UA 2DCBA 1BGOA 1U5IA 1CVZA 3PHWA 3CBKA 4M0WA 1AU0A 1DEUA 2XU5A 2ARYA 2YJ9A 3CH2X 2NQIA 2ACTA 3CH3X 1NB3A 2FYEA 1TU6A 3TRKA 2P0RA 3OISA 3KW9A 1EF7A 4XUIA 1BP4A 3K8UA 1U9WA 2J7QC 1QMYA 4PI3A 3RVVA 2BU3A 4WURA 3RVXA 1AYVA 4BOQA 2AVWA 3H7DA 1EWMA 1Y4HA 3IUTA 4G54A 1CV8A 1EWPA 4BPVA 2BTWA 4QRXA 3N3GA 2B1MA 3M99A 5CVMA 3USVA 3WXGA 1ITOA 2DOSA 3BPFA 2DJGB 4RF0A 2BDZA 1GLOA 3E1ZB 2G6DA 1GMYA 3MHSA
chains in the Genus database with same CATH topology
1YVBA 1VJVA 5J94A 2PREA 2JQFR 3H89A 3OF8A 2AIMA 1YALA 3O1GA 3B79A 4Q8HA 1CS8A 1QXPA 3BPMA 6PADA 4P6EA 1CPJA 4ZUXU 3MTNA 2JQGR 3U8EA 3H8BA 1AU2A 3N3KA 3P5WA 3IV2A 3IHPA 1ZCMA 1POPA 3IMAA 4P6GA 4YVAA 4RY2A 3S3RA 2DC9A 1BY8A 5A24A 2XU4A 1E2TA 2O6XA 3K9MA 1Q6KA 1QOLA 1S4VA 2DC7A 1PBHA 1GECE 3ZUAA 2YJ8A 2E00A 4I04A 3KFQA 1GCBA 3V6CA 4BS6A 1PPOA 2E03A 3LTWA 1CJLA 1MEMA 1W5RA 2FT2A 2R9OA 2AYOA 3KX1A 4DMXA 1MDWA 1Y08A 4YYQA 3OVZA 3F5VA 1PE6A 4XR7A 3S3QA 4YYWA 2DCCA 2FUDA 3N4CA 4YV8A 4AXMA 4N79A 3CBJA 2OULA 4YYSA 3OVXA 2R9NA 1AIMA 3MORA 2G8JA 2HXZA 3BC3A 5JH3A 1PPPA 1F2BA 2E02A 3I3TA 3O0UA 4KLBA 1CB5A 4PADA 4QH6A 2R9CA 2IPPB 3F75A 1AYUA 1U9XA 1VSNA 3P5XA 5CVOB 2PNSA 2WBFX 4OELA 4BS5A 4X6HA 1NQCA 2DZYA 3PDFA 1CTEA 4HWYA 3GCBA 4B55A 1ICFA 1KXRA 1PADA 3D6SA 3HWNA 3KKUA 4X6JA 3TNXA 3PW3A 4DMYA 2Y6EA 2AUXA 2FTDA 5CHVA 5EF4A 2DC6A 3DF0A 3HHAA 2VHSA 3BCNA 1A6RA 1M6DA 1PCIA 2XU1A 2VFCA 3KWBX 1YK7A 3AI8A 2DC8A 1KFXL 1BQIA 2AUZA 2B1NA 9PAPA 3MHHA 5CVNB 3WXEA 4PP2E 3H6SA 1KHPA 4N4ZA 3NHEA 4BQVA 1PXVA 4CZWA 4QRGA 1SNKA 5JA7A 4I05A 3OF9A 2R9FA 4MSXA 1EWOA 3HHIA 2YJ2A 2DJFB 4NV8A 2FRAA 2H7JA 4CDDB 1X9YA 5F02A 3LXSA 1EWLA 2F1GA 2GHUA 1FH0A 1TLOA 3KWZA 3IEJA 2HH5A 1NPZA 1MEGA 3KSEA 2DCAA 3HD3A 1JQPA 1NLJA 7PCKA 2FO5A 1STFE 1AECA 5FPWA 1NL6A 2P86A 1YK8A 1CQDA 2HHNA 4Q8GA 1F2AA 1ME3A 1MS6A 4FK5A 3WXFA 4YYVA 1ME4A 3H8CA 2FQ9A 4OEMA 3QSDA 4YYUA 1K3BB 4WA6A 3RVWA 1GX3A 1IWDA 5CHTA 3D9WA 1DF0A 3BWKA 3PBHA 2BDLA 2AU1A 4CDCB 3K24A 2OP3A 1PIPA 1MIRA 1ATKA 2DCDA 2DZZA 1PPNA 2YJCA 2AYNA 3ERVA 2AS8A 2E01A 3C9EA 5K16A 4BGFA 1THEA 4W5BA 1KFUL 1NB5A 1U9VA 2OZ2A 2HD5A 4CDEB 4QRVA 2XU3A 1AU3A 3I06A 2C0YA 2PADA 4NV7A 1U9QX 2CIOA 1TL9A 4BSQA 4I07A 1SP4B 3IOQA 1F29A 5PADA 4FIPA 4PP1A 3BOWA 4QBBA 4MZSA 4N8WA 2Y5BA 2ATOA 4MZOA 2PBHA 1CSBB 2VHFA 4C5PA 2NQAA 2FRQA 2IBIA 1KHQA 1ZIVA 4W5CA 4YYRA 1HUCB 3P5VA 3LFYA 2F7DA 3P5UA 4CDFB 2GFOA 8PCHA 1YT7A 4X6IA 4FJCA 1XKGA 2G8EA 1PPDA 1AYWA 1W4TA 1O0EA 4AXLA 2G7YA 2R6NA 3V6EA 3QT4A 2CB5A 1AU4A 2R9MA 2YJBA 1F2CA 3PNRA 1QDQA 2P7UA 4K7CA 4W4UA 3QJ3A 5EGWA 2NQDB 2NQGA 1MHWA 2DCBA 1BGOA 1U5IA 1CVZA 3CBKA 1AU0A 1DEUA 2XU5A 2ARYA 2YJ9A 3CH2X 2NQIA 2ACTA 3CH3X 1NB3A 2FYEA 1TU6A 2VFBA 2P0RA 3OISA 3KW9A 1EF7A 4XUIA 1BP4A 3K8UA 1U9WA 4PI3A 1QMYA 3RVVA 3RVXA 1AYVA 2AVWA 3H7DA 1EWMA 1Y4HA 2BSZA 3IUTA 4G54A 1CV8A 1EWPA 4BPVA 4QRXA 3N3GA 4GUZA 2B1MA 3M99A 5CVMA 3USVA 3WXGA 1ITOA 1W6FA 3BPFA 2DJGB 2BDZA 1GLOA 3E1ZB 2G6DA 1GMYA 3MHSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YVB A;  1VJV A;  5J94 A;  2PRE A;  2JQF R;  3H89 A;  3OF8 A;  2AIM A;  1YAL A;  3O1G A;  3B79 A;  4Q8H A;  1CS8 A;  1QXP A;  3BPM A;  6PAD A;  4P6E A;  1CPJ A;  4ZUX U;  3MTN A;  2JQG R;  3U8E A;  3H8B A;  1AU2 A;  3N3K A;  3P5W A;  3IV2 A;  3IHP A;  1ZCM A;  1POP A;  3IMA A;  4P6G A;  4YVA A;  4RY2 A;  3S3R A;  2DC9 A;  1BY8 A;  5A24 A;  2XU4 A;  2O6X A;  3K9M A;  1Q6K A;  1QOL A;  1S4V A;  2DC7 A;  1PBH A;  1GEC E;  3ZUA A;  2YJ8 A;  2E00 A;  4I04 A;  3KFQ A;  1GCB A;  3V6C A;  4BS6 A;  1PPO A;  2E03 A;  1CJL A;  1MEM A;  2FT2 A;  2R9O A;  2AYO A;  3KX1 A;  4DMX A;  1MDW A;  1Y08 A;  4YYQ A;  3OVZ A;  3F5V A;  1PE6 A;  4XR7 A;  3S3Q A;  4YYW A;  2DCC A;  2FUD A;  3N4C A;  4YV8 A;  4AXM A;  4N79 A;  3CBJ A;  2OUL A;  4YYS A;  3OVX A;  2R9N A;  1AIM A;  3MOR A;  2G8J A;  2HXZ A;  3BC3 A;  5JH3 A;  1PPP A;  1F2B A;  2E02 A;  3I3T A;  3O0U A;  4KLB A;  1CB5 A;  4PAD A;  4QH6 A;  2R9C A;  2IPP B;  3F75 A;  1AYU A;  1U9X A;  1VSN A;  3P5X A;  5CVO B;  2PNS A;  2WBF X;  4OEL A;  4BS5 A;  4X6H A;  1NQC A;  2DZY A;  3PDF A;  1CTE A;  4HWY A;  3GCB A;  1ICF A;  1KXR A;  1PAD A;  3D6S A;  3HWN A;  3KKU A;  4X6J A;  3TNX A;  3PW3 A;  4DMY A;  2Y6E A;  2AUX A;  2FTD A;  5CHV A;  5EF4 A;  2DC6 A;  3DF0 A;  3HHA A;  2VHS A;  3BCN A;  1A6R A;  1M6D A;  1PCI A;  2XU1 A;  3KWB X;  1YK7 A;  3AI8 A;  2DC8 A;  1KFX L;  1BQI A;  2AUZ A;  2B1N A;  9PAP A;  3MHH A;  5CVN B;  3WXE A;  4PP2 E;  3H6S A;  1KHP A;  4N4Z A;  3NHE A;  4BQV A;  1PXV A;  4CZW A;  4QRG A;  1SNK A;  5JA7 A;  4I05 A;  3OF9 A;  2R9F A;  4MSX A;  1EWO A;  3HHI A;  2YJ2 A;  2DJF B;  2FRA A;  2H7J A;  4CDD B;  1X9Y A;  5F02 A;  3LXS A;  1EWL A;  2F1G A;  2GHU A;  1FH0 A;  1TLO A;  3KWZ A;  3IEJ A;  2HH5 A;  1NPZ A;  1MEG A;  3KSE A;  2DCA A;  3HD3 A;  1JQP A;  1NLJ A;  7PCK A;  2FO5 A;  1STF E;  1AEC A;  5FPW A;  1NL6 A;  2P86 A;  1YK8 A;  1CQD A;  2HHN A;  4Q8G A;  1F2A A;  1ME3 A;  1MS6 A;  4FK5 A;  3WXF A;  4YYV A;  1ME4 A;  3H8C A;  2FQ9 A;  4OEM A;  3QSD A;  4YYU A;  1K3B B;  4WA6 A;  3RVW A;  1IWD A;  5CHT A;  1DF0 A;  3BWK A;  3PBH A;  2BDL A;  2AU1 A;  4CDC B;  3K24 A;  2OP3 A;  1PIP A;  1MIR A;  1ATK A;  2DCD A;  2DZZ A;  1PPN A;  2YJC A;  2AYN A;  3ERV A;  2AS8 A;  2E01 A;  3C9E A;  5K16 A;  1THE A;  4W5B A;  1KFU L;  1NB5 A;  1U9V A;  2OZ2 A;  2HD5 A;  4CDE B;  4QRV A;  2XU3 A;  1AU3 A;  3I06 A;  2C0Y A;  2PAD A;  1U9Q X;  2CIO A;  1TL9 A;  4BSQ A;  4I07 A;  1SP4 B;  3IOQ A;  1F29 A;  5PAD A;  4FIP A;  4PP1 A;  3BOW A;  4QBB A;  4MZS A;  4N8W A;  2Y5B A;  2ATO A;  4MZO A;  2PBH A;  1CSB B;  2VHF A;  2NQA A;  2FRQ A;  2IBI A;  1KHQ A;  1ZIV A;  4W5C A;  4YYR A;  1HUC B;  3P5V A;  3LFY A;  2F7D A;  3P5U A;  4CDF B;  2GFO A;  8PCH A;  1YT7 A;  4X6I A;  4FJC A;  1XKG A;  2G8E A;  1PPD A;  1AYW A;  1O0E A;  4AXL A;  2G7Y A;  2R6N A;  3V6E A;  3QT4 A;  2CB5 A;  1AU4 A;  2R9M A;  2YJB A;  1F2C A;  3PNR A;  1QDQ A;  2P7U A;  4K7C A;  4W4U A;  3QJ3 A;  5EGW A;  2NQD B;  2NQG A;  1MHW A;  2DCB A;  1BGO A;  1U5I A;  1CVZ A;  3CBK A;  1AU0 A;  1DEU A;  2XU5 A;  2ARY A;  2YJ9 A;  3CH2 X;  2NQI A;  2ACT A;  3CH3 X;  1NB3 A;  2FYE A;  1TU6 A;  2P0R A;  3OIS A;  3KW9 A;  1EF7 A;  4XUI A;  1BP4 A;  3K8U A;  1U9W A;  4PI3 A;  1QMY A;  3RVV A;  3RVX A;  1AYV A;  2AVW A;  3H7D A;  1EWM A;  1Y4H A;  3IUT A;  4G54 A;  1CV8 A;  1EWP A;  4BPV A;  4QRX A;  3N3G A;  2B1M A;  3M99 A;  5CVM A;  3USV A;  3WXG A;  1ITO A;  3BPF A;  2DJG B;  2BDZ A;  1GLO A;  3E1Z B;  2G6D A;  1GMY A;  3MHS A; 
#chains in the Genus database with same CATH topology
 1YVB A;  3RNV A;  1VJV A;  5J94 A;  2PRE A;  2JQF R;  3H89 A;  3OF8 A;  2AIM A;  1YAL A;  3O1G A;  3B79 A;  4Q8H A;  1CS8 A;  1QXP A;  3BPM A;  4IP3 A;  6PAD A;  4P6E A;  1CPJ A;  4ZUX U;  3MTN A;  2JQG R;  4RKX A;  3U8E A;  3H8B A;  1AU2 A;  3N3K A;  3P5W A;  3IV2 A;  3IHP A;  1ZCM A;  5JZE A;  1POP A;  3IMA A;  4P6G A;  4YVA A;  4RY2 A;  3S3R A;  2DC9 A;  1BY8 A;  5A24 A;  2XU4 A;  2O6X A;  3K9M A;  1Q6K A;  1QOL A;  1S4V A;  2DC7 A;  5EZS A;  1PBH A;  1GEC E;  3ZUA A;  2YJ8 A;  2E00 A;  4I04 A;  3KFQ A;  5EZQ A;  1GCB A;  3MTV A;  3V6C A;  4BS6 A;  1PPO A;  2E03 A;  1CJL A;  4RF1 A;  1MEM A;  2FT2 A;  2R9O A;  2AYO A;  3KX1 A;  4DMX A;  1MDW A;  1Y08 A;  4YYQ A;  3OVZ A;  3F5V A;  4D8E A;  1PE6 A;  4XR7 A;  3S3Q A;  4HXD B;  4D8B A;  4YYW A;  2DCC A;  2FUD A;  3N4C A;  4YV8 A;  4AXM A;  4N79 A;  3CBJ A;  2OUL A;  3BB7 A;  2Z84 A;  4YYS A;  3OVX A;  2R9N A;  1AIM A;  3MOR A;  2G8J A;  2HXZ A;  3BC3 A;  5JH3 A;  1PPP A;  1F2B A;  2E02 A;  3OQC A;  3I3T A;  3O0U A;  4PT5 A;  4KLB A;  1CB5 A;  4PAD A;  3PT2 A;  4QH6 A;  2R9C A;  2IPP B;  3F75 A;  1AYU A;  1U9X A;  1VSN A;  3P5X A;  5CVO B;  2PNS A;  2WBF X;  3BY4 A;  4OEL A;  4BS5 A;  4X6H A;  1NQC A;  2DZY A;  3PDF A;  1CTE A;  4OVZ B;  4HWY A;  3GCB A;  1ICF A;  4BOP A;  1KXR A;  3W30 A;  1PAD A;  3D6S A;  3HWN A;  3KKU A;  4X6J A;  2AGA A;  3TNX A;  4BOZ A;  3PW3 A;  4DMY A;  2Y6E A;  2AUX A;  2FTD A;  1PVJ A;  3E9S A;  2DC6 A;  5CHV A;  5EF4 A;  1DKI A;  5KO3 A;  3DF0 A;  3HHA A;  2VHS A;  3BBA A;  3BCN A;  1A6R A;  1M6D A;  1PCI A;  2XU1 A;  3KWB X;  1YK7 A;  3AI8 A;  2DC8 A;  1KFX L;  2JTC A;  4D8I A;  5E6J A;  1BQI A;  2AUZ A;  2B1N A;  9PAP A;  3MHH A;  5CVN B;  3WXE A;  4PP2 E;  3H6S A;  1KHP A;  3PSE A;  3PRP A;  4N4Z A;  3NHE A;  4BQV A;  1PXV A;  4CZW A;  4QRG A;  2JRI A;  1SNK A;  5JA7 A;  4I05 A;  3OF9 A;  4REZ A;  2R9F A;  3IFU A;  4MSX A;  1EWO A;  3HHI A;  4BOS A;  2YJ2 A;  2DJF B;  4GUA A;  2FRA A;  2H7J A;  4CDD B;  1X9Y A;  2J7Q A;  5F02 A;  3LXS A;  1EWL A;  2F1G A;  2GHU A;  1FH0 A;  1TLO A;  3KWZ A;  3IEJ A;  2HH5 A;  1NPZ A;  1MEG A;  3KSE A;  4IUM A;  2DCA A;  3HD3 A;  3MP2 A;  1JQP A;  1NLJ A;  3TMP A;  7PCK A;  2FO5 A;  1STF E;  3O65 A;  1AEC A;  5FPW A;  1NL6 A;  2HWK A;  2P86 A;  1YK8 A;  1CQD A;  2HHN A;  3PHX A;  4Q8G A;  1F2A A;  3B21 A;  1ME3 A;  1MS6 A;  4FK5 A;  3WXF A;  4YYV A;  3C0R A;  1ME4 A;  3H8C A;  1YZB A;  2FQ9 A;  4OEM A;  3QSD A;  4YYU A;  1K3B B;  4WA6 A;  3RVW A;  4XZX A;  1IWD A;  5CHT A;  1DF0 A;  3BWK A;  4P16 A;  3PRM A;  3PBH A;  2BDL A;  1UKF A;  4BOU A;  2AU1 A;  4CDC B;  3K24 A;  2OP3 A;  1PIP A;  1MIR A;  4OVZ A;  1ATK A;  2DCD A;  2DZZ A;  1PPN A;  2YJC A;  2AYN A;  3ERV A;  2AS8 A;  2E01 A;  3C9E A;  5K16 A;  4RNA A;  3W31 A;  1THE A;  4W5B A;  1KFU L;  1NB5 A;  1U9V A;  2BTW B;  2OZ2 A;  2HD5 A;  4CDE B;  4QRV A;  2XU3 A;  1AU3 A;  2UZJ A;  3I06 A;  2C0Y A;  2PAD A;  1U9Q X;  2CIO A;  1TL9 A;  4BSQ A;  4I07 A;  1SP4 B;  3IOQ A;  1F29 A;  5PAD A;  4FIP A;  4PP1 A;  3BOW A;  4QBB A;  4MZS A;  4N8W A;  2Y5B A;  2ATO A;  4ZTB A;  4MZO A;  2PBH A;  1CSB B;  2VHF A;  2NQA A;  2FRQ A;  2IBI A;  1KHQ A;  3ZNH A;  1ZIV A;  4W5C A;  4MM3 B;  4R3D A;  4YYR A;  1HUC B;  3P5V A;  3LFY A;  2F7D A;  3P5U A;  4CDF B;  2GFO A;  8PCH A;  1YT7 A;  4X6I A;  4FJC A;  1XKG A;  4MI7 A;  2G8E A;  1PPD A;  1AYW A;  1O0E A;  4AXL A;  2G7Y A;  2R6N A;  3V6E A;  3MJ5 A;  2CB5 A;  3PHU A;  3QT4 A;  1AU4 A;  2R9M A;  2YJB A;  2FE8 A;  4OW0 A;  1F2C A;  3PNR A;  1QDQ A;  2P7U A;  4K7C A;  4W4U A;  3QJ3 A;  5EGW A;  2NQD B;  2NQG A;  1MHW A;  4A5U A;  2DCB A;  1BGO A;  1U5I A;  1CVZ A;  3PHW A;  3CBK A;  4M0W A;  1AU0 A;  1DEU A;  2XU5 A;  2ARY A;  2YJ9 A;  3CH2 X;  2NQI A;  2ACT A;  3CH3 X;  1NB3 A;  2FYE A;  1TU6 A;  3TRK A;  2P0R A;  3OIS A;  3KW9 A;  1EF7 A;  4XUI A;  1BP4 A;  3K8U A;  1U9W A;  2J7Q C;  1QMY A;  4PI3 A;  3RVV A;  2BU3 A;  4WUR A;  3RVX A;  1AYV A;  4BOQ A;  2AVW A;  3H7D A;  1EWM A;  1Y4H A;  3IUT A;  4G54 A;  1CV8 A;  1EWP A;  4BPV A;  2BTW A;  4QRX A;  3N3G A;  2B1M A;  3M99 A;  5CVM A;  3USV A;  3WXG A;  1ITO A;  2DOS A;  3BPF A;  2DJG B;  4RF0 A;  2BDZ A;  1GLO A;  3E1Z B;  2G6D A;  1GMY A;  3MHS A; 
#chains in the Genus database with same CATH homology
 1YVB A;  1VJV A;  5J94 A;  2PRE A;  2JQF R;  3H89 A;  3OF8 A;  2AIM A;  1YAL A;  3O1G A;  3B79 A;  4Q8H A;  1CS8 A;  1QXP A;  3BPM A;  6PAD A;  4P6E A;  1CPJ A;  4ZUX U;  3MTN A;  2JQG R;  3U8E A;  3H8B A;  1AU2 A;  3N3K A;  3P5W A;  3IV2 A;  3IHP A;  1ZCM A;  1POP A;  3IMA A;  4P6G A;  4YVA A;  4RY2 A;  3S3R A;  2DC9 A;  1BY8 A;  5A24 A;  2XU4 A;  1E2T A;  2O6X A;  3K9M A;  1Q6K A;  1QOL A;  1S4V A;  2DC7 A;  1PBH A;  1GEC E;  3ZUA A;  2YJ8 A;  2E00 A;  4I04 A;  3KFQ A;  1GCB A;  3V6C A;  4BS6 A;  1PPO A;  2E03 A;  3LTW A;  1CJL A;  1MEM A;  1W5R A;  2FT2 A;  2R9O A;  2AYO A;  3KX1 A;  4DMX A;  1MDW A;  1Y08 A;  4YYQ A;  3OVZ A;  3F5V A;  1PE6 A;  4XR7 A;  3S3Q A;  4YYW A;  2DCC A;  2FUD A;  3N4C A;  4YV8 A;  4AXM A;  4N79 A;  3CBJ A;  2OUL A;  4YYS A;  3OVX A;  2R9N A;  1AIM A;  3MOR A;  2G8J A;  2HXZ A;  3BC3 A;  5JH3 A;  1PPP A;  1F2B A;  2E02 A;  3I3T A;  3O0U A;  4KLB A;  1CB5 A;  4PAD A;  4QH6 A;  2R9C A;  2IPP B;  3F75 A;  1AYU A;  1U9X A;  1VSN A;  3P5X A;  5CVO B;  2PNS A;  2WBF X;  4OEL A;  4BS5 A;  4X6H A;  1NQC A;  2DZY A;  3PDF A;  1CTE A;  4HWY A;  3GCB A;  4B55 A;  1ICF A;  1KXR A;  1PAD A;  3D6S A;  3HWN A;  3KKU A;  4X6J A;  3TNX A;  3PW3 A;  4DMY A;  2Y6E A;  2AUX A;  2FTD A;  5CHV A;  5EF4 A;  2DC6 A;  3DF0 A;  3HHA A;  2VHS A;  3BCN A;  1A6R A;  1M6D A;  1PCI A;  2XU1 A;  2VFC A;  3KWB X;  1YK7 A;  3AI8 A;  2DC8 A;  1KFX L;  1BQI A;  2AUZ A;  2B1N A;  9PAP A;  3MHH A;  5CVN B;  3WXE A;  4PP2 E;  3H6S A;  1KHP A;  4N4Z A;  3NHE A;  4BQV A;  1PXV A;  4CZW A;  4QRG A;  1SNK A;  5JA7 A;  4I05 A;  3OF9 A;  2R9F A;  4MSX A;  1EWO A;  3HHI A;  2YJ2 A;  2DJF B;  4NV8 A;  2FRA A;  2H7J A;  4CDD B;  1X9Y A;  5F02 A;  3LXS A;  1EWL A;  2F1G A;  2GHU A;  1FH0 A;  1TLO A;  3KWZ A;  3IEJ A;  2HH5 A;  1NPZ A;  1MEG A;  3KSE A;  2DCA A;  3HD3 A;  1JQP A;  1NLJ A;  7PCK A;  2FO5 A;  1STF E;  1AEC A;  5FPW A;  1NL6 A;  2P86 A;  1YK8 A;  1CQD A;  2HHN A;  4Q8G A;  1F2A A;  1ME3 A;  1MS6 A;  4FK5 A;  3WXF A;  4YYV A;  1ME4 A;  3H8C A;  2FQ9 A;  4OEM A;  3QSD A;  4YYU A;  1K3B B;  4WA6 A;  3RVW A;  1GX3 A;  1IWD A;  5CHT A;  3D9W A;  1DF0 A;  3BWK A;  3PBH A;  2BDL A;  2AU1 A;  4CDC B;  3K24 A;  2OP3 A;  1PIP A;  1MIR A;  1ATK A;  2DCD A;  2DZZ A;  1PPN A;  2YJC A;  2AYN A;  3ERV A;  2AS8 A;  2E01 A;  3C9E A;  5K16 A;  4BGF A;  1THE A;  4W5B A;  1KFU L;  1NB5 A;  1U9V A;  2OZ2 A;  2HD5 A;  4CDE B;  4QRV A;  2XU3 A;  1AU3 A;  3I06 A;  2C0Y A;  2PAD A;  4NV7 A;  1U9Q X;  2CIO A;  1TL9 A;  4BSQ A;  4I07 A;  1SP4 B;  3IOQ A;  1F29 A;  5PAD A;  4FIP A;  4PP1 A;  3BOW A;  4QBB A;  4MZS A;  4N8W A;  2Y5B A;  2ATO A;  4MZO A;  2PBH A;  1CSB B;  2VHF A;  4C5P A;  2NQA A;  2FRQ A;  2IBI A;  1KHQ A;  1ZIV A;  4W5C A;  4YYR A;  1HUC B;  3P5V A;  3LFY A;  2F7D A;  3P5U A;  4CDF B;  2GFO A;  8PCH A;  1YT7 A;  4X6I A;  4FJC A;  1XKG A;  2G8E A;  1PPD A;  1AYW A;  1W4T A;  1O0E A;  4AXL A;  2G7Y A;  2R6N A;  3V6E A;  3QT4 A;  2CB5 A;  1AU4 A;  2R9M A;  2YJB A;  1F2C A;  3PNR A;  1QDQ A;  2P7U A;  4K7C A;  4W4U A;  3QJ3 A;  5EGW A;  2NQD B;  2NQG A;  1MHW A;  2DCB A;  1BGO A;  1U5I A;  1CVZ A;  3CBK A;  1AU0 A;  1DEU A;  2XU5 A;  2ARY A;  2YJ9 A;  3CH2 X;  2NQI A;  2ACT A;  3CH3 X;  1NB3 A;  2FYE A;  1TU6 A;  2VFB A;  2P0R A;  3OIS A;  3KW9 A;  1EF7 A;  4XUI A;  1BP4 A;  3K8U A;  1U9W A;  4PI3 A;  1QMY A;  3RVV A;  3RVX A;  1AYV A;  2AVW A;  3H7D A;  1EWM A;  1Y4H A;  2BSZ A;  3IUT A;  4G54 A;  1CV8 A;  1EWP A;  4BPV A;  4QRX A;  3N3G A;  4GUZ A;  2B1M A;  3M99 A;  5CVM A;  3USV A;  3WXG A;  1ITO A;  1W6F A;  3BPF A;  2DJG B;  2BDZ A;  1GLO A;  3E1Z B;  2G6D A;  1GMY A;  3MHS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...