9PAPA

Structure of papain refined at 1.65 angstroms resolution
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
212
structure length
211
Chain Sequence
IPEYVDWRQKGAVTPVKNQGSCGSWAFSAVVTIEGIIKIRTGNLNQYSEQELLDCDRRSYGCNGGYPWSALQLVAQYGIHYRNTYPYEGVQRYCRSREKGPYAAKTDGVRQVQPYNQGALLYSIANQPVSVVLQAAGKDFQLYRGGIFVGPCGNKVDHAVAAVGYGPNYILIKNSWGTGWGENGYIRIKRGTGNSYGVCGLYTSSFYPVKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase (sulfhydryl proteinase)
molecule keywords PAPAIN
publication title Structure of papain refined at 1.65 A resolution
pubmed doi rcsb
source organism Carica papaya
total genus 67
structure length 211
sequence length 212
ec nomenclature ec 3.4.22.2: Papain.
pdb deposition date 1986-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 9papA00
3F75A 4QBBA 2DZYA 2P86A 1MDWA 1PXVA 2FTDA 4MSXA 1VSNA 2G6DA 3CBJA 3QSDA 3PDFA 1AU4A 3BPFA 1ATKA 3MHHA 2G8EA 8PCHA 1O0EA 3IMAA 3KWZA 4YYSA 1U9WA 1KHQA 2AU1A 4XUIA 1PCIA 5CVOB 6PADA 1AECA 1PIPA 1GCBA 1BGOA 4AXLA 2DC9A 2FT2A 2BDLA 2FRQA 3ZUAA 1FH0A 1GECE 4CDDB 2H7JA 2O6XA 3K8UA 2ATOA 1U5IA 4CDFB 2JQGR 2HH5A 4W4UA 1A6RA 4Q8HA 2OP3A 1CTEA 2XU5A 2P0RA 4YYVA 2CB5A 2G8JA 3CBKA 2FO5A 2Y5BA 4K7CA 3HWNA 2R9NA 3GCBA 1PPNA 2F1GA 1KFXL 3HHAA 3RVXA 1THEA 1ME3A 7PCKA 1TU6A 2C0YA 2DCBA 4Q8GA 1BY8A 1PBHA 2G7YA 2XU3A 1PPDA 2DC8A 2DZZA 3HHIA 4AXMA 4BS6A 4QH6A 2B1MA 1EWMA 4DMXA 2PADA 1ICFA 5F02A 1AYUA 3V6EA 3IV2A 3RVWA 1XKGA 1DF0A 1K3BB 2E00A 3CH3X 3E1ZB 4QRVA 1U9XA 2AUZA 3KWBX 1YK8A 3RVVA 1AU3A 1NLJA 3KX1A 5K16A 1SNKA 3WXGA 2DCAA 2HXZA 3C9EA 3D6SA 1AYVA 4QRXA 1AIMA 3N3KA 2E01A 4CDEB 1SP4B 1QDQA 4P6GA 1PE6A 2AVWA 5CVMA 3S3RA 4I07A 3P5UA 1ITOA 3I06A 2YJCA 1F2BA 4RY2A 5JH3A 2ARYA 4MZSA 2FUDA 4DMYA 1EWPA 2ACTA 3MTNA 2IPPB 1QMYA 3LXSA 1EWOA 2IBIA 4XR7A 1NB3A 1YK7A 3KW9A 1YT7A 1AU2A 1U9QX 4YYWA 3H7DA 1M6DA 1BP4A 3QT4A 2PBHA 4X6JA 1CB5A 1NPZA 2NQAA 3OISA 2YJBA 1F2AA 1EF7A 3BWKA 1MIRA 2VHSA 1VJVA 3PBHA 2HD5A 1KFUL 2AS8A 4YVAA 4FK5A 2OULA 2OZ2A 1S4VA 1PADA 3AI8A 3N4CA 4I05A 1MEGA 3U8EA 1IWDA 1MS6A 4X6IA 2E02A 4ZUXU 2YJ9A 4BS5A 1F29A 4BSQA 2PREA 1U9VA 1YVBA 2AUXA 3BCNA 2FYEA 2NQIA 1KHPA 3PNRA 5EF4A 4P6EA 3H8BA 1Y08A 3HD3A 3PW3A 4PADA 2AIMA 4YYUA 5FPWA 3P5VA 4MZOA 4PP1A 3OF8A 1BQIA 2P7UA 5J94A 1QXPA 1CS8A 2GFOA 2YJ8A 2B1NA 5JA7A 1POPA 3WXEA 1PPPA 1EWLA 3BC3A 2Y6EA 9PAPA 3KFQA 4FJCA 3BPMA 4G54A 2XU4A 1ZCMA 4HWYA 1CV8A 2E03A 3IHPA 1GLOA 2DC7A 3O0UA 4BQVA 3H89A 1Y4HA 3O1GA 3B79A 3P5WA 5A24A 3USVA 1QOLA 4CDCB 1X9YA 4I04A 2FRAA 3TNXA 1F2CA 4N4ZA 1NQCA 5CHVA 2AYOA 3S3QA 3MHSA 1GMYA 2CIOA 2JQFR 1MEMA 3IOQA 4W5BA 1MHWA 4BPVA 3KSEA 1AU0A 1CVZA 4N8WA 3LFYA 2DCDA 2FQ9A 1KXRA 4W5CA 1TLOA 2AYNA 2DCCA 3BOWA 4PI3A 1YALA 2YJ2A 3OF9A 2WBFX 5EGWA 1JQPA 4OEMA 3ERVA 4YV8A 1Q6KA 2VHFA 1NL6A 4WA6A 2R9CA 3MORA 3P5XA 1CQDA 2PNSA 4CZWA 3IEJA 3H8CA 3V6CA 5CHTA 1NB5A 3N3GA 5PADA 2R9FA 2DJFB 3H6SA 1DEUA 1ME4A 3F5VA 4FIPA 2F7DA 2HHNA 3M99A 1CSBB 2BDZA 1TL9A 1CJLA 3K24A 3IUTA 2NQDB 2DC6A 3WXFA 4KLBA 4QRGA 4OELA 2R6NA 2NQGA 2DJGB 1ZIVA 4X6HA 4YYQA 2R9MA 3KKUA 2XU1A 3CH2X 1PPOA 2GHUA 4YYRA 1CPJA 2R9OA 3NHEA 4N79A 4PP2E 1AYWA 3OVZA 3I3TA 3QJ3A 5CVNB 3K9MA 3DF0A 1HUCB 3OVXA 1STFE
chains in the Genus database with same CATH superfamily
4RNAA 3F75A 4GUAA 2DZYA 4QBBA 2P86A 3PRMA 1MDWA 1PXVA 2FTDA 4MSXA 1VSNA 2G6DA 3CBJA 3QSDA 3PDFA 1AU4A 3BPFA 1ATKA 3MHHA 4M0WA 2G8EA 8PCHA 1O0EA 3IMAA 3KWZA 4IP3A 4D8EA 4YYSA 1U9WA 1KHQA 2AU1A 4XUIA 1PCIA 4BOZA 5CVOB 6PADA 1AECA 1PIPA 1GCBA 2UZJA 1BGOA 4P16A 4AXLA 2DC9A 2FT2A 2BDLA 2FRQA 3ZUAA 1FH0A 1GECE 4CDDB 2H7JA 2O6XA 3K8UA 2ATOA 1U5IA 4CDFB 2JQGR 5JZEA 2HH5A 4W4UA 1A6RA 4Q8HA 3C0RA 4OW0A 2OP3A 1PVJA 1CTEA 2XU5A 2P0RA 4YYVA 2CB5A 3O65A 2G8JA 3CBKA 2FO5A 2Y5BA 4K7CA 3HWNA 2R9NA 3GCBA 1PPNA 2F1GA 1KFXL 3HHAA 3RVXA 1THEA 1ME3A 7PCKA 1TU6A 3BY4A 2C0YA 2DCBA 4Q8GA 1BY8A 1PBHA 2G7YA 2XU3A 1PPDA 2DC8A 2DZZA 3HHIA 4AXMA 4BS6A 4QH6A 2B1MA 1EWMA 3E9SA 4DMXA 2PADA 2BTWB 2J7QC 1ICFA 5F02A 1AYUA 3V6EA 4D8IA 3IV2A 3RVWA 4RF0A 1XKGA 1DF0A 1K3BB 2E00A 3CH3X 3RNVA 3E1ZB 3PHUA 4QRVA 4PT5A 3MP2A 1U9XA 2AUZA 3KWBX 4A5UA 1YK8A 3RVVA 1AU3A 1NLJA 3KX1A 5K16A 3W31A 4BOQA 2DOSA 1SNKA 4WURA 3WXGA 2DCAA 2HXZA 3C9EA 3D6SA 1AYVA 4QRXA 1AIMA 3N3KA 2E01A 4CDEB 1SP4B 1QDQA 4P6GA 5E6JA 1PE6A 2AVWA 5CVMA 3S3RA 4I07A 1YZBA 3P5UA 1ITOA 3I06A 2YJCA 1F2BA 4RY2A 5JH3A 2AGAA 2ARYA 5KO3A 4MZSA 2FUDA 4DMYA 1EWPA 2ACTA 3MTNA 2IPPB 1QMYA 3LXSA 1EWOA 2IBIA 4XR7A 5EZSA 2J7QA 1NB3A 1YK7A 3KW9A 4D8BA 1YT7A 1AU2A 1U9QX 1DKIA 4YYWA 3H7DA 1M6DA 1BP4A 3QT4A 3OQCA 4XZXA 2PBHA 4X6JA 1CB5A 1NPZA 2NQAA 3OISA 2YJBA 4REZA 1F2AA 1EF7A 3BWKA 1MIRA 2VHSA 1VJVA 3PBHA 2HD5A 3BB7A 1KFUL 2AS8A 4YVAA 4BOUA 4FK5A 2OULA 2OZ2A 1S4VA 1PADA 3AI8A 3N4CA 4I05A 1MEGA 3U8EA 1IWDA 1MS6A 4X6IA 2BU3A 3TRKA 2E02A 4ZUXU 2YJ9A 4BS5A 1F29A 4BSQA 4OVZA 2PREA 1U9VA 1YVBA 2AUXA 3BCNA 2FYEA 2NQIA 1KHPA 3PNRA 5EF4A 4P6EA 3H8BA 1Y08A 3HD3A 3B21A 3PW3A 4PADA 2AIMA 4MM3B 4YYUA 5FPWA 3MTVA 3P5VA 4MZOA 3IFUA 4PP1A 3OF8A 1BQIA 2P7UA 5J94A 1QXPA 4HXDB 1CS8A 2GFOA 2YJ8A 2B1NA 5JA7A 1POPA 3WXEA 1PPPA 1EWLA 3BC3A 2Y6EA 9PAPA 3KFQA 4FJCA 3BPMA 4G54A 2XU4A 4BOSA 1ZCMA 4HWYA 1CV8A 2E03A 3IHPA 1GLOA 2DC7A 3O0UA 4BQVA 3H89A 1Y4HA 3O1GA 3B79A 3P5WA 5A24A 3USVA 1QOLA 4CDCB 1X9YA 4I04A 2FRAA 3TNXA 1F2CA 3PSEA 4N4ZA 1NQCA 5CHVA 2AYOA 3S3QA 3MHSA 1GMYA 2CIOA 2JQFR 1MEMA 3IOQA 4W5BA 1MHWA 4R3DA 4BPVA 2Z84A 3KSEA 1AU0A 1CVZA 4N8WA 3LFYA 2DCDA 2FQ9A 3PHWA 1KXRA 4W5CA 1TLOA 2AYNA 2DCCA 4OVZB 3BOWA 4PI3A 1YALA 2YJ2A 3OF9A 2WBFX 5EGWA 3W30A 1JQPA 4OEMA 3ERVA 4YV8A 1Q6KA 2VHFA 1NL6A 4WA6A 4MI7A 2R9CA 3MORA 3P5XA 1CQDA 2PNSA 4CZWA 3IEJA 3H8CA 3V6CA 5CHTA 2FE8A 1NB5A 3N3GA 5PADA 2R9FA 2DJFB 3H6SA 1DEUA 3PHXA 4RF1A 1ME4A 3F5VA 4FIPA 1UKFA 2F7DA 3PT2A 2HHNA 3M99A 1CSBB 4BOPA 2BDZA 3PRPA 1TL9A 3MJ5A 1CJLA 3K24A 3BBAA 3IUTA 2NQDB 2DC6A 3WXFA 4KLBA 4QRGA 4OELA 2R6NA 3TMPA 2NQGA 2DJGB 1ZIVA 4X6HA 5EZQA 3ZNHA 4YYQA 2R9MA 3KKUA 2XU1A 3CH2X 4ZTBA 1PPOA 2GHUA 4YYRA 1CPJA 2JTCA 2R9OA 3NHEA 4RKXA 2HWKA 4N79A 4PP2E 1AYWA 2BTWA 3OVZA 3I3TA 3QJ3A 5CVNB 3K9MA 3DF0A 2JRIA 1HUCB 4IUMA 3OVXA 1STFE
chains in the Genus database with same CATH topology
3F75A 4QBBA 2DZYA 1GX3A 2P86A 1MDWA 1PXVA 2FTDA 4MSXA 1VSNA 2G6DA 3CBJA 3QSDA 4NV8A 3PDFA 1AU4A 3BPFA 1ATKA 3MHHA 2G8EA 2VFCA 8PCHA 1O0EA 3IMAA 3KWZA 4YYSA 1U9WA 1KHQA 2AU1A 4XUIA 1PCIA 5CVOB 6PADA 1AECA 1PIPA 1GCBA 1BGOA 4AXLA 2DC9A 2FT2A 2BDLA 2FRQA 3ZUAA 1FH0A 1GECE 4CDDB 4NV7A 2H7JA 2O6XA 3K8UA 2ATOA 1U5IA 4CDFB 2JQGR 2HH5A 4W4UA 1A6RA 4Q8HA 2OP3A 1CTEA 2XU5A 2P0RA 4YYVA 2CB5A 2G8JA 3CBKA 2FO5A 2Y5BA 4K7CA 3HWNA 2R9NA 3GCBA 1PPNA 2F1GA 1KFXL 3HHAA 3RVXA 1THEA 1ME3A 7PCKA 1TU6A 2C0YA 2DCBA 4Q8GA 3D9WA 2BSZA 1BY8A 1PBHA 2G7YA 2XU3A 1PPDA 2DC8A 2DZZA 3HHIA 4AXMA 4BS6A 4QH6A 2B1MA 1EWMA 4DMXA 2PADA 1ICFA 5F02A 1AYUA 3V6EA 3IV2A 3RVWA 1XKGA 1DF0A 1K3BB 2E00A 3CH3X 4C5PA 3E1ZB 4QRVA 1U9XA 2AUZA 3KWBX 1YK8A 3RVVA 1AU3A 1NLJA 3KX1A 5K16A 1SNKA 3WXGA 2VFBA 2DCAA 2HXZA 3C9EA 3D6SA 1AYVA 4QRXA 1AIMA 3N3KA 2E01A 4CDEB 1SP4B 1QDQA 4P6GA 1PE6A 2AVWA 5CVMA 3S3RA 4I07A 3P5UA 1ITOA 3I06A 2YJCA 1F2BA 4RY2A 5JH3A 2ARYA 4MZSA 2FUDA 4DMYA 1EWPA 2ACTA 3MTNA 2IPPB 1QMYA 3LXSA 1EWOA 2IBIA 4XR7A 1NB3A 1YK7A 3KW9A 1YT7A 1AU2A 1U9QX 4YYWA 3H7DA 1M6DA 1BP4A 3QT4A 2PBHA 4X6JA 1CB5A 1NPZA 2NQAA 3OISA 2YJBA 1F2AA 1EF7A 3BWKA 1MIRA 2VHSA 4GUZA 1VJVA 3PBHA 2HD5A 1KFUL 2AS8A 4YVAA 4FK5A 2OULA 2OZ2A 1S4VA 1PADA 3AI8A 3N4CA 4I05A 1MEGA 3U8EA 1IWDA 1MS6A 4X6IA 2E02A 4ZUXU 2YJ9A 4BS5A 1F29A 4BSQA 2PREA 1U9VA 1YVBA 2AUXA 3BCNA 2FYEA 2NQIA 1KHPA 3PNRA 5EF4A 4P6EA 3H8BA 1Y08A 3HD3A 3PW3A 4PADA 2AIMA 4YYUA 3LTWA 5FPWA 3P5VA 4MZOA 4PP1A 3OF8A 1BQIA 2P7UA 5J94A 1QXPA 1CS8A 2GFOA 2YJ8A 2B1NA 5JA7A 1POPA 3WXEA 1PPPA 1EWLA 3BC3A 2Y6EA 9PAPA 3KFQA 4FJCA 3BPMA 4G54A 2XU4A 1ZCMA 4HWYA 1CV8A 2E03A 3IHPA 1GLOA 2DC7A 3O0UA 4BQVA 3H89A 1Y4HA 3O1GA 3B79A 3P5WA 5A24A 3USVA 1QOLA 4CDCB 1X9YA 4I04A 2FRAA 3TNXA 1F2CA 4N4ZA 1NQCA 5CHVA 2AYOA 3S3QA 1W6FA 3MHSA 1GMYA 2CIOA 2JQFR 1MEMA 3IOQA 4W5BA 1MHWA 4BPVA 3KSEA 1AU0A 1CVZA 4N8WA 3LFYA 2DCDA 2FQ9A 1KXRA 4W5CA 1TLOA 2AYNA 2DCCA 3BOWA 4PI3A 1YALA 2YJ2A 3OF9A 2WBFX 5EGWA 1JQPA 4OEMA 3ERVA 4B55A 4YV8A 1Q6KA 1W5RA 2VHFA 1NL6A 4WA6A 2R9CA 3MORA 3P5XA 1CQDA 2PNSA 4CZWA 3IEJA 3H8CA 3V6CA 5CHTA 1NB5A 3N3GA 5PADA 2R9FA 2DJFB 3H6SA 1DEUA 1ME4A 3F5VA 4FIPA 2F7DA 2HHNA 3M99A 4BGFA 1CSBB 2BDZA 1TL9A 1CJLA 3K24A 3IUTA 2NQDB 2DC6A 3WXFA 4KLBA 4QRGA 4OELA 2R6NA 2NQGA 2DJGB 1ZIVA 4X6HA 4YYQA 2R9MA 3KKUA 2XU1A 3CH2X 1PPOA 2GHUA 4YYRA 1CPJA 2R9OA 3NHEA 1E2TA 4N79A 4PP2E 1AYWA 3OVZA 3I3TA 3QJ3A 5CVNB 3K9MA 3DF0A 1HUCB 1W4TA 3OVXA 1STFE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F75 A;  4QBB A;  2DZY A;  2P86 A;  1MDW A;  1PXV A;  2FTD A;  4MSX A;  1VSN A;  2G6D A;  3CBJ A;  3QSD A;  3PDF A;  1AU4 A;  3BPF A;  1ATK A;  3MHH A;  2G8E A;  8PCH A;  1O0E A;  3IMA A;  3KWZ A;  4YYS A;  1U9W A;  1KHQ A;  2AU1 A;  4XUI A;  1PCI A;  5CVO B;  6PAD A;  1AEC A;  1PIP A;  1GCB A;  1BGO A;  4AXL A;  2DC9 A;  2FT2 A;  2BDL A;  2FRQ A;  3ZUA A;  1FH0 A;  1GEC E;  4CDD B;  2H7J A;  2O6X A;  3K8U A;  2ATO A;  1U5I A;  4CDF B;  2JQG R;  2HH5 A;  4W4U A;  1A6R A;  4Q8H A;  2OP3 A;  1CTE A;  2XU5 A;  2P0R A;  4YYV A;  2CB5 A;  2G8J A;  3CBK A;  2FO5 A;  2Y5B A;  4K7C A;  3HWN A;  2R9N A;  3GCB A;  1PPN A;  2F1G A;  1KFX L;  3HHA A;  3RVX A;  1THE A;  1ME3 A;  7PCK A;  1TU6 A;  2C0Y A;  2DCB A;  4Q8G A;  1BY8 A;  1PBH A;  2G7Y A;  2XU3 A;  1PPD A;  2DC8 A;  2DZZ A;  3HHI A;  4AXM A;  4BS6 A;  4QH6 A;  2B1M A;  1EWM A;  4DMX A;  2PAD A;  1ICF A;  5F02 A;  1AYU A;  3V6E A;  3IV2 A;  3RVW A;  1XKG A;  1DF0 A;  1K3B B;  2E00 A;  3CH3 X;  3E1Z B;  4QRV A;  1U9X A;  2AUZ A;  3KWB X;  1YK8 A;  3RVV A;  1AU3 A;  1NLJ A;  3KX1 A;  5K16 A;  1SNK A;  3WXG A;  2DCA A;  2HXZ A;  3C9E A;  3D6S A;  1AYV A;  4QRX A;  1AIM A;  3N3K A;  2E01 A;  4CDE B;  1SP4 B;  1QDQ A;  4P6G A;  1PE6 A;  2AVW A;  5CVM A;  3S3R A;  4I07 A;  3P5U A;  1ITO A;  3I06 A;  2YJC A;  1F2B A;  4RY2 A;  5JH3 A;  2ARY A;  4MZS A;  2FUD A;  4DMY A;  1EWP A;  2ACT A;  3MTN A;  2IPP B;  1QMY A;  3LXS A;  1EWO A;  2IBI A;  4XR7 A;  1NB3 A;  1YK7 A;  3KW9 A;  1YT7 A;  1AU2 A;  1U9Q X;  4YYW A;  3H7D A;  1M6D A;  1BP4 A;  3QT4 A;  2PBH A;  4X6J A;  1CB5 A;  1NPZ A;  2NQA A;  3OIS A;  2YJB A;  1F2A A;  1EF7 A;  3BWK A;  1MIR A;  2VHS A;  1VJV A;  3PBH A;  2HD5 A;  1KFU L;  2AS8 A;  4YVA A;  4FK5 A;  2OUL A;  2OZ2 A;  1S4V A;  1PAD A;  3AI8 A;  3N4C A;  4I05 A;  1MEG A;  3U8E A;  1IWD A;  1MS6 A;  4X6I A;  2E02 A;  4ZUX U;  2YJ9 A;  4BS5 A;  1F29 A;  4BSQ A;  2PRE A;  1U9V A;  1YVB A;  2AUX A;  3BCN A;  2FYE A;  2NQI A;  1KHP A;  3PNR A;  5EF4 A;  4P6E A;  3H8B A;  1Y08 A;  3HD3 A;  3PW3 A;  4PAD A;  2AIM A;  4YYU A;  5FPW A;  3P5V A;  4MZO A;  4PP1 A;  3OF8 A;  1BQI A;  2P7U A;  5J94 A;  1QXP A;  1CS8 A;  2GFO A;  2YJ8 A;  2B1N A;  5JA7 A;  1POP A;  3WXE A;  1PPP A;  1EWL A;  3BC3 A;  2Y6E A;  9PAP A;  3KFQ A;  4FJC A;  3BPM A;  4G54 A;  2XU4 A;  1ZCM A;  4HWY A;  1CV8 A;  2E03 A;  3IHP A;  1GLO A;  2DC7 A;  3O0U A;  4BQV A;  3H89 A;  1Y4H A;  3O1G A;  3B79 A;  3P5W A;  5A24 A;  3USV A;  1QOL A;  4CDC B;  1X9Y A;  4I04 A;  2FRA A;  3TNX A;  1F2C A;  4N4Z A;  1NQC A;  5CHV A;  2AYO A;  3S3Q A;  3MHS A;  1GMY A;  2CIO A;  2JQF R;  1MEM A;  3IOQ A;  4W5B A;  1MHW A;  4BPV A;  3KSE A;  1AU0 A;  1CVZ A;  4N8W A;  3LFY A;  2DCD A;  2FQ9 A;  1KXR A;  4W5C A;  1TLO A;  2AYN A;  2DCC A;  3BOW A;  4PI3 A;  1YAL A;  2YJ2 A;  3OF9 A;  2WBF X;  5EGW A;  1JQP A;  4OEM A;  3ERV A;  4YV8 A;  1Q6K A;  2VHF A;  1NL6 A;  4WA6 A;  2R9C A;  3MOR A;  3P5X A;  1CQD A;  2PNS A;  4CZW A;  3IEJ A;  3H8C A;  3V6C A;  5CHT A;  1NB5 A;  3N3G A;  5PAD A;  2R9F A;  2DJF B;  3H6S A;  1DEU A;  1ME4 A;  3F5V A;  4FIP A;  2F7D A;  2HHN A;  3M99 A;  1CSB B;  2BDZ A;  1TL9 A;  1CJL A;  3K24 A;  3IUT A;  2NQD B;  2DC6 A;  3WXF A;  4KLB A;  4QRG A;  4OEL A;  2R6N A;  2NQG A;  2DJG B;  1ZIV A;  4X6H A;  4YYQ A;  2R9M A;  3KKU A;  2XU1 A;  3CH2 X;  1PPO A;  2GHU A;  4YYR A;  1CPJ A;  2R9O A;  3NHE A;  4N79 A;  4PP2 E;  1AYW A;  3OVZ A;  3I3T A;  3QJ3 A;  5CVN B;  3K9M A;  3DF0 A;  1HUC B;  3OVX A;  1STF E; 
#chains in the Genus database with same CATH topology
 4RNA A;  3F75 A;  4GUA A;  2DZY A;  4QBB A;  2P86 A;  3PRM A;  1MDW A;  1PXV A;  2FTD A;  4MSX A;  1VSN A;  2G6D A;  3CBJ A;  3QSD A;  3PDF A;  1AU4 A;  3BPF A;  1ATK A;  3MHH A;  4M0W A;  2G8E A;  8PCH A;  1O0E A;  3IMA A;  3KWZ A;  4IP3 A;  4D8E A;  4YYS A;  1U9W A;  1KHQ A;  2AU1 A;  4XUI A;  1PCI A;  4BOZ A;  5CVO B;  6PAD A;  1AEC A;  1PIP A;  1GCB A;  2UZJ A;  1BGO A;  4P16 A;  4AXL A;  2DC9 A;  2FT2 A;  2BDL A;  2FRQ A;  3ZUA A;  1FH0 A;  1GEC E;  4CDD B;  2H7J A;  2O6X A;  3K8U A;  2ATO A;  1U5I A;  4CDF B;  2JQG R;  5JZE A;  2HH5 A;  4W4U A;  1A6R A;  4Q8H A;  3C0R A;  4OW0 A;  2OP3 A;  1PVJ A;  1CTE A;  2XU5 A;  2P0R A;  4YYV A;  2CB5 A;  3O65 A;  2G8J A;  3CBK A;  2FO5 A;  2Y5B A;  4K7C A;  3HWN A;  2R9N A;  3GCB A;  1PPN A;  2F1G A;  1KFX L;  3HHA A;  3RVX A;  1THE A;  1ME3 A;  7PCK A;  1TU6 A;  3BY4 A;  2C0Y A;  2DCB A;  4Q8G A;  1BY8 A;  1PBH A;  2G7Y A;  2XU3 A;  1PPD A;  2DC8 A;  2DZZ A;  3HHI A;  4AXM A;  4BS6 A;  4QH6 A;  2B1M A;  1EWM A;  3E9S A;  4DMX A;  2PAD A;  2BTW B;  2J7Q C;  1ICF A;  5F02 A;  1AYU A;  3V6E A;  4D8I A;  3IV2 A;  3RVW A;  4RF0 A;  1XKG A;  1DF0 A;  1K3B B;  2E00 A;  3CH3 X;  3RNV A;  3E1Z B;  3PHU A;  4QRV A;  4PT5 A;  3MP2 A;  1U9X A;  2AUZ A;  3KWB X;  4A5U A;  1YK8 A;  3RVV A;  1AU3 A;  1NLJ A;  3KX1 A;  5K16 A;  3W31 A;  4BOQ A;  2DOS A;  1SNK A;  4WUR A;  3WXG A;  2DCA A;  2HXZ A;  3C9E A;  3D6S A;  1AYV A;  4QRX A;  1AIM A;  3N3K A;  2E01 A;  4CDE B;  1SP4 B;  1QDQ A;  4P6G A;  5E6J A;  1PE6 A;  2AVW A;  5CVM A;  3S3R A;  4I07 A;  1YZB A;  3P5U A;  1ITO A;  3I06 A;  2YJC A;  1F2B A;  4RY2 A;  5JH3 A;  2AGA A;  2ARY A;  5KO3 A;  4MZS A;  2FUD A;  4DMY A;  1EWP A;  2ACT A;  3MTN A;  2IPP B;  1QMY A;  3LXS A;  1EWO A;  2IBI A;  4XR7 A;  5EZS A;  2J7Q A;  1NB3 A;  1YK7 A;  3KW9 A;  4D8B A;  1YT7 A;  1AU2 A;  1U9Q X;  1DKI A;  4YYW A;  3H7D A;  1M6D A;  1BP4 A;  3QT4 A;  3OQC A;  4XZX A;  2PBH A;  4X6J A;  1CB5 A;  1NPZ A;  2NQA A;  3OIS A;  2YJB A;  4REZ A;  1F2A A;  1EF7 A;  3BWK A;  1MIR A;  2VHS A;  1VJV A;  3PBH A;  2HD5 A;  3BB7 A;  1KFU L;  2AS8 A;  4YVA A;  4BOU A;  4FK5 A;  2OUL A;  2OZ2 A;  1S4V A;  1PAD A;  3AI8 A;  3N4C A;  4I05 A;  1MEG A;  3U8E A;  1IWD A;  1MS6 A;  4X6I A;  2BU3 A;  3TRK A;  2E02 A;  4ZUX U;  2YJ9 A;  4BS5 A;  1F29 A;  4BSQ A;  4OVZ A;  2PRE A;  1U9V A;  1YVB A;  2AUX A;  3BCN A;  2FYE A;  2NQI A;  1KHP A;  3PNR A;  5EF4 A;  4P6E A;  3H8B A;  1Y08 A;  3HD3 A;  3B21 A;  3PW3 A;  4PAD A;  2AIM A;  4MM3 B;  4YYU A;  5FPW A;  3MTV A;  3P5V A;  4MZO A;  3IFU A;  4PP1 A;  3OF8 A;  1BQI A;  2P7U A;  5J94 A;  1QXP A;  4HXD B;  1CS8 A;  2GFO A;  2YJ8 A;  2B1N A;  5JA7 A;  1POP A;  3WXE A;  1PPP A;  1EWL A;  3BC3 A;  2Y6E A;  9PAP A;  3KFQ A;  4FJC A;  3BPM A;  4G54 A;  2XU4 A;  4BOS A;  1ZCM A;  4HWY A;  1CV8 A;  2E03 A;  3IHP A;  1GLO A;  2DC7 A;  3O0U A;  4BQV A;  3H89 A;  1Y4H A;  3O1G A;  3B79 A;  3P5W A;  5A24 A;  3USV A;  1QOL A;  4CDC B;  1X9Y A;  4I04 A;  2FRA A;  3TNX A;  1F2C A;  3PSE A;  4N4Z A;  1NQC A;  5CHV A;  2AYO A;  3S3Q A;  3MHS A;  1GMY A;  2CIO A;  2JQF R;  1MEM A;  3IOQ A;  4W5B A;  1MHW A;  4R3D A;  4BPV A;  2Z84 A;  3KSE A;  1AU0 A;  1CVZ A;  4N8W A;  3LFY A;  2DCD A;  2FQ9 A;  3PHW A;  1KXR A;  4W5C A;  1TLO A;  2AYN A;  2DCC A;  4OVZ B;  3BOW A;  4PI3 A;  1YAL A;  2YJ2 A;  3OF9 A;  2WBF X;  5EGW A;  3W30 A;  1JQP A;  4OEM A;  3ERV A;  4YV8 A;  1Q6K A;  2VHF A;  1NL6 A;  4WA6 A;  4MI7 A;  2R9C A;  3MOR A;  3P5X A;  1CQD A;  2PNS A;  4CZW A;  3IEJ A;  3H8C A;  3V6C A;  5CHT A;  2FE8 A;  1NB5 A;  3N3G A;  5PAD A;  2R9F A;  2DJF B;  3H6S A;  1DEU A;  3PHX A;  4RF1 A;  1ME4 A;  3F5V A;  4FIP A;  1UKF A;  2F7D A;  3PT2 A;  2HHN A;  3M99 A;  1CSB B;  4BOP A;  2BDZ A;  3PRP A;  1TL9 A;  3MJ5 A;  1CJL A;  3K24 A;  3BBA A;  3IUT A;  2NQD B;  2DC6 A;  3WXF A;  4KLB A;  4QRG A;  4OEL A;  2R6N A;  3TMP A;  2NQG A;  2DJG B;  1ZIV A;  4X6H A;  5EZQ A;  3ZNH A;  4YYQ A;  2R9M A;  3KKU A;  2XU1 A;  3CH2 X;  4ZTB A;  1PPO A;  2GHU A;  4YYR A;  1CPJ A;  2JTC A;  2R9O A;  3NHE A;  4RKX A;  2HWK A;  4N79 A;  4PP2 E;  1AYW A;  2BTW A;  3OVZ A;  3I3T A;  3QJ3 A;  5CVN B;  3K9M A;  3DF0 A;  2JRI A;  1HUC B;  4IUM A;  3OVX A;  1STF E; 
#chains in the Genus database with same CATH homology
 3F75 A;  4QBB A;  2DZY A;  1GX3 A;  2P86 A;  1MDW A;  1PXV A;  2FTD A;  4MSX A;  1VSN A;  2G6D A;  3CBJ A;  3QSD A;  4NV8 A;  3PDF A;  1AU4 A;  3BPF A;  1ATK A;  3MHH A;  2G8E A;  2VFC A;  8PCH A;  1O0E A;  3IMA A;  3KWZ A;  4YYS A;  1U9W A;  1KHQ A;  2AU1 A;  4XUI A;  1PCI A;  5CVO B;  6PAD A;  1AEC A;  1PIP A;  1GCB A;  1BGO A;  4AXL A;  2DC9 A;  2FT2 A;  2BDL A;  2FRQ A;  3ZUA A;  1FH0 A;  1GEC E;  4CDD B;  4NV7 A;  2H7J A;  2O6X A;  3K8U A;  2ATO A;  1U5I A;  4CDF B;  2JQG R;  2HH5 A;  4W4U A;  1A6R A;  4Q8H A;  2OP3 A;  1CTE A;  2XU5 A;  2P0R A;  4YYV A;  2CB5 A;  2G8J A;  3CBK A;  2FO5 A;  2Y5B A;  4K7C A;  3HWN A;  2R9N A;  3GCB A;  1PPN A;  2F1G A;  1KFX L;  3HHA A;  3RVX A;  1THE A;  1ME3 A;  7PCK A;  1TU6 A;  2C0Y A;  2DCB A;  4Q8G A;  3D9W A;  2BSZ A;  1BY8 A;  1PBH A;  2G7Y A;  2XU3 A;  1PPD A;  2DC8 A;  2DZZ A;  3HHI A;  4AXM A;  4BS6 A;  4QH6 A;  2B1M A;  1EWM A;  4DMX A;  2PAD A;  1ICF A;  5F02 A;  1AYU A;  3V6E A;  3IV2 A;  3RVW A;  1XKG A;  1DF0 A;  1K3B B;  2E00 A;  3CH3 X;  4C5P A;  3E1Z B;  4QRV A;  1U9X A;  2AUZ A;  3KWB X;  1YK8 A;  3RVV A;  1AU3 A;  1NLJ A;  3KX1 A;  5K16 A;  1SNK A;  3WXG A;  2VFB A;  2DCA A;  2HXZ A;  3C9E A;  3D6S A;  1AYV A;  4QRX A;  1AIM A;  3N3K A;  2E01 A;  4CDE B;  1SP4 B;  1QDQ A;  4P6G A;  1PE6 A;  2AVW A;  5CVM A;  3S3R A;  4I07 A;  3P5U A;  1ITO A;  3I06 A;  2YJC A;  1F2B A;  4RY2 A;  5JH3 A;  2ARY A;  4MZS A;  2FUD A;  4DMY A;  1EWP A;  2ACT A;  3MTN A;  2IPP B;  1QMY A;  3LXS A;  1EWO A;  2IBI A;  4XR7 A;  1NB3 A;  1YK7 A;  3KW9 A;  1YT7 A;  1AU2 A;  1U9Q X;  4YYW A;  3H7D A;  1M6D A;  1BP4 A;  3QT4 A;  2PBH A;  4X6J A;  1CB5 A;  1NPZ A;  2NQA A;  3OIS A;  2YJB A;  1F2A A;  1EF7 A;  3BWK A;  1MIR A;  2VHS A;  4GUZ A;  1VJV A;  3PBH A;  2HD5 A;  1KFU L;  2AS8 A;  4YVA A;  4FK5 A;  2OUL A;  2OZ2 A;  1S4V A;  1PAD A;  3AI8 A;  3N4C A;  4I05 A;  1MEG A;  3U8E A;  1IWD A;  1MS6 A;  4X6I A;  2E02 A;  4ZUX U;  2YJ9 A;  4BS5 A;  1F29 A;  4BSQ A;  2PRE A;  1U9V A;  1YVB A;  2AUX A;  3BCN A;  2FYE A;  2NQI A;  1KHP A;  3PNR A;  5EF4 A;  4P6E A;  3H8B A;  1Y08 A;  3HD3 A;  3PW3 A;  4PAD A;  2AIM A;  4YYU A;  3LTW A;  5FPW A;  3P5V A;  4MZO A;  4PP1 A;  3OF8 A;  1BQI A;  2P7U A;  5J94 A;  1QXP A;  1CS8 A;  2GFO A;  2YJ8 A;  2B1N A;  5JA7 A;  1POP A;  3WXE A;  1PPP A;  1EWL A;  3BC3 A;  2Y6E A;  9PAP A;  3KFQ A;  4FJC A;  3BPM A;  4G54 A;  2XU4 A;  1ZCM A;  4HWY A;  1CV8 A;  2E03 A;  3IHP A;  1GLO A;  2DC7 A;  3O0U A;  4BQV A;  3H89 A;  1Y4H A;  3O1G A;  3B79 A;  3P5W A;  5A24 A;  3USV A;  1QOL A;  4CDC B;  1X9Y A;  4I04 A;  2FRA A;  3TNX A;  1F2C A;  4N4Z A;  1NQC A;  5CHV A;  2AYO A;  3S3Q A;  1W6F A;  3MHS A;  1GMY A;  2CIO A;  2JQF R;  1MEM A;  3IOQ A;  4W5B A;  1MHW A;  4BPV A;  3KSE A;  1AU0 A;  1CVZ A;  4N8W A;  3LFY A;  2DCD A;  2FQ9 A;  1KXR A;  4W5C A;  1TLO A;  2AYN A;  2DCC A;  3BOW A;  4PI3 A;  1YAL A;  2YJ2 A;  3OF9 A;  2WBF X;  5EGW A;  1JQP A;  4OEM A;  3ERV A;  4B55 A;  4YV8 A;  1Q6K A;  1W5R A;  2VHF A;  1NL6 A;  4WA6 A;  2R9C A;  3MOR A;  3P5X A;  1CQD A;  2PNS A;  4CZW A;  3IEJ A;  3H8C A;  3V6C A;  5CHT A;  1NB5 A;  3N3G A;  5PAD A;  2R9F A;  2DJF B;  3H6S A;  1DEU A;  1ME4 A;  3F5V A;  4FIP A;  2F7D A;  2HHN A;  3M99 A;  4BGF A;  1CSB B;  2BDZ A;  1TL9 A;  1CJL A;  3K24 A;  3IUT A;  2NQD B;  2DC6 A;  3WXF A;  4KLB A;  4QRG A;  4OEL A;  2R6N A;  2NQG A;  2DJG B;  1ZIV A;  4X6H A;  4YYQ A;  2R9M A;  3KKU A;  2XU1 A;  3CH2 X;  1PPO A;  2GHU A;  4YYR A;  1CPJ A;  2R9O A;  3NHE A;  1E2T A;  4N79 A;  4PP2 E;  1AYW A;  3OVZ A;  3I3T A;  3QJ3 A;  5CVN B;  3K9M A;  3DF0 A;  1HUC B;  1W4T A;  3OVX A;  1STF E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...