1EWOA

The cysteine protease cruzain bound to wrr-204
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
215
structure length
215
Chain Sequence
APAAVDWRARGAVTAVKDQGQCGSCWAFSAIGNVECQWFLAGHPLTNLSEQMLVSCDKTDSGCSGGLMNNAFEWIVQENNGAVYTEDSYPYASGEGISPPCTTSGHTVGATITGHVELPQDEAQIAAWLAVNGPVAVAVDASSWMTYTGGVMTSCVSEQLDHGVLLVGYNDSAAVPYWIIKNSWTTQWGEEGYIRIAKGSNQCLVKEEASSAVVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords CRUZAIN
publication title Crystal Structure of Cruzain bound to WRR-204
rcsb
source organism Trypanosoma cruzi
total genus 69
structure length 215
sequence length 215
ec nomenclature ec 3.4.22.51: Cruzipain.
pdb deposition date 2000-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1ewoA00
4K7CA 1S4VA 3PNRA 1BP4A 5CVMA 3IMAA 3D6SA 2AVWA 1U5IA 1MEGA 1AU2A 2BDZA 3PBHA 1ZCMA 2G7YA 2NQDB 2FUDA 3H7DA 1CB5A 3F5VA 2DZZA 5FPWA 4CDEB 3RVWA 2AU1A 3P5VA 3ZUAA 4BS5A 1DEUA 2DCAA 3OVZA 2Y6EA 1NB3A 3C9EA 3U8EA 2DC8A 1POPA 5CVNB 3H6SA 1O0EA 4G54A 4N8WA 1AECA 2XU3A 1X9YA 4WA6A 3USVA 2R9MA 1CTEA 1BQIA 4Q8GA 3O1GA 3CH2X 3MHSA 4X6HA 1U9WA 1JQPA 2XU5A 3QSDA 1QMYA 2FO5A 4YYSA 2P7UA 1EWPA 1NLJA 2HD5A 2CB5A 1VJVA 1CV8A 3KFQA 1CSBB 1TU6A 2FRQA 4YYQA 2FT2A 3OISA 4X6JA 1GLOA 4CDDB 4DMYA 4BSQA 4DMXA 3KWZA 2FQ9A 4QH6A 2OULA 1EWOA 3P5UA 4PADA 3H8BA 4YVAA 3H8CA 3V6EA 2R6NA 3TNXA 2DCCA 5K16A 4W5CA 5EF4A 4QRGA 2XU1A 2B1NA 2DC6A 1VSNA 1PE6A 2AYOA 1PIPA 2GHUA 2YJ2A 3K8UA 1TL9A 3H89A 1YK8A 1U9XA 4CDCB 4BS6A 2PBHA 4I05A 1AIMA 3KW9A 1MS6A 2F1GA 8PCHA 4YV8A 2C0YA 3IOQA 1ME4A 9PAPA 5CHTA 4XR7A 1PXVA 2R9NA 2VHFA 1PPOA 4QBBA 2FYEA 3NHEA 1CS8A 1THEA 3I06A 3MTNA 1U9QX 2OZ2A 1ZIVA 3N4CA 1ATKA 3E1ZB 1FH0A 3HHIA 3M99A 3LFYA 1NPZA 3IHPA 3S3RA 3RVXA 1IWDA 3BOWA 2B1MA 1BGOA 1ME3A 2HH5A 1AU3A 1YK7A 3V6CA 1F2AA 2DZYA 1YALA 2PNSA 1MEMA 1CPJA 4MZSA 5JH3A 3RVVA 1F2CA 4I04A 5EGWA 2HHNA 6PADA 4I07A 3BPFA 3P5XA 1GCBA 2AIMA 1SNKA 2YJBA 1YVBA 1KFXL 1CQDA 2BDLA 1EF7A 2Y5BA 1KHQA 1NB5A 5PADA 4N4ZA 3LXSA 2CIOA 1KHPA 3I3TA 2ACTA 1MHWA 3WXFA 1K3BB 1AYWA 1M6DA 4OEMA 1AYUA 4AXLA 2DCDA 1MDWA 1MIRA 1ITOA 4KLBA 3GCBA 2PADA 1Y4HA 2AUXA 2E01A 2DCBA 2IPPB 4MSXA 2O6XA 3BWKA 3MORA 1F2BA 3F75A 4FK5A 2R9CA 2DJFB 1KXRA 1EWLA 3CBJA 2OP3A 5JA7A 3S3QA 1TLOA 1CJLA 4Q8HA 3BCNA 3OF9A 1HUCB 2PREA 1ICFA 4HWYA 4BQVA 1U9VA 3KX1A 1PPPA 2XU4A 2AS8A 2FTDA 1NQCA 2E02A 1QDQA 3OVXA 1PBHA 2GFOA 3ERVA 2HXZA 2ATOA 4ZUXU 3QT4A 4P6GA 3HD3A 4CZWA 1EWMA 1Q6KA 3MHHA 4YYRA 3QJ3A 4W4UA 2ARYA 3CH3X 3HHAA 1PPDA 3N3GA 5CVOB 5F02A 2G8JA 1AU4A 3OF8A 2AYNA 5CHVA 1NL6A 1YT7A 4YYWA 4FIPA 2NQAA 2JQGR 1AYVA 2NQIA 2G6DA 4P6EA 3B79A 3KSEA 1QXPA 3IEJA 2R9FA 4PI3A 3WXEA 4AXMA 3HWNA 2E03A 4YYVA 5A24A 4QRVA 1Y08A 3N3KA 2DJGB 3IUTA 1QOLA 2NQGA 1CVZA 2H7JA 3O0UA 3BPMA 2P86A 3KWBX 3PDFA 1AU0A 2R9OA 1PADA 4FJCA 3KKUA 4XUIA 4MZOA 3K24A 1F29A 2YJCA 2DC9A 2JQFR 4QRXA 1PPNA 1DF0A 1KFUL 1STFE 2P0RA 1A6RA 4X6IA 2VHSA 2IBIA 1GMYA 4PP2E 2G8EA 4OELA 4W5BA 4CDFB 3CBKA 4PP1A 2YJ8A 5J94A 3DF0A 4BPVA 2YJ9A 1XKGA 4YYUA 2DC7A 1BY8A 3P5WA 4N79A 3PW3A 2AUZA 1PCIA 2E00A 2F7DA 3K9MA 1SP4B 3AI8A 3BC3A 3WXGA 3IV2A 2WBFX 4RY2A 1GECE 7PCKA 2FRAA
chains in the Genus database with same CATH superfamily
4K7CA 1S4VA 3PNRA 1BP4A 3B21A 3PRPA 5CVMA 3IMAA 3D6SA 2AVWA 1U5IA 1MEGA 1AU2A 2BDZA 3PBHA 1ZCMA 2G7YA 4BOPA 3W30A 2NQDB 2FUDA 3H7DA 1CB5A 2AGAA 3F5VA 2DZZA 5FPWA 4CDEB 3RVWA 2AU1A 3P5VA 4OW0A 3ZUAA 4BS5A 1DEUA 2DCAA 3OVZA 2Y6EA 1NB3A 3C9EA 3U8EA 2DC8A 1POPA 5CVNB 2BTWB 3H6SA 1O0EA 4G54A 4N8WA 1AECA 2XU3A 1X9YA 4GUAA 4WA6A 3USVA 2R9MA 1CTEA 1BQIA 4Q8GA 3O1GA 3CH2X 3E9SA 3MHSA 4X6HA 1U9WA 1JQPA 2XU5A 3QSDA 1QMYA 2FO5A 4YYSA 2P7UA 1DKIA 1EWPA 1NLJA 2HD5A 2CB5A 2DOSA 1VJVA 1CV8A 3KFQA 1CSBB 1TU6A 2FRQA 4YYQA 1UKFA 2FT2A 2JRIA 3OISA 4X6JA 1GLOA 4CDDB 4DMYA 4BSQA 4DMXA 3KWZA 2FQ9A 4QH6A 2OULA 3PHUA 1EWOA 3P5UA 4PADA 3H8BA 4YVAA 3H8CA 3V6EA 2R6NA 2BTWA 3ZNHA 3TNXA 2DCCA 5K16A 4W5CA 5EF4A 4QRGA 2XU1A 2B1NA 2DC6A 1VSNA 1PE6A 2AYOA 1PIPA 2GHUA 2YJ2A 3K8UA 4M0WA 1TL9A 3H89A 2BU3A 1YK8A 4RNAA 1U9XA 4CDCB 4BS6A 2PBHA 4I05A 1AIMA 3KW9A 1MS6A 3IFUA 2F1GA 8PCHA 4PT5A 4YV8A 2C0YA 3IOQA 3PRMA 1ME4A 9PAPA 5CHTA 4XR7A 1PXVA 2R9NA 2VHFA 1PPOA 4QBBA 2FYEA 3NHEA 1CS8A 1THEA 3I06A 3MTNA 1U9QX 2OZ2A 1ZIVA 3N4CA 1ATKA 5E6JA 3E1ZB 4XZXA 1FH0A 3HHIA 3M99A 3O65A 3LFYA 1NPZA 2JTCA 3IHPA 3S3RA 3RVXA 1IWDA 3BOWA 2B1MA 1BGOA 1ME3A 2HH5A 1AU3A 1YK7A 2Z84A 3PT2A 3V6CA 1F2AA 2DZYA 1YALA 2PNSA 3TMPA 1MEMA 1CPJA 4MZSA 3PHWA 5JH3A 3RVVA 1F2CA 4I04A 5EGWA 2HHNA 6PADA 4I07A 3BPFA 4IUMA 3BBAA 3P5XA 1GCBA 2AIMA 1SNKA 2YJBA 1YVBA 1KFXL 1CQDA 2BDLA 1EF7A 2Y5BA 1KHQA 1NB5A 5PADA 4RF0A 2J7QA 4N4ZA 3LXSA 2CIOA 1KHPA 4A5UA 4D8EA 3I3TA 2ACTA 1MHWA 3WXFA 1K3BB 1AYWA 1M6DA 4OEMA 1AYUA 4AXLA 2DCDA 1MDWA 1MIRA 1ITOA 4KLBA 3GCBA 2PADA 1Y4HA 2AUXA 2E01A 2DCBA 2IPPB 4MSXA 2O6XA 3BWKA 3MORA 5EZQA 1F2BA 3F75A 4MI7A 4FK5A 3PSEA 2R9CA 2DJFB 1KXRA 1EWLA 3CBJA 2OP3A 5JA7A 4D8BA 3S3QA 1TLOA 3TRKA 1CJLA 4Q8HA 3BCNA 3OF9A 1HUCB 2PREA 1ICFA 4RKXA 4HWYA 4BQVA 3OQCA 1U9VA 3KX1A 1PPPA 2XU4A 2AS8A 3C0RA 2FTDA 1NQCA 2E02A 1QDQA 3OVXA 1PBHA 2GFOA 3ERVA 2HXZA 1PVJA 2ATOA 4ZUXU 3QT4A 4P6GA 3HD3A 3BY4A 4CZWA 1EWMA 1Q6KA 3MHHA 4YYRA 3MJ5A 3QJ3A 5JZEA 4W4UA 2ARYA 3CH3X 3HHAA 3W31A 1PPDA 3N3GA 4WURA 5CVOB 5F02A 2G8JA 1AU4A 3OF8A 2AYNA 4MM3B 5CHVA 1NL6A 1YT7A 1YZBA 4YYWA 4FIPA 2NQAA 4R3DA 2JQGR 4HXDB 1AYVA 2NQIA 2G6DA 4P6EA 3B79A 2HWKA 3KSEA 1QXPA 3IEJA 2R9FA 4PI3A 3WXEA 4AXMA 3HWNA 2E03A 4YYVA 5A24A 4QRVA 1Y08A 4D8IA 3N3KA 2DJGB 3IUTA 4OVZB 1QOLA 2NQGA 4P16A 5KO3A 1CVZA 2H7JA 3O0UA 3BPMA 2P86A 3KWBX 3PDFA 1AU0A 2R9OA 1PADA 4FJCA 3KKUA 4XUIA 3MP2A 4BOSA 4MZOA 2UZJA 3K24A 1F29A 2YJCA 2DC9A 2JQFR 3PHXA 4QRXA 5EZSA 1PPNA 1DF0A 1KFUL 1STFE 2P0RA 1A6RA 4X6IA 2VHSA 4BOZA 2IBIA 4BOUA 1GMYA 4RF1A 4PP2E 2G8EA 4OELA 4W5BA 4CDFB 3CBKA 4PP1A 2YJ8A 5J94A 3DF0A 4BPVA 3MTVA 2YJ9A 4BOQA 1XKGA 3RNVA 4YYUA 2DC7A 1BY8A 3P5WA 4OVZA 2FE8A 4N79A 3PW3A 2J7QC 2AUZA 3BB7A 1PCIA 2E00A 2F7DA 3K9MA 1SP4B 3AI8A 3BC3A 3WXGA 3IV2A 2WBFX 4IP3A 4RY2A 4REZA 1GECE 7PCKA 2FRAA 4ZTBA
chains in the Genus database with same CATH topology
4K7CA 1S4VA 3PNRA 1BP4A 5CVMA 3IMAA 3D6SA 2AVWA 1U5IA 1MEGA 1AU2A 2BDZA 3PBHA 1ZCMA 2G7YA 2NQDB 2FUDA 3H7DA 1CB5A 3F5VA 2DZZA 5FPWA 4CDEB 3RVWA 2AU1A 3P5VA 3ZUAA 4BS5A 1DEUA 2DCAA 3OVZA 2Y6EA 1NB3A 3C9EA 1GX3A 3U8EA 2DC8A 1POPA 5CVNB 3H6SA 1O0EA 4G54A 4N8WA 1AECA 2XU3A 1X9YA 4WA6A 3USVA 2R9MA 2BSZA 1CTEA 1BQIA 4Q8GA 3O1GA 3CH2X 3MHSA 4X6HA 1U9WA 1JQPA 2XU5A 3QSDA 1QMYA 2FO5A 4YYSA 2P7UA 1EWPA 1NLJA 2HD5A 2CB5A 1VJVA 1CV8A 3KFQA 1CSBB 1TU6A 1W5RA 2FRQA 4YYQA 2FT2A 3OISA 4X6JA 1GLOA 4CDDB 4DMYA 4BSQA 4DMXA 3KWZA 2FQ9A 4QH6A 2OULA 4BGFA 1EWOA 3P5UA 4PADA 3H8BA 4YVAA 3H8CA 3V6EA 2R6NA 3D9WA 3TNXA 2DCCA 5K16A 4W5CA 5EF4A 4QRGA 2XU1A 2B1NA 2DC6A 1VSNA 1PE6A 2AYOA 1PIPA 4C5PA 2GHUA 2YJ2A 3K8UA 1TL9A 3H89A 1YK8A 1U9XA 4CDCB 4BS6A 2PBHA 4I05A 1AIMA 3LTWA 3KW9A 1MS6A 2F1GA 8PCHA 4YV8A 2C0YA 3IOQA 1ME4A 9PAPA 5CHTA 4XR7A 1PXVA 2R9NA 2VFBA 2VHFA 1PPOA 4QBBA 2FYEA 3NHEA 1CS8A 1THEA 4GUZA 3I06A 3MTNA 1U9QX 2OZ2A 1ZIVA 3N4CA 1ATKA 3E1ZB 1FH0A 3HHIA 3M99A 3LFYA 1NPZA 3IHPA 3S3RA 3RVXA 1IWDA 1W6FA 3BOWA 2B1MA 1BGOA 1ME3A 2HH5A 1E2TA 1AU3A 1YK7A 3V6CA 1F2AA 2DZYA 1YALA 2PNSA 1MEMA 1CPJA 4MZSA 5JH3A 3RVVA 1F2CA 4I04A 5EGWA 2HHNA 4NV7A 6PADA 4I07A 3BPFA 3P5XA 1GCBA 2AIMA 1SNKA 2YJBA 1YVBA 1KFXL 1CQDA 2BDLA 1EF7A 2Y5BA 1KHQA 1NB5A 5PADA 4N4ZA 3LXSA 2CIOA 1KHPA 3I3TA 2ACTA 1MHWA 3WXFA 1K3BB 1AYWA 1M6DA 4OEMA 1AYUA 4AXLA 2DCDA 1MDWA 1MIRA 1ITOA 4KLBA 3GCBA 2PADA 1Y4HA 2AUXA 2E01A 2DCBA 2IPPB 4MSXA 2O6XA 3BWKA 3MORA 1F2BA 4NV8A 3F75A 4FK5A 2R9CA 2DJFB 1KXRA 1EWLA 3CBJA 2OP3A 5JA7A 3S3QA 1TLOA 1CJLA 4Q8HA 3BCNA 3OF9A 1HUCB 2PREA 1ICFA 4HWYA 4BQVA 1U9VA 3KX1A 1PPPA 2XU4A 2AS8A 2FTDA 1NQCA 2E02A 1QDQA 3OVXA 1PBHA 2GFOA 3ERVA 2HXZA 2ATOA 4ZUXU 3QT4A 4P6GA 3HD3A 4CZWA 1EWMA 1Q6KA 3MHHA 4YYRA 3QJ3A 4W4UA 2ARYA 3CH3X 3HHAA 1PPDA 3N3GA 1W4TA 5CVOB 5F02A 2G8JA 1AU4A 3OF8A 2AYNA 5CHVA 1NL6A 1YT7A 4YYWA 4FIPA 2NQAA 2JQGR 1AYVA 2NQIA 2G6DA 4P6EA 3B79A 3KSEA 1QXPA 3IEJA 2R9FA 4PI3A 3WXEA 4AXMA 3HWNA 2E03A 4YYVA 5A24A 4QRVA 1Y08A 3N3KA 2DJGB 3IUTA 1QOLA 2NQGA 1CVZA 2H7JA 3O0UA 4B55A 3BPMA 2P86A 3KWBX 3PDFA 1AU0A 2R9OA 1PADA 4FJCA 3KKUA 4XUIA 4MZOA 3K24A 1F29A 2YJCA 2DC9A 2JQFR 4QRXA 1PPNA 1DF0A 1KFUL 1STFE 2P0RA 1A6RA 4X6IA 2VHSA 2IBIA 1GMYA 4PP2E 2G8EA 4OELA 4W5BA 4CDFB 3CBKA 4PP1A 2YJ8A 5J94A 3DF0A 4BPVA 2YJ9A 1XKGA 2VFCA 4YYUA 2DC7A 1BY8A 3P5WA 4N79A 3PW3A 2AUZA 1PCIA 2E00A 2F7DA 3K9MA 1SP4B 3AI8A 3BC3A 3WXGA 3IV2A 2WBFX 4RY2A 1GECE 7PCKA 2FRAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K7C A;  1S4V A;  3PNR A;  1BP4 A;  5CVM A;  3IMA A;  3D6S A;  2AVW A;  1U5I A;  1MEG A;  1AU2 A;  2BDZ A;  3PBH A;  1ZCM A;  2G7Y A;  2NQD B;  2FUD A;  3H7D A;  1CB5 A;  3F5V A;  2DZZ A;  5FPW A;  4CDE B;  3RVW A;  2AU1 A;  3P5V A;  3ZUA A;  4BS5 A;  1DEU A;  2DCA A;  3OVZ A;  2Y6E A;  1NB3 A;  3C9E A;  3U8E A;  2DC8 A;  1POP A;  5CVN B;  3H6S A;  1O0E A;  4G54 A;  4N8W A;  1AEC A;  2XU3 A;  1X9Y A;  4WA6 A;  3USV A;  2R9M A;  1CTE A;  1BQI A;  4Q8G A;  3O1G A;  3CH2 X;  3MHS A;  4X6H A;  1U9W A;  1JQP A;  2XU5 A;  3QSD A;  1QMY A;  2FO5 A;  4YYS A;  2P7U A;  1EWP A;  1NLJ A;  2HD5 A;  2CB5 A;  1VJV A;  1CV8 A;  3KFQ A;  1CSB B;  1TU6 A;  2FRQ A;  4YYQ A;  2FT2 A;  3OIS A;  4X6J A;  1GLO A;  4CDD B;  4DMY A;  4BSQ A;  4DMX A;  3KWZ A;  2FQ9 A;  4QH6 A;  2OUL A;  1EWO A;  3P5U A;  4PAD A;  3H8B A;  4YVA A;  3H8C A;  3V6E A;  2R6N A;  3TNX A;  2DCC A;  5K16 A;  4W5C A;  5EF4 A;  4QRG A;  2XU1 A;  2B1N A;  2DC6 A;  1VSN A;  1PE6 A;  2AYO A;  1PIP A;  2GHU A;  2YJ2 A;  3K8U A;  1TL9 A;  3H89 A;  1YK8 A;  1U9X A;  4CDC B;  4BS6 A;  2PBH A;  4I05 A;  1AIM A;  3KW9 A;  1MS6 A;  2F1G A;  8PCH A;  4YV8 A;  2C0Y A;  3IOQ A;  1ME4 A;  9PAP A;  5CHT A;  4XR7 A;  1PXV A;  2R9N A;  2VHF A;  1PPO A;  4QBB A;  2FYE A;  3NHE A;  1CS8 A;  1THE A;  3I06 A;  3MTN A;  1U9Q X;  2OZ2 A;  1ZIV A;  3N4C A;  1ATK A;  3E1Z B;  1FH0 A;  3HHI A;  3M99 A;  3LFY A;  1NPZ A;  3IHP A;  3S3R A;  3RVX A;  1IWD A;  3BOW A;  2B1M A;  1BGO A;  1ME3 A;  2HH5 A;  1AU3 A;  1YK7 A;  3V6C A;  1F2A A;  2DZY A;  1YAL A;  2PNS A;  1MEM A;  1CPJ A;  4MZS A;  5JH3 A;  3RVV A;  1F2C A;  4I04 A;  5EGW A;  2HHN A;  6PAD A;  4I07 A;  3BPF A;  3P5X A;  1GCB A;  2AIM A;  1SNK A;  2YJB A;  1YVB A;  1KFX L;  1CQD A;  2BDL A;  1EF7 A;  2Y5B A;  1KHQ A;  1NB5 A;  5PAD A;  4N4Z A;  3LXS A;  2CIO A;  1KHP A;  3I3T A;  2ACT A;  1MHW A;  3WXF A;  1K3B B;  1AYW A;  1M6D A;  4OEM A;  1AYU A;  4AXL A;  2DCD A;  1MDW A;  1MIR A;  1ITO A;  4KLB A;  3GCB A;  2PAD A;  1Y4H A;  2AUX A;  2E01 A;  2DCB A;  2IPP B;  4MSX A;  2O6X A;  3BWK A;  3MOR A;  1F2B A;  3F75 A;  4FK5 A;  2R9C A;  2DJF B;  1KXR A;  1EWL A;  3CBJ A;  2OP3 A;  5JA7 A;  3S3Q A;  1TLO A;  1CJL A;  4Q8H A;  3BCN A;  3OF9 A;  1HUC B;  2PRE A;  1ICF A;  4HWY A;  4BQV A;  1U9V A;  3KX1 A;  1PPP A;  2XU4 A;  2AS8 A;  2FTD A;  1NQC A;  2E02 A;  1QDQ A;  3OVX A;  1PBH A;  2GFO A;  3ERV A;  2HXZ A;  2ATO A;  4ZUX U;  3QT4 A;  4P6G A;  3HD3 A;  4CZW A;  1EWM A;  1Q6K A;  3MHH A;  4YYR A;  3QJ3 A;  4W4U A;  2ARY A;  3CH3 X;  3HHA A;  1PPD A;  3N3G A;  5CVO B;  5F02 A;  2G8J A;  1AU4 A;  3OF8 A;  2AYN A;  5CHV A;  1NL6 A;  1YT7 A;  4YYW A;  4FIP A;  2NQA A;  2JQG R;  1AYV A;  2NQI A;  2G6D A;  4P6E A;  3B79 A;  3KSE A;  1QXP A;  3IEJ A;  2R9F A;  4PI3 A;  3WXE A;  4AXM A;  3HWN A;  2E03 A;  4YYV A;  5A24 A;  4QRV A;  1Y08 A;  3N3K A;  2DJG B;  3IUT A;  1QOL A;  2NQG A;  1CVZ A;  2H7J A;  3O0U A;  3BPM A;  2P86 A;  3KWB X;  3PDF A;  1AU0 A;  2R9O A;  1PAD A;  4FJC A;  3KKU A;  4XUI A;  4MZO A;  3K24 A;  1F29 A;  2YJC A;  2DC9 A;  2JQF R;  4QRX A;  1PPN A;  1DF0 A;  1KFU L;  1STF E;  2P0R A;  1A6R A;  4X6I A;  2VHS A;  2IBI A;  1GMY A;  4PP2 E;  2G8E A;  4OEL A;  4W5B A;  4CDF B;  3CBK A;  4PP1 A;  2YJ8 A;  5J94 A;  3DF0 A;  4BPV A;  2YJ9 A;  1XKG A;  4YYU A;  2DC7 A;  1BY8 A;  3P5W A;  4N79 A;  3PW3 A;  2AUZ A;  1PCI A;  2E00 A;  2F7D A;  3K9M A;  1SP4 B;  3AI8 A;  3BC3 A;  3WXG A;  3IV2 A;  2WBF X;  4RY2 A;  1GEC E;  7PCK A;  2FRA A; 
#chains in the Genus database with same CATH topology
 4K7C A;  1S4V A;  3PNR A;  1BP4 A;  3B21 A;  3PRP A;  5CVM A;  3IMA A;  3D6S A;  2AVW A;  1U5I A;  1MEG A;  1AU2 A;  2BDZ A;  3PBH A;  1ZCM A;  2G7Y A;  4BOP A;  3W30 A;  2NQD B;  2FUD A;  3H7D A;  1CB5 A;  2AGA A;  3F5V A;  2DZZ A;  5FPW A;  4CDE B;  3RVW A;  2AU1 A;  3P5V A;  4OW0 A;  3ZUA A;  4BS5 A;  1DEU A;  2DCA A;  3OVZ A;  2Y6E A;  1NB3 A;  3C9E A;  3U8E A;  2DC8 A;  1POP A;  5CVN B;  2BTW B;  3H6S A;  1O0E A;  4G54 A;  4N8W A;  1AEC A;  2XU3 A;  1X9Y A;  4GUA A;  4WA6 A;  3USV A;  2R9M A;  1CTE A;  1BQI A;  4Q8G A;  3O1G A;  3CH2 X;  3E9S A;  3MHS A;  4X6H A;  1U9W A;  1JQP A;  2XU5 A;  3QSD A;  1QMY A;  2FO5 A;  4YYS A;  2P7U A;  1DKI A;  1EWP A;  1NLJ A;  2HD5 A;  2CB5 A;  2DOS A;  1VJV A;  1CV8 A;  3KFQ A;  1CSB B;  1TU6 A;  2FRQ A;  4YYQ A;  1UKF A;  2FT2 A;  2JRI A;  3OIS A;  4X6J A;  1GLO A;  4CDD B;  4DMY A;  4BSQ A;  4DMX A;  3KWZ A;  2FQ9 A;  4QH6 A;  2OUL A;  3PHU A;  1EWO A;  3P5U A;  4PAD A;  3H8B A;  4YVA A;  3H8C A;  3V6E A;  2R6N A;  2BTW A;  3ZNH A;  3TNX A;  2DCC A;  5K16 A;  4W5C A;  5EF4 A;  4QRG A;  2XU1 A;  2B1N A;  2DC6 A;  1VSN A;  1PE6 A;  2AYO A;  1PIP A;  2GHU A;  2YJ2 A;  3K8U A;  4M0W A;  1TL9 A;  3H89 A;  2BU3 A;  1YK8 A;  4RNA A;  1U9X A;  4CDC B;  4BS6 A;  2PBH A;  4I05 A;  1AIM A;  3KW9 A;  1MS6 A;  3IFU A;  2F1G A;  8PCH A;  4PT5 A;  4YV8 A;  2C0Y A;  3IOQ A;  3PRM A;  1ME4 A;  9PAP A;  5CHT A;  4XR7 A;  1PXV A;  2R9N A;  2VHF A;  1PPO A;  4QBB A;  2FYE A;  3NHE A;  1CS8 A;  1THE A;  3I06 A;  3MTN A;  1U9Q X;  2OZ2 A;  1ZIV A;  3N4C A;  1ATK A;  5E6J A;  3E1Z B;  4XZX A;  1FH0 A;  3HHI A;  3M99 A;  3O65 A;  3LFY A;  1NPZ A;  2JTC A;  3IHP A;  3S3R A;  3RVX A;  1IWD A;  3BOW A;  2B1M A;  1BGO A;  1ME3 A;  2HH5 A;  1AU3 A;  1YK7 A;  2Z84 A;  3PT2 A;  3V6C A;  1F2A A;  2DZY A;  1YAL A;  2PNS A;  3TMP A;  1MEM A;  1CPJ A;  4MZS A;  3PHW A;  5JH3 A;  3RVV A;  1F2C A;  4I04 A;  5EGW A;  2HHN A;  6PAD A;  4I07 A;  3BPF A;  4IUM A;  3BBA A;  3P5X A;  1GCB A;  2AIM A;  1SNK A;  2YJB A;  1YVB A;  1KFX L;  1CQD A;  2BDL A;  1EF7 A;  2Y5B A;  1KHQ A;  1NB5 A;  5PAD A;  4RF0 A;  2J7Q A;  4N4Z A;  3LXS A;  2CIO A;  1KHP A;  4A5U A;  4D8E A;  3I3T A;  2ACT A;  1MHW A;  3WXF A;  1K3B B;  1AYW A;  1M6D A;  4OEM A;  1AYU A;  4AXL A;  2DCD A;  1MDW A;  1MIR A;  1ITO A;  4KLB A;  3GCB A;  2PAD A;  1Y4H A;  2AUX A;  2E01 A;  2DCB A;  2IPP B;  4MSX A;  2O6X A;  3BWK A;  3MOR A;  5EZQ A;  1F2B A;  3F75 A;  4MI7 A;  4FK5 A;  3PSE A;  2R9C A;  2DJF B;  1KXR A;  1EWL A;  3CBJ A;  2OP3 A;  5JA7 A;  4D8B A;  3S3Q A;  1TLO A;  3TRK A;  1CJL A;  4Q8H A;  3BCN A;  3OF9 A;  1HUC B;  2PRE A;  1ICF A;  4RKX A;  4HWY A;  4BQV A;  3OQC A;  1U9V A;  3KX1 A;  1PPP A;  2XU4 A;  2AS8 A;  3C0R A;  2FTD A;  1NQC A;  2E02 A;  1QDQ A;  3OVX A;  1PBH A;  2GFO A;  3ERV A;  2HXZ A;  1PVJ A;  2ATO A;  4ZUX U;  3QT4 A;  4P6G A;  3HD3 A;  3BY4 A;  4CZW A;  1EWM A;  1Q6K A;  3MHH A;  4YYR A;  3MJ5 A;  3QJ3 A;  5JZE A;  4W4U A;  2ARY A;  3CH3 X;  3HHA A;  3W31 A;  1PPD A;  3N3G A;  4WUR A;  5CVO B;  5F02 A;  2G8J A;  1AU4 A;  3OF8 A;  2AYN A;  4MM3 B;  5CHV A;  1NL6 A;  1YT7 A;  1YZB A;  4YYW A;  4FIP A;  2NQA A;  4R3D A;  2JQG R;  4HXD B;  1AYV A;  2NQI A;  2G6D A;  4P6E A;  3B79 A;  2HWK A;  3KSE A;  1QXP A;  3IEJ A;  2R9F A;  4PI3 A;  3WXE A;  4AXM A;  3HWN A;  2E03 A;  4YYV A;  5A24 A;  4QRV A;  1Y08 A;  4D8I A;  3N3K A;  2DJG B;  3IUT A;  4OVZ B;  1QOL A;  2NQG A;  4P16 A;  5KO3 A;  1CVZ A;  2H7J A;  3O0U A;  3BPM A;  2P86 A;  3KWB X;  3PDF A;  1AU0 A;  2R9O A;  1PAD A;  4FJC A;  3KKU A;  4XUI A;  3MP2 A;  4BOS A;  4MZO A;  2UZJ A;  3K24 A;  1F29 A;  2YJC A;  2DC9 A;  2JQF R;  3PHX A;  4QRX A;  5EZS A;  1PPN A;  1DF0 A;  1KFU L;  1STF E;  2P0R A;  1A6R A;  4X6I A;  2VHS A;  4BOZ A;  2IBI A;  4BOU A;  1GMY A;  4RF1 A;  4PP2 E;  2G8E A;  4OEL A;  4W5B A;  4CDF B;  3CBK A;  4PP1 A;  2YJ8 A;  5J94 A;  3DF0 A;  4BPV A;  3MTV A;  2YJ9 A;  4BOQ A;  1XKG A;  3RNV A;  4YYU A;  2DC7 A;  1BY8 A;  3P5W A;  4OVZ A;  2FE8 A;  4N79 A;  3PW3 A;  2J7Q C;  2AUZ A;  3BB7 A;  1PCI A;  2E00 A;  2F7D A;  3K9M A;  1SP4 B;  3AI8 A;  3BC3 A;  3WXG A;  3IV2 A;  2WBF X;  4IP3 A;  4RY2 A;  4REZ A;  1GEC E;  7PCK A;  2FRA A;  4ZTB A; 
#chains in the Genus database with same CATH homology
 4K7C A;  1S4V A;  3PNR A;  1BP4 A;  5CVM A;  3IMA A;  3D6S A;  2AVW A;  1U5I A;  1MEG A;  1AU2 A;  2BDZ A;  3PBH A;  1ZCM A;  2G7Y A;  2NQD B;  2FUD A;  3H7D A;  1CB5 A;  3F5V A;  2DZZ A;  5FPW A;  4CDE B;  3RVW A;  2AU1 A;  3P5V A;  3ZUA A;  4BS5 A;  1DEU A;  2DCA A;  3OVZ A;  2Y6E A;  1NB3 A;  3C9E A;  1GX3 A;  3U8E A;  2DC8 A;  1POP A;  5CVN B;  3H6S A;  1O0E A;  4G54 A;  4N8W A;  1AEC A;  2XU3 A;  1X9Y A;  4WA6 A;  3USV A;  2R9M A;  2BSZ A;  1CTE A;  1BQI A;  4Q8G A;  3O1G A;  3CH2 X;  3MHS A;  4X6H A;  1U9W A;  1JQP A;  2XU5 A;  3QSD A;  1QMY A;  2FO5 A;  4YYS A;  2P7U A;  1EWP A;  1NLJ A;  2HD5 A;  2CB5 A;  1VJV A;  1CV8 A;  3KFQ A;  1CSB B;  1TU6 A;  1W5R A;  2FRQ A;  4YYQ A;  2FT2 A;  3OIS A;  4X6J A;  1GLO A;  4CDD B;  4DMY A;  4BSQ A;  4DMX A;  3KWZ A;  2FQ9 A;  4QH6 A;  2OUL A;  4BGF A;  1EWO A;  3P5U A;  4PAD A;  3H8B A;  4YVA A;  3H8C A;  3V6E A;  2R6N A;  3D9W A;  3TNX A;  2DCC A;  5K16 A;  4W5C A;  5EF4 A;  4QRG A;  2XU1 A;  2B1N A;  2DC6 A;  1VSN A;  1PE6 A;  2AYO A;  1PIP A;  4C5P A;  2GHU A;  2YJ2 A;  3K8U A;  1TL9 A;  3H89 A;  1YK8 A;  1U9X A;  4CDC B;  4BS6 A;  2PBH A;  4I05 A;  1AIM A;  3LTW A;  3KW9 A;  1MS6 A;  2F1G A;  8PCH A;  4YV8 A;  2C0Y A;  3IOQ A;  1ME4 A;  9PAP A;  5CHT A;  4XR7 A;  1PXV A;  2R9N A;  2VFB A;  2VHF A;  1PPO A;  4QBB A;  2FYE A;  3NHE A;  1CS8 A;  1THE A;  4GUZ A;  3I06 A;  3MTN A;  1U9Q X;  2OZ2 A;  1ZIV A;  3N4C A;  1ATK A;  3E1Z B;  1FH0 A;  3HHI A;  3M99 A;  3LFY A;  1NPZ A;  3IHP A;  3S3R A;  3RVX A;  1IWD A;  1W6F A;  3BOW A;  2B1M A;  1BGO A;  1ME3 A;  2HH5 A;  1E2T A;  1AU3 A;  1YK7 A;  3V6C A;  1F2A A;  2DZY A;  1YAL A;  2PNS A;  1MEM A;  1CPJ A;  4MZS A;  5JH3 A;  3RVV A;  1F2C A;  4I04 A;  5EGW A;  2HHN A;  4NV7 A;  6PAD A;  4I07 A;  3BPF A;  3P5X A;  1GCB A;  2AIM A;  1SNK A;  2YJB A;  1YVB A;  1KFX L;  1CQD A;  2BDL A;  1EF7 A;  2Y5B A;  1KHQ A;  1NB5 A;  5PAD A;  4N4Z A;  3LXS A;  2CIO A;  1KHP A;  3I3T A;  2ACT A;  1MHW A;  3WXF A;  1K3B B;  1AYW A;  1M6D A;  4OEM A;  1AYU A;  4AXL A;  2DCD A;  1MDW A;  1MIR A;  1ITO A;  4KLB A;  3GCB A;  2PAD A;  1Y4H A;  2AUX A;  2E01 A;  2DCB A;  2IPP B;  4MSX A;  2O6X A;  3BWK A;  3MOR A;  1F2B A;  4NV8 A;  3F75 A;  4FK5 A;  2R9C A;  2DJF B;  1KXR A;  1EWL A;  3CBJ A;  2OP3 A;  5JA7 A;  3S3Q A;  1TLO A;  1CJL A;  4Q8H A;  3BCN A;  3OF9 A;  1HUC B;  2PRE A;  1ICF A;  4HWY A;  4BQV A;  1U9V A;  3KX1 A;  1PPP A;  2XU4 A;  2AS8 A;  2FTD A;  1NQC A;  2E02 A;  1QDQ A;  3OVX A;  1PBH A;  2GFO A;  3ERV A;  2HXZ A;  2ATO A;  4ZUX U;  3QT4 A;  4P6G A;  3HD3 A;  4CZW A;  1EWM A;  1Q6K A;  3MHH A;  4YYR A;  3QJ3 A;  4W4U A;  2ARY A;  3CH3 X;  3HHA A;  1PPD A;  3N3G A;  1W4T A;  5CVO B;  5F02 A;  2G8J A;  1AU4 A;  3OF8 A;  2AYN A;  5CHV A;  1NL6 A;  1YT7 A;  4YYW A;  4FIP A;  2NQA A;  2JQG R;  1AYV A;  2NQI A;  2G6D A;  4P6E A;  3B79 A;  3KSE A;  1QXP A;  3IEJ A;  2R9F A;  4PI3 A;  3WXE A;  4AXM A;  3HWN A;  2E03 A;  4YYV A;  5A24 A;  4QRV A;  1Y08 A;  3N3K A;  2DJG B;  3IUT A;  1QOL A;  2NQG A;  1CVZ A;  2H7J A;  3O0U A;  4B55 A;  3BPM A;  2P86 A;  3KWB X;  3PDF A;  1AU0 A;  2R9O A;  1PAD A;  4FJC A;  3KKU A;  4XUI A;  4MZO A;  3K24 A;  1F29 A;  2YJC A;  2DC9 A;  2JQF R;  4QRX A;  1PPN A;  1DF0 A;  1KFU L;  1STF E;  2P0R A;  1A6R A;  4X6I A;  2VHS A;  2IBI A;  1GMY A;  4PP2 E;  2G8E A;  4OEL A;  4W5B A;  4CDF B;  3CBK A;  4PP1 A;  2YJ8 A;  5J94 A;  3DF0 A;  4BPV A;  2YJ9 A;  1XKG A;  2VFC A;  4YYU A;  2DC7 A;  1BY8 A;  3P5W A;  4N79 A;  3PW3 A;  2AUZ A;  1PCI A;  2E00 A;  2F7D A;  3K9M A;  1SP4 B;  3AI8 A;  3BC3 A;  3WXG A;  3IV2 A;  2WBF X;  4RY2 A;  1GEC E;  7PCK A;  2FRA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...