1F2BA

Crystal structure analysis of cruzain bound to vinyl sulfone derived inhibitor (iii)
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
215
structure length
215
Chain Sequence
APAAVDWRARGAVTAVKDQGQCGSCWAFSAIGNVECQWFLAGHPLTNLSEQMLVSCDKTDSGCSGGLMNNAFEWIVQENNGAVYTEDSYPYASGEGISPPCTTSGHTVGATITGHVELPQDEAQIAAWLAVNGPVAVAVDASSWMTYTGGVMTSCVSEQLDHGVLLVGYNDSAAVPYWIIKNSWTTQWGEEGYIRIAKGSNQCLVKEEASSAVVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A target within the target: probing cruzain's P1' site to define structural determinants for the Chagas' disease protease.
pubmed doi rcsb
source organism Trypanosoma cruzi
molecule tags Hydrolase
molecule keywords CRUZAIN
total genus 66
structure length 215
sequence length 215
ec nomenclature ec 3.4.22.51: Cruzipain.
pdb deposition date 2000-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1f2bA00
2YJ8A 3U8EA 1EWOA 4P6GA 4W4UA 3WXGA 3MHHA 2IBIA 4QBBA 2R9OA 3IUTA 3MORA 3K9MA 4X6JA 2DZYA 3CH2X 1YK8A 4BQVA 5CVMA 4YYVA 2E02A 3HD3A 2DC7A 1AU2A 4W5CA 2AIMA 2P7UA 2DCCA 5CVNB 1PPOA 2YJ2A 1PXVA 3QSDA 3CH3X 1MEMA 2BDZA 3KSEA 1U9VA 3WXFA 4CDDB 1BY8A 4N8WA 1KFUL 3IHPA 2AUXA 3O1GA 2ARYA 5JH3A 1Y08A 4Q8GA 1NL6A 3P5XA 2R9FA 1F2AA 4OELA 1U9WA 2CIOA 1EWMA 2NQDB 2NQIA 3LXSA 1PPDA 2AS8A 2YJCA 2R9CA 4BS5A 3QT4A 1BGOA 3P5VA 4PP2E 1F2CA 3RVVA 1SNKA 2P0RA 4I07A 4W5BA 4I05A 4XR7A 2C0YA 4HWYA 3I3TA 4PP1A 3OISA 2XU4A 5J94A 1PADA 8PCHA 2GHUA 2FT2A 1PPNA 4QRVA 1PCIA 2DCAA 3IEJA 1VJVA 1ME4A 3N3GA 3PDFA 1CV8A 3D6SA 2PREA 1CB5A 1ME3A 1U9QX 2XU5A 3BPFA 4PADA 1MS6A 1QXPA 2AUZA 1Y4HA 1IWDA 4CDCB 1CTEA 4Q8HA 1EF7A 3HWNA 1GCBA 1MEGA 4BPVA 1AU4A 1CPJA 4G54A 3F75A 2OP3A 4YYRA 1PPPA 4AXMA 1S4VA 2PBHA 1X9YA 2O6XA 1GECE 3TNXA 5F02A 3KWZA 3USVA 2H7JA 3NHEA 2GFOA 1MDWA 1ICFA 4FIPA 1PE6A 1YK7A 1KHQA 3LFYA 2R6NA 3V6EA 1AU0A 5CHTA 5FPWA 1BP4A 2NQAA 2G6DA 3HHAA 3KKUA 1FH0A 1GMYA 3E1ZB 2E03A 2FTDA 3AI8A 3GCBA 4P6EA 3QJ3A 1NQCA 2B1NA 3MHSA 4YYWA 1K3BB 2PNSA 2R9NA 2VHFA 3KWBX 1EWPA 2PADA 3H89A 3HHIA 2DC9A 3PNRA 4DMXA 1PIPA 1JQPA 4MSXA 4YYSA 3BOWA 1O0EA 2BDLA 1PBHA 1F29A 1MHWA 2DC8A 2AYOA 1THEA 2XU3A 1AYWA 2P86A 6PADA 1YALA 1BQIA 2DCBA 1NPZA 2IPPB 1CVZA 3O0UA 3DF0A 5K16A 1AIMA 2Y6EA 1STFE 1ZIVA 2FRQA 1EWLA 2VHSA 1ATKA 2ACTA 4AXLA 9PAPA 1YT7A 2FUDA 3N3KA 3OVXA 4YYQA 3KX1A 4QRGA 1AYUA 4BSQA 3V6CA 3BC3A 4DMYA 2G8EA 2AYNA 2CB5A 3RVWA 7PCKA 1NB5A 3M99A 1DF0A 1CSBB 3C9EA 2DJGB 1VSNA 3PBHA 2E01A 1TLOA 2OZ2A 3B79A 3N4CA 5EF4A 2ATOA 1KHPA 4PI3A 4N4ZA 1XKGA 1DEUA 3H6SA 4BS6A 1ITOA 1TU6A 1AU3A 1KXRA 1SP4B 2HH5A 2DC6A 3K24A 3OF8A 4YVAA 2G8JA 1QOLA 2JQFR 4KLBA 1NLJA 1CS8A 4MZSA 1CQDA 4X6HA 1F2BA 1GLOA 3K8UA 2R9MA 3IV2A 2YJBA 5EGWA 3ERVA 1HUCB 3I06A 4CDEB 5JA7A 1AECA 2HXZA 3OVZA 2NQGA 3P5UA 4I04A 3F5VA 1QDQA 2AVWA 1AYVA 4YV8A 2WBFX 4WA6A 2FRAA 2FO5A 3S3QA 3BPMA 3MTNA 1MIRA 3WXEA 1KFXL 1M6DA 2F7DA 3ZUAA 3PW3A 1ZCMA 2DCDA 3CBJA 4QRXA 2Y5BA 3BCNA 3IMAA 1TL9A 3RVXA 1U5IA 2XU1A 2HHNA 3KFQA 3P5WA 2DZZA 5A24A 4MZOA 4QH6A 2B1MA 3OF9A 3H8BA 4RY2A 4XUIA 1U9XA 4N79A 3S3RA 4FJCA 4FK5A 4CDFB 4K7CA 2FQ9A 2DJFB 4X6IA 1NB3A 1QMYA 2JQGR 4CZWA 2F1GA 1A6RA 3H8CA 2E00A 5CVOB 3H7DA 3KW9A 1CJLA 3CBKA 2YJ9A 3IOQA 3BWKA 2AU1A 4YYUA 2FYEA 2G7YA 4ZUXU 1POPA 2OULA 1Q6KA 5PADA 2HD5A 5CHVA 1YVBA 4OEMA
chains in the Genus database with same CATH superfamily
2YJ8A 3U8EA 1EWOA 4P6GA 4W4UA 3WXGA 3MHHA 2J7QC 2Z84A 2IBIA 4QBBA 2R9OA 3IUTA 3MORA 3K9MA 4X6JA 2DZYA 3CH2X 1YK8A 3W31A 4BQVA 4P16A 5CVMA 4YYVA 3BBAA 2E02A 2DOSA 3HD3A 2DC7A 1AU2A 4W5CA 2AIMA 3O65A 2P7UA 2DCCA 5CVNB 1PPOA 2YJ2A 1PXVA 3QSDA 3CH3X 1MEMA 2BDZA 3KSEA 1U9VA 4GUAA 3WXFA 4HXDB 4CDDB 1BY8A 4N8WA 1KFUL 3IHPA 4BOUA 2AUXA 3O1GA 2ARYA 1YZBA 5JH3A 4BOQA 1Y08A 4Q8GA 1NL6A 3P5XA 4RNAA 2R9FA 1F2AA 4OELA 1U9WA 2CIOA 1EWMA 2NQDB 2NQIA 3LXSA 3PHXA 1PPDA 2AS8A 2UZJA 2YJCA 2R9CA 4BS5A 3QT4A 3TMPA 1BGOA 3P5VA 4PP2E 1F2CA 3RVVA 1SNKA 2P0RA 4I07A 3PHWA 4W5BA 4I05A 4XR7A 2C0YA 4HWYA 3I3TA 4PP1A 4WURA 4OVZB 3OISA 2XU4A 5J94A 3BY4A 1PADA 8PCHA 2GHUA 2FT2A 1PPNA 4QRVA 3PRPA 1PCIA 2DCAA 3IEJA 1VJVA 1ME4A 3C0RA 3N3GA 3PDFA 1CV8A 3MJ5A 3D6SA 2PREA 1CB5A 1ME3A 2JTCA 1U9QX 2XU5A 3BPFA 4PADA 1MS6A 1QXPA 2AUZA 4ZTBA 1Y4HA 1IWDA 4CDCB 1CTEA 4Q8HA 1EF7A 3HWNA 4M0WA 1GCBA 1MEGA 2BU3A 4BPVA 1AU4A 2J7QA 1CPJA 4G54A 3F75A 2OP3A 4YYRA 1PPPA 4AXMA 1S4VA 2PBHA 1X9YA 2O6XA 1GECE 3TNXA 5F02A 3KWZA 3USVA 2H7JA 3PHUA 3NHEA 2GFOA 1MDWA 1ICFA 4FIPA 1PE6A 1YK7A 1KHQA 3LFYA 3RNVA 2R6NA 1AU0A 5CHTA 3V6EA 5FPWA 1PVJA 1BP4A 2NQAA 2G6DA 3HHAA 3KKUA 1FH0A 1GMYA 3E1ZB 2E03A 3MP2A 2FE8A 2FTDA 3AI8A 4RF1A 3GCBA 4P6EA 4BOZA 3QJ3A 1NQCA 2B1NA 3MHSA 4YYWA 1K3BB 2PNSA 3B21A 2R9NA 2VHFA 3KWBX 1EWPA 2PADA 3H89A 3HHIA 2DC9A 3PNRA 4DMXA 1PIPA 1JQPA 4MSXA 4YYSA 3BOWA 1O0EA 4XZXA 2BDLA 1PBHA 1F29A 1MHWA 2DC8A 4IUMA 2AYOA 4R3DA 1THEA 2BTWB 2XU3A 1AYWA 2P86A 6PADA 1YALA 1BQIA 2DCBA 1NPZA 2IPPB 1CVZA 3O0UA 3DF0A 5K16A 1AIMA 2Y6EA 1STFE 1ZIVA 2FRQA 1EWLA 2VHSA 3PRMA 1ATKA 2ACTA 4AXLA 9PAPA 1YT7A 2FUDA 4RKXA 3N3KA 3OVXA 4YYQA 3KX1A 4QRGA 1AYUA 4BSQA 3V6CA 4REZA 3BC3A 4DMYA 2G8EA 2AYNA 2CB5A 4D8IA 3RVWA 2AGAA 7PCKA 1NB5A 3ZNHA 3M99A 1DF0A 1CSBB 3C9EA 2DJGB 1VSNA 3PBHA 2E01A 3PSEA 1TLOA 2OZ2A 3B79A 3N4CA 5EF4A 2ATOA 1KHPA 3E9SA 4OVZA 4PI3A 4N4ZA 1XKGA 1DEUA 3H6SA 4BS6A 1ITOA 1TU6A 1AU3A 1KXRA 1SP4B 3TRKA 2HH5A 2DC6A 3K24A 3OF8A 4MM3B 4YVAA 2G8JA 1QOLA 2JQFR 4KLBA 3IFUA 1NLJA 5KO3A 1CS8A 3BB7A 4MZSA 1CQDA 4X6HA 1F2BA 3PT2A 1GLOA 4RF0A 3K8UA 2R9MA 3IV2A 2JRIA 2YJBA 5EGWA 3ERVA 1HUCB 3I06A 4CDEB 5JA7A 1AECA 2HXZA 3OVZA 2NQGA 3P5UA 4I04A 3F5VA 1DKIA 1QDQA 2AVWA 1AYVA 4YV8A 2WBFX 4WA6A 2FRAA 2FO5A 3S3QA 3BPMA 3MTNA 1MIRA 4D8EA 3WXEA 1KFXL 4MI7A 1M6DA 2F7DA 3ZUAA 3PW3A 1ZCMA 2DCDA 3CBJA 4QRXA 2Y5BA 3BCNA 3IMAA 1UKFA 1TL9A 4BOPA 3RVXA 1U5IA 2XU1A 2HHNA 2HWKA 3KFQA 5E6JA 3P5WA 2DZZA 5A24A 4IP3A 4MZOA 3MTVA 4QH6A 2B1MA 3OF9A 3H8BA 4RY2A 4A5UA 4XUIA 1U9XA 5EZQA 4N79A 3S3RA 4FJCA 4FK5A 4CDFB 3OQCA 4K7CA 2FQ9A 2DJFB 4X6IA 2BTWA 1NB3A 1QMYA 5EZSA 2JQGR 4CZWA 2F1GA 1A6RA 3W30A 3H8CA 2E00A 5CVOB 4D8BA 3H7DA 3KW9A 5JZEA 1CJLA 3CBKA 2YJ9A 3IOQA 3BWKA 4PT5A 2AU1A 4YYUA 4OW0A 2FYEA 2G7YA 1POPA 2OULA 1Q6KA 5PADA 4ZUXU 4BOSA 2HD5A 5CHVA 1YVBA 4OEMA
chains in the Genus database with same CATH topology
2YJ8A 3U8EA 1EWOA 4P6GA 4W4UA 3WXGA 3MHHA 2IBIA 4QBBA 2R9OA 3IUTA 3MORA 3K9MA 4X6JA 2DZYA 3CH2X 1YK8A 4BQVA 5CVMA 4YYVA 2E02A 3HD3A 2DC7A 1AU2A 2VFBA 4W5CA 2AIMA 2P7UA 2DCCA 5CVNB 1PPOA 2YJ2A 1PXVA 3QSDA 3CH3X 1MEMA 2BDZA 3KSEA 1U9VA 3WXFA 4CDDB 1BY8A 4N8WA 1KFUL 3IHPA 2AUXA 3O1GA 2ARYA 5JH3A 1Y08A 4Q8GA 1NL6A 3P5XA 2R9FA 1F2AA 4OELA 1U9WA 2CIOA 1EWMA 2NQDB 2NQIA 3LXSA 1PPDA 2AS8A 2YJCA 2R9CA 4BS5A 3QT4A 1BGOA 3P5VA 4PP2E 1F2CA 3RVVA 1SNKA 2P0RA 4I07A 4W5BA 4I05A 4XR7A 1W4TA 2C0YA 4HWYA 3I3TA 4PP1A 3OISA 2XU4A 5J94A 1PADA 8PCHA 2GHUA 2FT2A 1PPNA 4QRVA 1PCIA 2DCAA 3IEJA 1VJVA 1ME4A 3N3GA 3PDFA 1CV8A 3D6SA 2PREA 4GUZA 1CB5A 1ME3A 1U9QX 2XU5A 3BPFA 4PADA 1MS6A 1QXPA 2AUZA 1Y4HA 1IWDA 4CDCB 1CTEA 4Q8HA 1EF7A 3HWNA 1GCBA 3LTWA 1MEGA 4BPVA 1AU4A 1CPJA 4G54A 3F75A 2OP3A 4YYRA 1PPPA 4AXMA 1S4VA 2PBHA 1W5RA 1X9YA 2O6XA 1GECE 3TNXA 5F02A 3KWZA 3USVA 2H7JA 3NHEA 2GFOA 1MDWA 1ICFA 4FIPA 1PE6A 1YK7A 1KHQA 3LFYA 2R6NA 1AU0A 5CHTA 3V6EA 4B55A 5FPWA 1BP4A 2NQAA 2G6DA 3HHAA 3KKUA 1FH0A 1GMYA 3E1ZB 2E03A 2FTDA 3AI8A 3GCBA 4P6EA 4C5PA 3QJ3A 1NQCA 2B1NA 3MHSA 4YYWA 1K3BB 2PNSA 2R9NA 2VHFA 3KWBX 1EWPA 2PADA 3H89A 3HHIA 2DC9A 3PNRA 4DMXA 1PIPA 1JQPA 4MSXA 4YYSA 3BOWA 1O0EA 2BDLA 1PBHA 1F29A 1MHWA 2DC8A 2AYOA 1THEA 2XU3A 1AYWA 2P86A 6PADA 1YALA 1BQIA 1GX3A 2DCBA 1NPZA 2IPPB 1CVZA 3O0UA 3DF0A 5K16A 1AIMA 2Y6EA 1STFE 1ZIVA 2FRQA 1EWLA 2VHSA 1ATKA 2ACTA 4AXLA 3D9WA 9PAPA 1YT7A 2VFCA 2FUDA 3N3KA 3OVXA 4YYQA 3KX1A 4QRGA 1AYUA 4BSQA 3V6CA 3BC3A 4DMYA 2G8EA 2AYNA 2CB5A 3RVWA 7PCKA 1NB5A 3M99A 1DF0A 1CSBB 3C9EA 2DJGB 1VSNA 3PBHA 2E01A 1TLOA 2OZ2A 3B79A 3N4CA 5EF4A 2ATOA 1KHPA 4PI3A 4N4ZA 1XKGA 1DEUA 3H6SA 4BS6A 1ITOA 1TU6A 1AU3A 1KXRA 1SP4B 2HH5A 2DC6A 3K24A 3OF8A 4YVAA 2G8JA 1QOLA 2JQFR 4KLBA 1NLJA 1CS8A 4MZSA 1CQDA 4X6HA 1F2BA 1GLOA 3K8UA 2R9MA 3IV2A 1E2TA 2YJBA 5EGWA 3ERVA 1HUCB 3I06A 4NV8A 4CDEB 5JA7A 1AECA 2HXZA 3OVZA 2NQGA 3P5UA 4I04A 3F5VA 1QDQA 2AVWA 1AYVA 4YV8A 2WBFX 4WA6A 2FRAA 2FO5A 3S3QA 3BPMA 3MTNA 1MIRA 3WXEA 1KFXL 1M6DA 2F7DA 3ZUAA 3PW3A 1ZCMA 2DCDA 3CBJA 4QRXA 2Y5BA 3BCNA 3IMAA 1TL9A 3RVXA 1U5IA 2XU1A 2HHNA 3KFQA 3P5WA 2DZZA 5A24A 4MZOA 4QH6A 2B1MA 3OF9A 3H8BA 4RY2A 4XUIA 1U9XA 4N79A 3S3RA 4FJCA 4FK5A 4CDFB 4NV7A 4K7CA 2FQ9A 2DJFB 4X6IA 1NB3A 1QMYA 2JQGR 4CZWA 2F1GA 1A6RA 3H8CA 2E00A 5CVOB 3H7DA 3KW9A 1CJLA 3CBKA 2YJ9A 3IOQA 3BWKA 1W6FA 2AU1A 4YYUA 2FYEA 2G7YA 4ZUXU 1POPA 2OULA 1Q6KA 5PADA 4BGFA 2BSZA 2HD5A 5CHVA 1YVBA 4OEMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YJ8 A;  3U8E A;  1EWO A;  4P6G A;  4W4U A;  3WXG A;  3MHH A;  2IBI A;  4QBB A;  2R9O A;  3IUT A;  3MOR A;  3K9M A;  4X6J A;  2DZY A;  3CH2 X;  1YK8 A;  4BQV A;  5CVM A;  4YYV A;  2E02 A;  3HD3 A;  2DC7 A;  1AU2 A;  4W5C A;  2AIM A;  2P7U A;  2DCC A;  5CVN B;  1PPO A;  2YJ2 A;  1PXV A;  3QSD A;  3CH3 X;  1MEM A;  2BDZ A;  3KSE A;  1U9V A;  3WXF A;  4CDD B;  1BY8 A;  4N8W A;  1KFU L;  3IHP A;  2AUX A;  3O1G A;  2ARY A;  5JH3 A;  1Y08 A;  4Q8G A;  1NL6 A;  3P5X A;  2R9F A;  1F2A A;  4OEL A;  1U9W A;  2CIO A;  1EWM A;  2NQD B;  2NQI A;  3LXS A;  1PPD A;  2AS8 A;  2YJC A;  2R9C A;  4BS5 A;  3QT4 A;  1BGO A;  3P5V A;  4PP2 E;  1F2C A;  3RVV A;  1SNK A;  2P0R A;  4I07 A;  4W5B A;  4I05 A;  4XR7 A;  2C0Y A;  4HWY A;  3I3T A;  4PP1 A;  3OIS A;  2XU4 A;  5J94 A;  1PAD A;  8PCH A;  2GHU A;  2FT2 A;  1PPN A;  4QRV A;  1PCI A;  2DCA A;  3IEJ A;  1VJV A;  1ME4 A;  3N3G A;  3PDF A;  1CV8 A;  3D6S A;  2PRE A;  1CB5 A;  1ME3 A;  1U9Q X;  2XU5 A;  3BPF A;  4PAD A;  1MS6 A;  1QXP A;  2AUZ A;  1Y4H A;  1IWD A;  4CDC B;  1CTE A;  4Q8H A;  1EF7 A;  3HWN A;  1GCB A;  1MEG A;  4BPV A;  1AU4 A;  1CPJ A;  4G54 A;  3F75 A;  2OP3 A;  4YYR A;  1PPP A;  4AXM A;  1S4V A;  2PBH A;  1X9Y A;  2O6X A;  1GEC E;  3TNX A;  5F02 A;  3KWZ A;  3USV A;  2H7J A;  3NHE A;  2GFO A;  1MDW A;  1ICF A;  4FIP A;  1PE6 A;  1YK7 A;  1KHQ A;  3LFY A;  2R6N A;  3V6E A;  1AU0 A;  5CHT A;  5FPW A;  1BP4 A;  2NQA A;  2G6D A;  3HHA A;  3KKU A;  1FH0 A;  1GMY A;  3E1Z B;  2E03 A;  2FTD A;  3AI8 A;  3GCB A;  4P6E A;  3QJ3 A;  1NQC A;  2B1N A;  3MHS A;  4YYW A;  1K3B B;  2PNS A;  2R9N A;  2VHF A;  3KWB X;  1EWP A;  2PAD A;  3H89 A;  3HHI A;  2DC9 A;  3PNR A;  4DMX A;  1PIP A;  1JQP A;  4MSX A;  4YYS A;  3BOW A;  1O0E A;  2BDL A;  1PBH A;  1F29 A;  1MHW A;  2DC8 A;  2AYO A;  1THE A;  2XU3 A;  1AYW A;  2P86 A;  6PAD A;  1YAL A;  1BQI A;  2DCB A;  1NPZ A;  2IPP B;  1CVZ A;  3O0U A;  3DF0 A;  5K16 A;  1AIM A;  2Y6E A;  1STF E;  1ZIV A;  2FRQ A;  1EWL A;  2VHS A;  1ATK A;  2ACT A;  4AXL A;  9PAP A;  1YT7 A;  2FUD A;  3N3K A;  3OVX A;  4YYQ A;  3KX1 A;  4QRG A;  1AYU A;  4BSQ A;  3V6C A;  3BC3 A;  4DMY A;  2G8E A;  2AYN A;  2CB5 A;  3RVW A;  7PCK A;  1NB5 A;  3M99 A;  1DF0 A;  1CSB B;  3C9E A;  2DJG B;  1VSN A;  3PBH A;  2E01 A;  1TLO A;  2OZ2 A;  3B79 A;  3N4C A;  5EF4 A;  2ATO A;  1KHP A;  4PI3 A;  4N4Z A;  1XKG A;  1DEU A;  3H6S A;  4BS6 A;  1ITO A;  1TU6 A;  1AU3 A;  1KXR A;  1SP4 B;  2HH5 A;  2DC6 A;  3K24 A;  3OF8 A;  4YVA A;  2G8J A;  1QOL A;  2JQF R;  4KLB A;  1NLJ A;  1CS8 A;  4MZS A;  1CQD A;  4X6H A;  1F2B A;  1GLO A;  3K8U A;  2R9M A;  3IV2 A;  2YJB A;  5EGW A;  3ERV A;  1HUC B;  3I06 A;  4CDE B;  5JA7 A;  1AEC A;  2HXZ A;  3OVZ A;  2NQG A;  3P5U A;  4I04 A;  3F5V A;  1QDQ A;  2AVW A;  1AYV A;  4YV8 A;  2WBF X;  4WA6 A;  2FRA A;  2FO5 A;  3S3Q A;  3BPM A;  3MTN A;  1MIR A;  3WXE A;  1KFX L;  1M6D A;  2F7D A;  3ZUA A;  3PW3 A;  1ZCM A;  2DCD A;  3CBJ A;  4QRX A;  2Y5B A;  3BCN A;  3IMA A;  1TL9 A;  3RVX A;  1U5I A;  2XU1 A;  2HHN A;  3KFQ A;  3P5W A;  2DZZ A;  5A24 A;  4MZO A;  4QH6 A;  2B1M A;  3OF9 A;  3H8B A;  4RY2 A;  4XUI A;  1U9X A;  4N79 A;  3S3R A;  4FJC A;  4FK5 A;  4CDF B;  4K7C A;  2FQ9 A;  2DJF B;  4X6I A;  1NB3 A;  1QMY A;  2JQG R;  4CZW A;  2F1G A;  1A6R A;  3H8C A;  2E00 A;  5CVO B;  3H7D A;  3KW9 A;  1CJL A;  3CBK A;  2YJ9 A;  3IOQ A;  3BWK A;  2AU1 A;  4YYU A;  2FYE A;  2G7Y A;  4ZUX U;  1POP A;  2OUL A;  1Q6K A;  5PAD A;  2HD5 A;  5CHV A;  1YVB A;  4OEM A; 
#chains in the Genus database with same CATH topology
 2YJ8 A;  3U8E A;  1EWO A;  4P6G A;  4W4U A;  3WXG A;  3MHH A;  2J7Q C;  2Z84 A;  2IBI A;  4QBB A;  2R9O A;  3IUT A;  3MOR A;  3K9M A;  4X6J A;  2DZY A;  3CH2 X;  1YK8 A;  3W31 A;  4BQV A;  4P16 A;  5CVM A;  4YYV A;  3BBA A;  2E02 A;  2DOS A;  3HD3 A;  2DC7 A;  1AU2 A;  4W5C A;  2AIM A;  3O65 A;  2P7U A;  2DCC A;  5CVN B;  1PPO A;  2YJ2 A;  1PXV A;  3QSD A;  3CH3 X;  1MEM A;  2BDZ A;  3KSE A;  1U9V A;  4GUA A;  3WXF A;  4HXD B;  4CDD B;  1BY8 A;  4N8W A;  1KFU L;  3IHP A;  4BOU A;  2AUX A;  3O1G A;  2ARY A;  1YZB A;  5JH3 A;  4BOQ A;  1Y08 A;  4Q8G A;  1NL6 A;  3P5X A;  4RNA A;  2R9F A;  1F2A A;  4OEL A;  1U9W A;  2CIO A;  1EWM A;  2NQD B;  2NQI A;  3LXS A;  3PHX A;  1PPD A;  2AS8 A;  2UZJ A;  2YJC A;  2R9C A;  4BS5 A;  3QT4 A;  3TMP A;  1BGO A;  3P5V A;  4PP2 E;  1F2C A;  3RVV A;  1SNK A;  2P0R A;  4I07 A;  3PHW A;  4W5B A;  4I05 A;  4XR7 A;  2C0Y A;  4HWY A;  3I3T A;  4PP1 A;  4WUR A;  4OVZ B;  3OIS A;  2XU4 A;  5J94 A;  3BY4 A;  1PAD A;  8PCH A;  2GHU A;  2FT2 A;  1PPN A;  4QRV A;  3PRP A;  1PCI A;  2DCA A;  3IEJ A;  1VJV A;  1ME4 A;  3C0R A;  3N3G A;  3PDF A;  1CV8 A;  3MJ5 A;  3D6S A;  2PRE A;  1CB5 A;  1ME3 A;  2JTC A;  1U9Q X;  2XU5 A;  3BPF A;  4PAD A;  1MS6 A;  1QXP A;  2AUZ A;  4ZTB A;  1Y4H A;  1IWD A;  4CDC B;  1CTE A;  4Q8H A;  1EF7 A;  3HWN A;  4M0W A;  1GCB A;  1MEG A;  2BU3 A;  4BPV A;  1AU4 A;  2J7Q A;  1CPJ A;  4G54 A;  3F75 A;  2OP3 A;  4YYR A;  1PPP A;  4AXM A;  1S4V A;  2PBH A;  1X9Y A;  2O6X A;  1GEC E;  3TNX A;  5F02 A;  3KWZ A;  3USV A;  2H7J A;  3PHU A;  3NHE A;  2GFO A;  1MDW A;  1ICF A;  4FIP A;  1PE6 A;  1YK7 A;  1KHQ A;  3LFY A;  3RNV A;  2R6N A;  1AU0 A;  5CHT A;  3V6E A;  5FPW A;  1PVJ A;  1BP4 A;  2NQA A;  2G6D A;  3HHA A;  3KKU A;  1FH0 A;  1GMY A;  3E1Z B;  2E03 A;  3MP2 A;  2FE8 A;  2FTD A;  3AI8 A;  4RF1 A;  3GCB A;  4P6E A;  4BOZ A;  3QJ3 A;  1NQC A;  2B1N A;  3MHS A;  4YYW A;  1K3B B;  2PNS A;  3B21 A;  2R9N A;  2VHF A;  3KWB X;  1EWP A;  2PAD A;  3H89 A;  3HHI A;  2DC9 A;  3PNR A;  4DMX A;  1PIP A;  1JQP A;  4MSX A;  4YYS A;  3BOW A;  1O0E A;  4XZX A;  2BDL A;  1PBH A;  1F29 A;  1MHW A;  2DC8 A;  4IUM A;  2AYO A;  4R3D A;  1THE A;  2BTW B;  2XU3 A;  1AYW A;  2P86 A;  6PAD A;  1YAL A;  1BQI A;  2DCB A;  1NPZ A;  2IPP B;  1CVZ A;  3O0U A;  3DF0 A;  5K16 A;  1AIM A;  2Y6E A;  1STF E;  1ZIV A;  2FRQ A;  1EWL A;  2VHS A;  3PRM A;  1ATK A;  2ACT A;  4AXL A;  9PAP A;  1YT7 A;  2FUD A;  4RKX A;  3N3K A;  3OVX A;  4YYQ A;  3KX1 A;  4QRG A;  1AYU A;  4BSQ A;  3V6C A;  4REZ A;  3BC3 A;  4DMY A;  2G8E A;  2AYN A;  2CB5 A;  4D8I A;  3RVW A;  2AGA A;  7PCK A;  1NB5 A;  3ZNH A;  3M99 A;  1DF0 A;  1CSB B;  3C9E A;  2DJG B;  1VSN A;  3PBH A;  2E01 A;  3PSE A;  1TLO A;  2OZ2 A;  3B79 A;  3N4C A;  5EF4 A;  2ATO A;  1KHP A;  3E9S A;  4OVZ A;  4PI3 A;  4N4Z A;  1XKG A;  1DEU A;  3H6S A;  4BS6 A;  1ITO A;  1TU6 A;  1AU3 A;  1KXR A;  1SP4 B;  3TRK A;  2HH5 A;  2DC6 A;  3K24 A;  3OF8 A;  4MM3 B;  4YVA A;  2G8J A;  1QOL A;  2JQF R;  4KLB A;  3IFU A;  1NLJ A;  5KO3 A;  1CS8 A;  3BB7 A;  4MZS A;  1CQD A;  4X6H A;  1F2B A;  3PT2 A;  1GLO A;  4RF0 A;  3K8U A;  2R9M A;  3IV2 A;  2JRI A;  2YJB A;  5EGW A;  3ERV A;  1HUC B;  3I06 A;  4CDE B;  5JA7 A;  1AEC A;  2HXZ A;  3OVZ A;  2NQG A;  3P5U A;  4I04 A;  3F5V A;  1DKI A;  1QDQ A;  2AVW A;  1AYV A;  4YV8 A;  2WBF X;  4WA6 A;  2FRA A;  2FO5 A;  3S3Q A;  3BPM A;  3MTN A;  1MIR A;  4D8E A;  3WXE A;  1KFX L;  4MI7 A;  1M6D A;  2F7D A;  3ZUA A;  3PW3 A;  1ZCM A;  2DCD A;  3CBJ A;  4QRX A;  2Y5B A;  3BCN A;  3IMA A;  1UKF A;  1TL9 A;  4BOP A;  3RVX A;  1U5I A;  2XU1 A;  2HHN A;  2HWK A;  3KFQ A;  5E6J A;  3P5W A;  2DZZ A;  5A24 A;  4IP3 A;  4MZO A;  3MTV A;  4QH6 A;  2B1M A;  3OF9 A;  3H8B A;  4RY2 A;  4A5U A;  4XUI A;  1U9X A;  5EZQ A;  4N79 A;  3S3R A;  4FJC A;  4FK5 A;  4CDF B;  3OQC A;  4K7C A;  2FQ9 A;  2DJF B;  4X6I A;  2BTW A;  1NB3 A;  1QMY A;  5EZS A;  2JQG R;  4CZW A;  2F1G A;  1A6R A;  3W30 A;  3H8C A;  2E00 A;  5CVO B;  4D8B A;  3H7D A;  3KW9 A;  5JZE A;  1CJL A;  3CBK A;  2YJ9 A;  3IOQ A;  3BWK A;  4PT5 A;  2AU1 A;  4YYU A;  4OW0 A;  2FYE A;  2G7Y A;  1POP A;  2OUL A;  1Q6K A;  5PAD A;  4ZUX U;  4BOS A;  2HD5 A;  5CHV A;  1YVB A;  4OEM A; 
#chains in the Genus database with same CATH homology
 2YJ8 A;  3U8E A;  1EWO A;  4P6G A;  4W4U A;  3WXG A;  3MHH A;  2IBI A;  4QBB A;  2R9O A;  3IUT A;  3MOR A;  3K9M A;  4X6J A;  2DZY A;  3CH2 X;  1YK8 A;  4BQV A;  5CVM A;  4YYV A;  2E02 A;  3HD3 A;  2DC7 A;  1AU2 A;  2VFB A;  4W5C A;  2AIM A;  2P7U A;  2DCC A;  5CVN B;  1PPO A;  2YJ2 A;  1PXV A;  3QSD A;  3CH3 X;  1MEM A;  2BDZ A;  3KSE A;  1U9V A;  3WXF A;  4CDD B;  1BY8 A;  4N8W A;  1KFU L;  3IHP A;  2AUX A;  3O1G A;  2ARY A;  5JH3 A;  1Y08 A;  4Q8G A;  1NL6 A;  3P5X A;  2R9F A;  1F2A A;  4OEL A;  1U9W A;  2CIO A;  1EWM A;  2NQD B;  2NQI A;  3LXS A;  1PPD A;  2AS8 A;  2YJC A;  2R9C A;  4BS5 A;  3QT4 A;  1BGO A;  3P5V A;  4PP2 E;  1F2C A;  3RVV A;  1SNK A;  2P0R A;  4I07 A;  4W5B A;  4I05 A;  4XR7 A;  1W4T A;  2C0Y A;  4HWY A;  3I3T A;  4PP1 A;  3OIS A;  2XU4 A;  5J94 A;  1PAD A;  8PCH A;  2GHU A;  2FT2 A;  1PPN A;  4QRV A;  1PCI A;  2DCA A;  3IEJ A;  1VJV A;  1ME4 A;  3N3G A;  3PDF A;  1CV8 A;  3D6S A;  2PRE A;  4GUZ A;  1CB5 A;  1ME3 A;  1U9Q X;  2XU5 A;  3BPF A;  4PAD A;  1MS6 A;  1QXP A;  2AUZ A;  1Y4H A;  1IWD A;  4CDC B;  1CTE A;  4Q8H A;  1EF7 A;  3HWN A;  1GCB A;  3LTW A;  1MEG A;  4BPV A;  1AU4 A;  1CPJ A;  4G54 A;  3F75 A;  2OP3 A;  4YYR A;  1PPP A;  4AXM A;  1S4V A;  2PBH A;  1W5R A;  1X9Y A;  2O6X A;  1GEC E;  3TNX A;  5F02 A;  3KWZ A;  3USV A;  2H7J A;  3NHE A;  2GFO A;  1MDW A;  1ICF A;  4FIP A;  1PE6 A;  1YK7 A;  1KHQ A;  3LFY A;  2R6N A;  1AU0 A;  5CHT A;  3V6E A;  4B55 A;  5FPW A;  1BP4 A;  2NQA A;  2G6D A;  3HHA A;  3KKU A;  1FH0 A;  1GMY A;  3E1Z B;  2E03 A;  2FTD A;  3AI8 A;  3GCB A;  4P6E A;  4C5P A;  3QJ3 A;  1NQC A;  2B1N A;  3MHS A;  4YYW A;  1K3B B;  2PNS A;  2R9N A;  2VHF A;  3KWB X;  1EWP A;  2PAD A;  3H89 A;  3HHI A;  2DC9 A;  3PNR A;  4DMX A;  1PIP A;  1JQP A;  4MSX A;  4YYS A;  3BOW A;  1O0E A;  2BDL A;  1PBH A;  1F29 A;  1MHW A;  2DC8 A;  2AYO A;  1THE A;  2XU3 A;  1AYW A;  2P86 A;  6PAD A;  1YAL A;  1BQI A;  1GX3 A;  2DCB A;  1NPZ A;  2IPP B;  1CVZ A;  3O0U A;  3DF0 A;  5K16 A;  1AIM A;  2Y6E A;  1STF E;  1ZIV A;  2FRQ A;  1EWL A;  2VHS A;  1ATK A;  2ACT A;  4AXL A;  3D9W A;  9PAP A;  1YT7 A;  2VFC A;  2FUD A;  3N3K A;  3OVX A;  4YYQ A;  3KX1 A;  4QRG A;  1AYU A;  4BSQ A;  3V6C A;  3BC3 A;  4DMY A;  2G8E A;  2AYN A;  2CB5 A;  3RVW A;  7PCK A;  1NB5 A;  3M99 A;  1DF0 A;  1CSB B;  3C9E A;  2DJG B;  1VSN A;  3PBH A;  2E01 A;  1TLO A;  2OZ2 A;  3B79 A;  3N4C A;  5EF4 A;  2ATO A;  1KHP A;  4PI3 A;  4N4Z A;  1XKG A;  1DEU A;  3H6S A;  4BS6 A;  1ITO A;  1TU6 A;  1AU3 A;  1KXR A;  1SP4 B;  2HH5 A;  2DC6 A;  3K24 A;  3OF8 A;  4YVA A;  2G8J A;  1QOL A;  2JQF R;  4KLB A;  1NLJ A;  1CS8 A;  4MZS A;  1CQD A;  4X6H A;  1F2B A;  1GLO A;  3K8U A;  2R9M A;  3IV2 A;  1E2T A;  2YJB A;  5EGW A;  3ERV A;  1HUC B;  3I06 A;  4NV8 A;  4CDE B;  5JA7 A;  1AEC A;  2HXZ A;  3OVZ A;  2NQG A;  3P5U A;  4I04 A;  3F5V A;  1QDQ A;  2AVW A;  1AYV A;  4YV8 A;  2WBF X;  4WA6 A;  2FRA A;  2FO5 A;  3S3Q A;  3BPM A;  3MTN A;  1MIR A;  3WXE A;  1KFX L;  1M6D A;  2F7D A;  3ZUA A;  3PW3 A;  1ZCM A;  2DCD A;  3CBJ A;  4QRX A;  2Y5B A;  3BCN A;  3IMA A;  1TL9 A;  3RVX A;  1U5I A;  2XU1 A;  2HHN A;  3KFQ A;  3P5W A;  2DZZ A;  5A24 A;  4MZO A;  4QH6 A;  2B1M A;  3OF9 A;  3H8B A;  4RY2 A;  4XUI A;  1U9X A;  4N79 A;  3S3R A;  4FJC A;  4FK5 A;  4CDF B;  4NV7 A;  4K7C A;  2FQ9 A;  2DJF B;  4X6I A;  1NB3 A;  1QMY A;  2JQG R;  4CZW A;  2F1G A;  1A6R A;  3H8C A;  2E00 A;  5CVO B;  3H7D A;  3KW9 A;  1CJL A;  3CBK A;  2YJ9 A;  3IOQ A;  3BWK A;  1W6F A;  2AU1 A;  4YYU A;  2FYE A;  2G7Y A;  4ZUX U;  1POP A;  2OUL A;  1Q6K A;  5PAD A;  4BGF A;  2BSZ A;  2HD5 A;  5CHV A;  1YVB A;  4OEM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...