1F2BA

Crystal structure analysis of cruzain bound to vinyl sulfone derived inhibitor (iii)
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
215
structure length
215
Chain Sequence
APAAVDWRARGAVTAVKDQGQCGSCWAFSAIGNVECQWFLAGHPLTNLSEQMLVSCDKTDSGCSGGLMNNAFEWIVQENNGAVYTEDSYPYASGEGISPPCTTSGHTVGATITGHVELPQDEAQIAAWLAVNGPVAVAVDASSWMTYTGGVMTSCVSEQLDHGVLLVGYNDSAAVPYWIIKNSWTTQWGEEGYIRIAKGSNQCLVKEEASSAVVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CRUZAIN
publication title A target within the target: probing cruzain's P1' site to define structural determinants for the Chagas' disease protease.
pubmed doi rcsb
source organism Trypanosoma cruzi
molecule tags Hydrolase
total genus 66
structure length 215
sequence length 215
ec nomenclature ec 3.4.22.51: Cruzipain.
pdb deposition date 2000-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1f2bA00
6PADA 5EF4A 1U9VA 4YYWA 4PP2E 1AECA 2E00A 4YYVA 2DJFB 2O6XA 1TLOA 5CHTA 4I05A 2P0RA 1CS8A 1DEUA 2AU1A 3IV2A 3MTNA 1YALA 3QT4A 4QBBA 3N3KA 2XU3A 4BPVA 1DF0A 2C0YA 5PADA 1QXPA 1PPNA 3BCNA 2HXZA 1HUCB 1TL9A 2AS8A 1PXVA 4CDDB 1U9XA 2HHNA 3I06A 3WXFA 3RVXA 2HD5A 1AU0A 1PCIA 1CB5A 4CDCB 3I3TA 1GECE 3BPMA 1CPJA 4Q8HA 4XR7A 2H7JA 3QJ3A 3IHPA 3K8UA 4I07A 4OEMA 5K16A 2DC6A 3P5WA 2PBHA 4PP1A 1EWPA 4AXMA 2YJ8A 3USVA 1A6RA 3H89A 1POPA 2YJBA 3IUTA 3HHIA 1MIRA 2YJ2A 2DC9A 3BC3A 1CTEA 3H7DA 4CZWA 2R9NA 2JQFR 1AYWA 4XUIA 4X6IA 3TNXA 2BDLA 1CVZA 2B1NA 5JA7A 3BWKA 2NQIA 7PCKA 2DC8A 3PDFA 3IEJA 1ME3A 2DCCA 3WXEA 1ZIVA 3N4CA 3F75A 2PADA 1BQIA 2R6NA 1U9QX 2FYEA 3D6SA 1FH0A 4G54A 2NQGA 4ZUXU 3NHEA 2Y5BA 1IWDA 1PPPA 3CH2X 1STFE 2YJCA 1MHWA 3K24A 4K7CA 1KHPA 2NQAA 4QRXA 4P6EA 2XU4A 3E1ZB 2DCBA 1EWOA 3CBKA 1NPZA 5CVNB 5EGWA 1KFXL 3HHAA 1CQDA 3KX1A 1CSBB 3HD3A 4QH6A 3P5VA 3P5XA 1MDWA 3M99A 3MORA 1YK7A 4P6GA 1S4VA 1ITOA 2XU1A 3S3QA 1SNKA 2JQGR 1QOLA 3DF0A 2G8JA 3CBJA 3KKUA 2GFOA 2VHSA 2OP3A 3QSDA 1ME4A 3KSEA 1PBHA 4AXLA 2E03A 4N79A 4W4UA 2DCAA 2GHUA 1KXRA 3ZUAA 1MS6A 3MHHA 1U5IA 3PNRA 1VSNA 1U9WA 5JH3A 1BGOA 1NL6A 2G7YA 1M6DA 1PE6A 4WA6A 1MEMA 2R9MA 2PREA 2AVWA 4W5CA 4PADA 1AU4A 3K9MA 2F7DA 2CIOA 1O0EA 1ZCMA 4KLBA 2P86A 8PCHA 1ICFA 2G6DA 1GMYA 3U8EA 4YYRA 4X6HA 2IBIA 3RVWA 2ARYA 1AU2A 1KFUL 3KFQA 3ERVA 2P7UA 3AI8A 3OVXA 4FK5A 4YVAA 2YJ9A 1VJVA 1AU3A 1EWMA 4BS6A 2VHFA 4DMXA 4CDEB 2B1MA 4RY2A 4HWYA 2FO5A 2E01A 1Q6KA 1SP4B 2DC7A 2PNSA 4MZSA 2HH5A 4X6JA 4YYQA 2FT2A 3F5VA 2Y6EA 1YVBA 4N4ZA 1YK8A 1F2AA 4YYUA 1CV8A 2ATOA 4BS5A 4BSQA 3WXGA 4DMYA 1F2BA 4MZOA 4CDFB 2OULA 1PIPA 4Q8GA 3RVVA 2E02A 2IPPB 3B79A 3PW3A 1GLOA 1AIMA 5CVMA 3IMAA 1YT7A 4FJCA 3OF8A 2DCDA 3CH3X 1CJLA 3H6SA 3OISA 2CB5A 1THEA 1BP4A 4MSXA 3V6CA 1K3BB 4FIPA 3V6EA 2FQ9A 1NQCA 2DZZA 2AYOA 2FTDA 3OVZA 2AUXA 4QRVA 1F29A 2F1GA 1TU6A 3KWBX 2R9FA 3KW9A 5J94A 3P5UA 2XU5A 2DZYA 1NLJA 3HWNA 2ACTA 1KHQA 2G8EA 3GCBA 1AYUA 1JQPA 2FRAA 2FRQA 3S3RA 2AYNA 9PAPA 1NB3A 3KWZA 4YYSA 3O0UA 1QDQA 3H8CA 1F2CA 5FPWA 4PI3A 1PADA 1NB5A 3N3GA 2R9CA 3C9EA 2AIMA 1EF7A 1X9YA 1BY8A 4W5BA 2R9OA 1ATKA 1XKGA 1QMYA 2DJGB 2OZ2A 3IOQA 2AUZA 2NQDB 1EWLA 3PBHA 3LFYA 1Y08A 4QRGA 4I04A 2WBFX 4BQVA 4OELA 1PPDA 5CHVA 3BOWA 5A24A 2BDZA 1GCBA 1AYVA 3LXSA 4YV8A 1Y4HA 3O1GA 1PPOA 2FUDA 3H8BA 1MEGA 5F02A 3OF9A 3BPFA 3MHSA 5CVOB 4N8WA
chains in the Genus database with same CATH superfamily
2J7QC 6PADA 5EF4A 1U9VA 4YYWA 4PP2E 1AECA 2E00A 4YYVA 2DJFB 2O6XA 1TLOA 2FE8A 5CHTA 4OVZA 4I05A 2P0RA 4PT5A 1CS8A 1DEUA 2AU1A 2BTWB 3IV2A 3MTNA 5KO3A 3BB7A 3W30A 1YALA 3QT4A 3PRMA 2Z84A 4QBBA 3E9SA 3N3KA 2XU3A 4BPVA 1DF0A 2C0YA 5PADA 1QXPA 3PSEA 1PPNA 3BCNA 2HXZA 1HUCB 1TL9A 2AS8A 1PXVA 4CDDB 1U9XA 2HHNA 3I06A 3WXFA 3RVXA 2HD5A 1AU0A 1PCIA 1CB5A 4CDCB 3I3TA 1GECE 3BPMA 1CPJA 4Q8HA 4XR7A 2H7JA 2BU3A 3QJ3A 3IHPA 3OQCA 3K8UA 4I07A 4OEMA 5K16A 2DC6A 3P5WA 2PBHA 4OVZB 4PP1A 1EWPA 4XZXA 4AXMA 2YJ8A 3USVA 1A6RA 2AGAA 4BOUA 3H89A 1POPA 4BOZA 2YJBA 3IUTA 3HHIA 1MIRA 2YJ2A 2DC9A 3BC3A 1CTEA 3H7DA 4GUAA 4CZWA 2R9NA 3MJ5A 2JQFR 1AYWA 4XUIA 4X6IA 3TNXA 2BDLA 1CVZA 2B1NA 5JA7A 3BWKA 2NQIA 7PCKA 2DC8A 3PDFA 3IEJA 1ME3A 2DCCA 3WXEA 1ZIVA 3N4CA 3F75A 2PADA 1BQIA 2R6NA 1U9QX 2FYEA 3D6SA 1FH0A 4G54A 2NQGA 4ZUXU 3NHEA 2Y5BA 1IWDA 1PPPA 4BOSA 4A5UA 2UZJA 3CH2X 1STFE 2YJCA 1MHWA 3K24A 4K7CA 1KHPA 2NQAA 4QRXA 4P6EA 2XU4A 3E1ZB 2DCBA 1EWOA 3CBKA 1NPZA 5CVNB 5EGWA 1KFXL 3HHAA 1CQDA 3KX1A 1CSBB 3HD3A 4QH6A 3P5VA 2HWKA 3P5XA 1MDWA 1UKFA 4IUMA 3M99A 3MORA 1YK7A 4P6GA 1S4VA 1ITOA 2XU1A 3S3QA 2JTCA 1SNKA 2JQGR 1QOLA 3DF0A 2G8JA 3CBJA 3KKUA 2GFOA 2VHSA 2OP3A 3QSDA 1ME4A 3PT2A 3KSEA 1PBHA 4AXLA 2E03A 4N79A 4W4UA 2DCAA 4WURA 3MP2A 2GHUA 1KXRA 3ZUAA 4BOPA 1MS6A 3MHHA 1U5IA 3RNVA 3PNRA 3PRPA 1VSNA 1U9WA 3IFUA 3W31A 5JH3A 1PVJA 1BGOA 1NL6A 4OW0A 2G7YA 1M6DA 1PE6A 4RF1A 4WA6A 1MEMA 2R9MA 3O65A 2PREA 2AVWA 4W5CA 4PADA 5JZEA 1AU4A 3PHXA 3K9MA 2JRIA 2F7DA 2CIOA 1O0EA 1ZCMA 4KLBA 2P86A 2DOSA 8PCHA 1ICFA 3TRKA 2G6DA 4P16A 1GMYA 3U8EA 4YYRA 4X6HA 2IBIA 3RVWA 2ARYA 1AU2A 1KFUL 3KFQA 3ERVA 2P7UA 3AI8A 3OVXA 4FK5A 4YVAA 2YJ9A 1VJVA 1AU3A 1EWMA 5EZSA 4BS6A 4MI7A 4RNAA 2VHFA 4DMXA 4CDEB 2B1MA 4RY2A 4BOQA 4HWYA 2FO5A 4ZTBA 2E01A 1Q6KA 1SP4B 2DC7A 2PNSA 4MZSA 2HH5A 4X6JA 4YYQA 4D8EA 2FT2A 3F5VA 2Y6EA 1YVBA 4N4ZA 1YK8A 1F2AA 4D8IA 4YYUA 1CV8A 2ATOA 4BS5A 4BSQA 3WXGA 1YZBA 4DMYA 1F2BA 4REZA 4MZOA 4CDFB 2OULA 1PIPA 4Q8GA 3RVVA 2E02A 2IPPB 1DKIA 3C0RA 3B79A 3PW3A 3ZNHA 4HXDB 1GLOA 1AIMA 3BBAA 5CVMA 4M0WA 3IMAA 1YT7A 4FJCA 3OF8A 4IP3A 2DCDA 3CH3X 1CJLA 3H6SA 3OISA 2CB5A 1THEA 1BP4A 4MSXA 3V6CA 1K3BB 4FIPA 4MM3B 3V6EA 2FQ9A 1NQCA 2DZZA 2AYOA 2FTDA 3OVZA 2AUXA 4QRVA 1F29A 2F1GA 1TU6A 3KWBX 2R9FA 3KW9A 4RKXA 5J94A 3P5UA 2XU5A 2DZYA 1NLJA 3HWNA 2ACTA 5EZQA 3TMPA 1KHQA 2G8EA 3GCBA 3PHWA 4R3DA 1AYUA 1JQPA 2FRAA 2FRQA 3S3RA 2AYNA 9PAPA 1NB3A 3KWZA 4YYSA 3O0UA 1QDQA 3H8CA 1F2CA 5FPWA 4PI3A 3MTVA 1PADA 1NB5A 3N3GA 2R9CA 3B21A 3C9EA 5E6JA 2AIMA 1EF7A 1X9YA 2BTWA 1BY8A 4W5BA 2R9OA 1ATKA 1XKGA 1QMYA 2DJGB 2OZ2A 3IOQA 2AUZA 2NQDB 1EWLA 3PBHA 3LFYA 1Y08A 4QRGA 4I04A 2WBFX 4D8BA 4BQVA 4OELA 1PPDA 3BY4A 5CHVA 2J7QA 3BOWA 5A24A 2BDZA 1GCBA 1AYVA 3LXSA 4YV8A 1Y4HA 3O1GA 1PPOA 2FUDA 3H8BA 1MEGA 5F02A 3OF9A 3BPFA 3MHSA 5CVOB 4N8WA 3PHUA 4RF0A
chains in the Genus database with same CATH topology
6PADA 5EF4A 1U9VA 4YYWA 4PP2E 1AECA 2E00A 4YYVA 2DJFB 2O6XA 1TLOA 5CHTA 4I05A 2P0RA 1W4TA 1CS8A 1DEUA 2AU1A 2BSZA 3IV2A 3MTNA 1YALA 3QT4A 4QBBA 3N3KA 2XU3A 4BPVA 1DF0A 2C0YA 5PADA 1QXPA 1PPNA 3BCNA 2HXZA 1HUCB 1TL9A 2AS8A 1PXVA 4CDDB 1U9XA 2HHNA 3I06A 3WXFA 3RVXA 2HD5A 1AU0A 1PCIA 1CB5A 4CDCB 3I3TA 1GECE 3BPMA 1CPJA 4Q8HA 4XR7A 2H7JA 3QJ3A 3IHPA 3K8UA 4I07A 4OEMA 5K16A 2DC6A 3P5WA 2PBHA 4PP1A 1EWPA 4AXMA 2YJ8A 3USVA 1A6RA 3H89A 1POPA 2YJBA 3IUTA 3HHIA 1MIRA 2YJ2A 2DC9A 3BC3A 1CTEA 3H7DA 4CZWA 2R9NA 2JQFR 1AYWA 4XUIA 4X6IA 3TNXA 2BDLA 1CVZA 2B1NA 5JA7A 3BWKA 2NQIA 7PCKA 2DC8A 3PDFA 3IEJA 1ME3A 4B55A 1W5RA 2DCCA 3WXEA 1ZIVA 3N4CA 3F75A 1E2TA 2PADA 1BQIA 2R6NA 1U9QX 2FYEA 3D6SA 1FH0A 4G54A 2NQGA 4ZUXU 3NHEA 2Y5BA 1IWDA 1PPPA 3CH2X 1STFE 2YJCA 1MHWA 3K24A 4K7CA 1KHPA 2NQAA 4QRXA 4P6EA 2XU4A 3E1ZB 2DCBA 4NV8A 1EWOA 3CBKA 1NPZA 5CVNB 5EGWA 1KFXL 3HHAA 1CQDA 3KX1A 1CSBB 4NV7A 3HD3A 4QH6A 3P5VA 3P5XA 1MDWA 3M99A 3MORA 1YK7A 4P6GA 1S4VA 1ITOA 2XU1A 3S3QA 3D9WA 1SNKA 2JQGR 4BGFA 1QOLA 3DF0A 2G8JA 3CBJA 3KKUA 2GFOA 2VHSA 2OP3A 3QSDA 1ME4A 3LTWA 3KSEA 1PBHA 4AXLA 2E03A 4N79A 4W4UA 2DCAA 2GHUA 1KXRA 3ZUAA 1MS6A 3MHHA 1U5IA 3PNRA 1VSNA 1U9WA 5JH3A 1BGOA 1NL6A 2G7YA 1M6DA 1PE6A 1GX3A 4WA6A 1MEMA 2R9MA 2PREA 2AVWA 4W5CA 4PADA 1AU4A 3K9MA 2F7DA 2CIOA 1O0EA 1ZCMA 4KLBA 2P86A 8PCHA 1ICFA 2G6DA 1GMYA 3U8EA 4YYRA 4X6HA 2IBIA 3RVWA 2ARYA 1AU2A 1KFUL 3KFQA 3ERVA 2P7UA 4GUZA 1W6FA 3AI8A 3OVXA 4FK5A 4YVAA 2YJ9A 1VJVA 1AU3A 1EWMA 4BS6A 2VHFA 4DMXA 4CDEB 2B1MA 4RY2A 4HWYA 2FO5A 2E01A 1Q6KA 1SP4B 2DC7A 2PNSA 4MZSA 2HH5A 4X6JA 4YYQA 2FT2A 3F5VA 2Y6EA 1YVBA 4N4ZA 1YK8A 1F2AA 4YYUA 1CV8A 2ATOA 4BS5A 4BSQA 3WXGA 4DMYA 1F2BA 4MZOA 4CDFB 2OULA 1PIPA 4Q8GA 3RVVA 2E02A 2IPPB 3B79A 3PW3A 1GLOA 1AIMA 5CVMA 3IMAA 1YT7A 4FJCA 3OF8A 2DCDA 3CH3X 1CJLA 3H6SA 3OISA 2CB5A 1THEA 1BP4A 4MSXA 3V6CA 1K3BB 4FIPA 2VFBA 3V6EA 2FQ9A 1NQCA 4C5PA 2DZZA 2AYOA 2FTDA 3OVZA 2AUXA 4QRVA 1F29A 2F1GA 1TU6A 3KWBX 2R9FA 3KW9A 5J94A 3P5UA 2XU5A 2DZYA 1NLJA 3HWNA 2ACTA 1KHQA 2G8EA 3GCBA 2VFCA 1AYUA 1JQPA 2FRAA 2FRQA 3S3RA 2AYNA 9PAPA 1NB3A 3KWZA 4YYSA 3O0UA 1QDQA 3H8CA 1F2CA 5FPWA 4PI3A 1PADA 1NB5A 3N3GA 2R9CA 3C9EA 2AIMA 1EF7A 1X9YA 1BY8A 4W5BA 2R9OA 1ATKA 1XKGA 1QMYA 2DJGB 2OZ2A 3IOQA 2AUZA 2NQDB 1EWLA 3PBHA 3LFYA 1Y08A 4QRGA 4I04A 2WBFX 4BQVA 4OELA 1PPDA 5CHVA 3BOWA 5A24A 2BDZA 1GCBA 1AYVA 3LXSA 4YV8A 1Y4HA 3O1GA 1PPOA 2FUDA 3H8BA 1MEGA 5F02A 3OF9A 3BPFA 3MHSA 5CVOB 4N8WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 6PAD A;  5EF4 A;  1U9V A;  4YYW A;  4PP2 E;  1AEC A;  2E00 A;  4YYV A;  2DJF B;  2O6X A;  1TLO A;  5CHT A;  4I05 A;  2P0R A;  1CS8 A;  1DEU A;  2AU1 A;  3IV2 A;  3MTN A;  1YAL A;  3QT4 A;  4QBB A;  3N3K A;  2XU3 A;  4BPV A;  1DF0 A;  2C0Y A;  5PAD A;  1QXP A;  1PPN A;  3BCN A;  2HXZ A;  1HUC B;  1TL9 A;  2AS8 A;  1PXV A;  4CDD B;  1U9X A;  2HHN A;  3I06 A;  3WXF A;  3RVX A;  2HD5 A;  1AU0 A;  1PCI A;  1CB5 A;  4CDC B;  3I3T A;  1GEC E;  3BPM A;  1CPJ A;  4Q8H A;  4XR7 A;  2H7J A;  3QJ3 A;  3IHP A;  3K8U A;  4I07 A;  4OEM A;  5K16 A;  2DC6 A;  3P5W A;  2PBH A;  4PP1 A;  1EWP A;  4AXM A;  2YJ8 A;  3USV A;  1A6R A;  3H89 A;  1POP A;  2YJB A;  3IUT A;  3HHI A;  1MIR A;  2YJ2 A;  2DC9 A;  3BC3 A;  1CTE A;  3H7D A;  4CZW A;  2R9N A;  2JQF R;  1AYW A;  4XUI A;  4X6I A;  3TNX A;  2BDL A;  1CVZ A;  2B1N A;  5JA7 A;  3BWK A;  2NQI A;  7PCK A;  2DC8 A;  3PDF A;  3IEJ A;  1ME3 A;  2DCC A;  3WXE A;  1ZIV A;  3N4C A;  3F75 A;  2PAD A;  1BQI A;  2R6N A;  1U9Q X;  2FYE A;  3D6S A;  1FH0 A;  4G54 A;  2NQG A;  4ZUX U;  3NHE A;  2Y5B A;  1IWD A;  1PPP A;  3CH2 X;  1STF E;  2YJC A;  1MHW A;  3K24 A;  4K7C A;  1KHP A;  2NQA A;  4QRX A;  4P6E A;  2XU4 A;  3E1Z B;  2DCB A;  1EWO A;  3CBK A;  1NPZ A;  5CVN B;  5EGW A;  1KFX L;  3HHA A;  1CQD A;  3KX1 A;  1CSB B;  3HD3 A;  4QH6 A;  3P5V A;  3P5X A;  1MDW A;  3M99 A;  3MOR A;  1YK7 A;  4P6G A;  1S4V A;  1ITO A;  2XU1 A;  3S3Q A;  1SNK A;  2JQG R;  1QOL A;  3DF0 A;  2G8J A;  3CBJ A;  3KKU A;  2GFO A;  2VHS A;  2OP3 A;  3QSD A;  1ME4 A;  3KSE A;  1PBH A;  4AXL A;  2E03 A;  4N79 A;  4W4U A;  2DCA A;  2GHU A;  1KXR A;  3ZUA A;  1MS6 A;  3MHH A;  1U5I A;  3PNR A;  1VSN A;  1U9W A;  5JH3 A;  1BGO A;  1NL6 A;  2G7Y A;  1M6D A;  1PE6 A;  4WA6 A;  1MEM A;  2R9M A;  2PRE A;  2AVW A;  4W5C A;  4PAD A;  1AU4 A;  3K9M A;  2F7D A;  2CIO A;  1O0E A;  1ZCM A;  4KLB A;  2P86 A;  8PCH A;  1ICF A;  2G6D A;  1GMY A;  3U8E A;  4YYR A;  4X6H A;  2IBI A;  3RVW A;  2ARY A;  1AU2 A;  1KFU L;  3KFQ A;  3ERV A;  2P7U A;  3AI8 A;  3OVX A;  4FK5 A;  4YVA A;  2YJ9 A;  1VJV A;  1AU3 A;  1EWM A;  4BS6 A;  2VHF A;  4DMX A;  4CDE B;  2B1M A;  4RY2 A;  4HWY A;  2FO5 A;  2E01 A;  1Q6K A;  1SP4 B;  2DC7 A;  2PNS A;  4MZS A;  2HH5 A;  4X6J A;  4YYQ A;  2FT2 A;  3F5V A;  2Y6E A;  1YVB A;  4N4Z A;  1YK8 A;  1F2A A;  4YYU A;  1CV8 A;  2ATO A;  4BS5 A;  4BSQ A;  3WXG A;  4DMY A;  1F2B A;  4MZO A;  4CDF B;  2OUL A;  1PIP A;  4Q8G A;  3RVV A;  2E02 A;  2IPP B;  3B79 A;  3PW3 A;  1GLO A;  1AIM A;  5CVM A;  3IMA A;  1YT7 A;  4FJC A;  3OF8 A;  2DCD A;  3CH3 X;  1CJL A;  3H6S A;  3OIS A;  2CB5 A;  1THE A;  1BP4 A;  4MSX A;  3V6C A;  1K3B B;  4FIP A;  3V6E A;  2FQ9 A;  1NQC A;  2DZZ A;  2AYO A;  2FTD A;  3OVZ A;  2AUX A;  4QRV A;  1F29 A;  2F1G A;  1TU6 A;  3KWB X;  2R9F A;  3KW9 A;  5J94 A;  3P5U A;  2XU5 A;  2DZY A;  1NLJ A;  3HWN A;  2ACT A;  1KHQ A;  2G8E A;  3GCB A;  1AYU A;  1JQP A;  2FRA A;  2FRQ A;  3S3R A;  2AYN A;  9PAP A;  1NB3 A;  3KWZ A;  4YYS A;  3O0U A;  1QDQ A;  3H8C A;  1F2C A;  5FPW A;  4PI3 A;  1PAD A;  1NB5 A;  3N3G A;  2R9C A;  3C9E A;  2AIM A;  1EF7 A;  1X9Y A;  1BY8 A;  4W5B A;  2R9O A;  1ATK A;  1XKG A;  1QMY A;  2DJG B;  2OZ2 A;  3IOQ A;  2AUZ A;  2NQD B;  1EWL A;  3PBH A;  3LFY A;  1Y08 A;  4QRG A;  4I04 A;  2WBF X;  4BQV A;  4OEL A;  1PPD A;  5CHV A;  3BOW A;  5A24 A;  2BDZ A;  1GCB A;  1AYV A;  3LXS A;  4YV8 A;  1Y4H A;  3O1G A;  1PPO A;  2FUD A;  3H8B A;  1MEG A;  5F02 A;  3OF9 A;  3BPF A;  3MHS A;  5CVO B;  4N8W A; 
#chains in the Genus database with same CATH topology
 2J7Q C;  6PAD A;  5EF4 A;  1U9V A;  4YYW A;  4PP2 E;  1AEC A;  2E00 A;  4YYV A;  2DJF B;  2O6X A;  1TLO A;  2FE8 A;  5CHT A;  4OVZ A;  4I05 A;  2P0R A;  4PT5 A;  1CS8 A;  1DEU A;  2AU1 A;  2BTW B;  3IV2 A;  3MTN A;  5KO3 A;  3BB7 A;  3W30 A;  1YAL A;  3QT4 A;  3PRM A;  2Z84 A;  4QBB A;  3E9S A;  3N3K A;  2XU3 A;  4BPV A;  1DF0 A;  2C0Y A;  5PAD A;  1QXP A;  3PSE A;  1PPN A;  3BCN A;  2HXZ A;  1HUC B;  1TL9 A;  2AS8 A;  1PXV A;  4CDD B;  1U9X A;  2HHN A;  3I06 A;  3WXF A;  3RVX A;  2HD5 A;  1AU0 A;  1PCI A;  1CB5 A;  4CDC B;  3I3T A;  1GEC E;  3BPM A;  1CPJ A;  4Q8H A;  4XR7 A;  2H7J A;  2BU3 A;  3QJ3 A;  3IHP A;  3OQC A;  3K8U A;  4I07 A;  4OEM A;  5K16 A;  2DC6 A;  3P5W A;  2PBH A;  4OVZ B;  4PP1 A;  1EWP A;  4XZX A;  4AXM A;  2YJ8 A;  3USV A;  1A6R A;  2AGA A;  4BOU A;  3H89 A;  1POP A;  4BOZ A;  2YJB A;  3IUT A;  3HHI A;  1MIR A;  2YJ2 A;  2DC9 A;  3BC3 A;  1CTE A;  3H7D A;  4GUA A;  4CZW A;  2R9N A;  3MJ5 A;  2JQF R;  1AYW A;  4XUI A;  4X6I A;  3TNX A;  2BDL A;  1CVZ A;  2B1N A;  5JA7 A;  3BWK A;  2NQI A;  7PCK A;  2DC8 A;  3PDF A;  3IEJ A;  1ME3 A;  2DCC A;  3WXE A;  1ZIV A;  3N4C A;  3F75 A;  2PAD A;  1BQI A;  2R6N A;  1U9Q X;  2FYE A;  3D6S A;  1FH0 A;  4G54 A;  2NQG A;  4ZUX U;  3NHE A;  2Y5B A;  1IWD A;  1PPP A;  4BOS A;  4A5U A;  2UZJ A;  3CH2 X;  1STF E;  2YJC A;  1MHW A;  3K24 A;  4K7C A;  1KHP A;  2NQA A;  4QRX A;  4P6E A;  2XU4 A;  3E1Z B;  2DCB A;  1EWO A;  3CBK A;  1NPZ A;  5CVN B;  5EGW A;  1KFX L;  3HHA A;  1CQD A;  3KX1 A;  1CSB B;  3HD3 A;  4QH6 A;  3P5V A;  2HWK A;  3P5X A;  1MDW A;  1UKF A;  4IUM A;  3M99 A;  3MOR A;  1YK7 A;  4P6G A;  1S4V A;  1ITO A;  2XU1 A;  3S3Q A;  2JTC A;  1SNK A;  2JQG R;  1QOL A;  3DF0 A;  2G8J A;  3CBJ A;  3KKU A;  2GFO A;  2VHS A;  2OP3 A;  3QSD A;  1ME4 A;  3PT2 A;  3KSE A;  1PBH A;  4AXL A;  2E03 A;  4N79 A;  4W4U A;  2DCA A;  4WUR A;  3MP2 A;  2GHU A;  1KXR A;  3ZUA A;  4BOP A;  1MS6 A;  3MHH A;  1U5I A;  3RNV A;  3PNR A;  3PRP A;  1VSN A;  1U9W A;  3IFU A;  3W31 A;  5JH3 A;  1PVJ A;  1BGO A;  1NL6 A;  4OW0 A;  2G7Y A;  1M6D A;  1PE6 A;  4RF1 A;  4WA6 A;  1MEM A;  2R9M A;  3O65 A;  2PRE A;  2AVW A;  4W5C A;  4PAD A;  5JZE A;  1AU4 A;  3PHX A;  3K9M A;  2JRI A;  2F7D A;  2CIO A;  1O0E A;  1ZCM A;  4KLB A;  2P86 A;  2DOS A;  8PCH A;  1ICF A;  3TRK A;  2G6D A;  4P16 A;  1GMY A;  3U8E A;  4YYR A;  4X6H A;  2IBI A;  3RVW A;  2ARY A;  1AU2 A;  1KFU L;  3KFQ A;  3ERV A;  2P7U A;  3AI8 A;  3OVX A;  4FK5 A;  4YVA A;  2YJ9 A;  1VJV A;  1AU3 A;  1EWM A;  5EZS A;  4BS6 A;  4MI7 A;  4RNA A;  2VHF A;  4DMX A;  4CDE B;  2B1M A;  4RY2 A;  4BOQ A;  4HWY A;  2FO5 A;  4ZTB A;  2E01 A;  1Q6K A;  1SP4 B;  2DC7 A;  2PNS A;  4MZS A;  2HH5 A;  4X6J A;  4YYQ A;  4D8E A;  2FT2 A;  3F5V A;  2Y6E A;  1YVB A;  4N4Z A;  1YK8 A;  1F2A A;  4D8I A;  4YYU A;  1CV8 A;  2ATO A;  4BS5 A;  4BSQ A;  3WXG A;  1YZB A;  4DMY A;  1F2B A;  4REZ A;  4MZO A;  4CDF B;  2OUL A;  1PIP A;  4Q8G A;  3RVV A;  2E02 A;  2IPP B;  1DKI A;  3C0R A;  3B79 A;  3PW3 A;  3ZNH A;  4HXD B;  1GLO A;  1AIM A;  3BBA A;  5CVM A;  4M0W A;  3IMA A;  1YT7 A;  4FJC A;  3OF8 A;  4IP3 A;  2DCD A;  3CH3 X;  1CJL A;  3H6S A;  3OIS A;  2CB5 A;  1THE A;  1BP4 A;  4MSX A;  3V6C A;  1K3B B;  4FIP A;  4MM3 B;  3V6E A;  2FQ9 A;  1NQC A;  2DZZ A;  2AYO A;  2FTD A;  3OVZ A;  2AUX A;  4QRV A;  1F29 A;  2F1G A;  1TU6 A;  3KWB X;  2R9F A;  3KW9 A;  4RKX A;  5J94 A;  3P5U A;  2XU5 A;  2DZY A;  1NLJ A;  3HWN A;  2ACT A;  5EZQ A;  3TMP A;  1KHQ A;  2G8E A;  3GCB A;  3PHW A;  4R3D A;  1AYU A;  1JQP A;  2FRA A;  2FRQ A;  3S3R A;  2AYN A;  9PAP A;  1NB3 A;  3KWZ A;  4YYS A;  3O0U A;  1QDQ A;  3H8C A;  1F2C A;  5FPW A;  4PI3 A;  3MTV A;  1PAD A;  1NB5 A;  3N3G A;  2R9C A;  3B21 A;  3C9E A;  5E6J A;  2AIM A;  1EF7 A;  1X9Y A;  2BTW A;  1BY8 A;  4W5B A;  2R9O A;  1ATK A;  1XKG A;  1QMY A;  2DJG B;  2OZ2 A;  3IOQ A;  2AUZ A;  2NQD B;  1EWL A;  3PBH A;  3LFY A;  1Y08 A;  4QRG A;  4I04 A;  2WBF X;  4D8B A;  4BQV A;  4OEL A;  1PPD A;  3BY4 A;  5CHV A;  2J7Q A;  3BOW A;  5A24 A;  2BDZ A;  1GCB A;  1AYV A;  3LXS A;  4YV8 A;  1Y4H A;  3O1G A;  1PPO A;  2FUD A;  3H8B A;  1MEG A;  5F02 A;  3OF9 A;  3BPF A;  3MHS A;  5CVO B;  4N8W A;  3PHU A;  4RF0 A; 
#chains in the Genus database with same CATH homology
 6PAD A;  5EF4 A;  1U9V A;  4YYW A;  4PP2 E;  1AEC A;  2E00 A;  4YYV A;  2DJF B;  2O6X A;  1TLO A;  5CHT A;  4I05 A;  2P0R A;  1W4T A;  1CS8 A;  1DEU A;  2AU1 A;  2BSZ A;  3IV2 A;  3MTN A;  1YAL A;  3QT4 A;  4QBB A;  3N3K A;  2XU3 A;  4BPV A;  1DF0 A;  2C0Y A;  5PAD A;  1QXP A;  1PPN A;  3BCN A;  2HXZ A;  1HUC B;  1TL9 A;  2AS8 A;  1PXV A;  4CDD B;  1U9X A;  2HHN A;  3I06 A;  3WXF A;  3RVX A;  2HD5 A;  1AU0 A;  1PCI A;  1CB5 A;  4CDC B;  3I3T A;  1GEC E;  3BPM A;  1CPJ A;  4Q8H A;  4XR7 A;  2H7J A;  3QJ3 A;  3IHP A;  3K8U A;  4I07 A;  4OEM A;  5K16 A;  2DC6 A;  3P5W A;  2PBH A;  4PP1 A;  1EWP A;  4AXM A;  2YJ8 A;  3USV A;  1A6R A;  3H89 A;  1POP A;  2YJB A;  3IUT A;  3HHI A;  1MIR A;  2YJ2 A;  2DC9 A;  3BC3 A;  1CTE A;  3H7D A;  4CZW A;  2R9N A;  2JQF R;  1AYW A;  4XUI A;  4X6I A;  3TNX A;  2BDL A;  1CVZ A;  2B1N A;  5JA7 A;  3BWK A;  2NQI A;  7PCK A;  2DC8 A;  3PDF A;  3IEJ A;  1ME3 A;  4B55 A;  1W5R A;  2DCC A;  3WXE A;  1ZIV A;  3N4C A;  3F75 A;  1E2T A;  2PAD A;  1BQI A;  2R6N A;  1U9Q X;  2FYE A;  3D6S A;  1FH0 A;  4G54 A;  2NQG A;  4ZUX U;  3NHE A;  2Y5B A;  1IWD A;  1PPP A;  3CH2 X;  1STF E;  2YJC A;  1MHW A;  3K24 A;  4K7C A;  1KHP A;  2NQA A;  4QRX A;  4P6E A;  2XU4 A;  3E1Z B;  2DCB A;  4NV8 A;  1EWO A;  3CBK A;  1NPZ A;  5CVN B;  5EGW A;  1KFX L;  3HHA A;  1CQD A;  3KX1 A;  1CSB B;  4NV7 A;  3HD3 A;  4QH6 A;  3P5V A;  3P5X A;  1MDW A;  3M99 A;  3MOR A;  1YK7 A;  4P6G A;  1S4V A;  1ITO A;  2XU1 A;  3S3Q A;  3D9W A;  1SNK A;  2JQG R;  4BGF A;  1QOL A;  3DF0 A;  2G8J A;  3CBJ A;  3KKU A;  2GFO A;  2VHS A;  2OP3 A;  3QSD A;  1ME4 A;  3LTW A;  3KSE A;  1PBH A;  4AXL A;  2E03 A;  4N79 A;  4W4U A;  2DCA A;  2GHU A;  1KXR A;  3ZUA A;  1MS6 A;  3MHH A;  1U5I A;  3PNR A;  1VSN A;  1U9W A;  5JH3 A;  1BGO A;  1NL6 A;  2G7Y A;  1M6D A;  1PE6 A;  1GX3 A;  4WA6 A;  1MEM A;  2R9M A;  2PRE A;  2AVW A;  4W5C A;  4PAD A;  1AU4 A;  3K9M A;  2F7D A;  2CIO A;  1O0E A;  1ZCM A;  4KLB A;  2P86 A;  8PCH A;  1ICF A;  2G6D A;  1GMY A;  3U8E A;  4YYR A;  4X6H A;  2IBI A;  3RVW A;  2ARY A;  1AU2 A;  1KFU L;  3KFQ A;  3ERV A;  2P7U A;  4GUZ A;  1W6F A;  3AI8 A;  3OVX A;  4FK5 A;  4YVA A;  2YJ9 A;  1VJV A;  1AU3 A;  1EWM A;  4BS6 A;  2VHF A;  4DMX A;  4CDE B;  2B1M A;  4RY2 A;  4HWY A;  2FO5 A;  2E01 A;  1Q6K A;  1SP4 B;  2DC7 A;  2PNS A;  4MZS A;  2HH5 A;  4X6J A;  4YYQ A;  2FT2 A;  3F5V A;  2Y6E A;  1YVB A;  4N4Z A;  1YK8 A;  1F2A A;  4YYU A;  1CV8 A;  2ATO A;  4BS5 A;  4BSQ A;  3WXG A;  4DMY A;  1F2B A;  4MZO A;  4CDF B;  2OUL A;  1PIP A;  4Q8G A;  3RVV A;  2E02 A;  2IPP B;  3B79 A;  3PW3 A;  1GLO A;  1AIM A;  5CVM A;  3IMA A;  1YT7 A;  4FJC A;  3OF8 A;  2DCD A;  3CH3 X;  1CJL A;  3H6S A;  3OIS A;  2CB5 A;  1THE A;  1BP4 A;  4MSX A;  3V6C A;  1K3B B;  4FIP A;  2VFB A;  3V6E A;  2FQ9 A;  1NQC A;  4C5P A;  2DZZ A;  2AYO A;  2FTD A;  3OVZ A;  2AUX A;  4QRV A;  1F29 A;  2F1G A;  1TU6 A;  3KWB X;  2R9F A;  3KW9 A;  5J94 A;  3P5U A;  2XU5 A;  2DZY A;  1NLJ A;  3HWN A;  2ACT A;  1KHQ A;  2G8E A;  3GCB A;  2VFC A;  1AYU A;  1JQP A;  2FRA A;  2FRQ A;  3S3R A;  2AYN A;  9PAP A;  1NB3 A;  3KWZ A;  4YYS A;  3O0U A;  1QDQ A;  3H8C A;  1F2C A;  5FPW A;  4PI3 A;  1PAD A;  1NB5 A;  3N3G A;  2R9C A;  3C9E A;  2AIM A;  1EF7 A;  1X9Y A;  1BY8 A;  4W5B A;  2R9O A;  1ATK A;  1XKG A;  1QMY A;  2DJG B;  2OZ2 A;  3IOQ A;  2AUZ A;  2NQD B;  1EWL A;  3PBH A;  3LFY A;  1Y08 A;  4QRG A;  4I04 A;  2WBF X;  4BQV A;  4OEL A;  1PPD A;  5CHV A;  3BOW A;  5A24 A;  2BDZ A;  1GCB A;  1AYV A;  3LXS A;  4YV8 A;  1Y4H A;  3O1G A;  1PPO A;  2FUD A;  3H8B A;  1MEG A;  5F02 A;  3OF9 A;  3BPF A;  3MHS A;  5CVO B;  4N8W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...