1F2BA

Crystal structure analysis of cruzain bound to vinyl sulfone derived inhibitor (iii)
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
215
structure length
215
Chain Sequence
b'APAAVDWRARGAVTAVKDQGQCGSCWAFSAIGNVECQWFLAGHPLTNLSEQMLVSCDKTDSGCSGGLMNNAFEWIVQENNGAVYTEDSYPYASGEGISPPCTTSGHTVGATITGHVELPQDEAQIAAWLAVNGPVAVAVDASSWMTYTGGVMTSCVSEQLDHGVLLVGYNDSAAVPYWIIKNSWTTQWGEEGYIRIAKGSNQCLVKEEASSAVVG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CRUZAIN
molecule tags Hydrolase
source organism Trypanosoma cruzi
publication title A target within the target: probing cruzain's P1' site to define structural determinants for the Chagas' disease protease.
pubmed doi rcsb
total genus 66
structure length 215
sequence length 215
ec nomenclature ec 3.4.22.51: Cruzipain.
pdb deposition date 2000-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1f2bA00
3KWZA 1PPDA 1AYUA 1F2CA 3KSEA 2P0RA 1BGOA 3IUTA 2VHFA 1DEUA 1QMYA 1Y08A 3PW3A 4QRVA 1Q6KA 4X6IA 3HHIA 1PADA 2AIMA 1DF0A 2FRQA 5F02A 2YJ9A 4CDDB 1VJVA 4CDCB 2DCDA 1F2AA 4YV8A 1THEA 2PBHA 3N3KA 1KHQA 4Q8GA 1U9WA 4I04A 2P86A 3BC3A 2R9OA 5CVMA 3KFQA 1STFE 2AS8A 2G8JA 1MEGA 4CDFB 1BQIA 4FJCA 4K7CA 1U9XA 2B1MA 7PCKA 3WXFA 2DCCA 3HD3A 1CPJA 1AYWA 2GHUA 2F7DA 4MZSA 3RVWA 4BPVA 2OZ2A 3KWBX 3TNXA 1SNKA 1CB5A 4CDEB 1KHPA 2HHNA 3OF9A 2NQGA 1CSBB 1BY8A 3H7DA 3MORA 2F1GA 2IPPB 4HWYA 1YT7A 1ME3A 2PREA 1HUCB 3OVXA 3QSDA 1MDWA 4PP2E 2WBFX 2DJFB 2IBIA 3B79A 2AYNA 1U9QX 4QBBA 2G6DA 4OELA 2PNSA 1AU0A 2FYEA 2YJ8A 2AUZA 3C9EA 2C0YA 3D6SA 5EF4A 4DMXA 1NLJA 3V6EA 3M99A 3P5VA 1SP4B 2CB5A 3H8BA 1AU4A 4QRXA 1O0EA 3N3GA 3P5XA 2AVWA 1YALA 4BQVA 4CZWA 1PXVA 2B1NA 1XKGA 2VHSA 1ATKA 4YYUA 1NB3A 3PBHA 1MIRA 2P7UA 1KFXL 1EWLA 1BP4A 1K3BB 4P6EA 1NQCA 2DZZA 1JQPA 3CBKA 2R9MA 1A6RA 5A24A 3ZUAA 2DJGB 2ARYA 4YVAA 5CHTA 4N79A 1S4VA 3KW9A 2YJCA 2GFOA 2JQGR 1ITOA 3E1ZB 4PADA 4YYWA 3K8UA 4RY2A 2E00A 1ICFA 1CS8A 3BOWA 2DC9A 1PPNA 2CIOA 1ZIVA 4N4ZA 4N8WA 2DC6A 1X9YA 1CV8A 2YJ2A 2FQ9A 1PE6A 3BPMA 3IMAA 4ZUXU 4FK5A 3QJ3A 2HD5A 3V6CA 2FO5A 2BDLA 2FTDA 2Y6EA 1POPA 1EF7A 3F5VA 1ME4A 1ZCMA 2R9FA 1F29A 4YYSA 4OEMA 1MHWA 3CBJA 4X6HA 1PPOA 3CH3X 2XU3A 3USVA 2NQDB 5J94A 3WXEA 8PCHA 2DC8A 1GECE 1GMYA 4MZOA 4XUIA 3AI8A 3K9MA 3P5WA 2R9CA 3HWNA 1IWDA 3BWKA 5CVNB 2Y5BA 3I3TA 4BSQA 1M6DA 3WXGA 2FUDA 3LXSA 3U8EA 4W5CA 5FPWA 1QXPA 4QH6A 4BS5A 6PADA 5CVOB 2XU5A 2FRAA 3QT4A 4PP1A 2AUXA 1KXRA 4Q8HA 3P5UA 3KX1A 4P6GA 3H89A 1FH0A 2FT2A 1VSNA 5CHVA 2YJBA 3OF8A 3IOQA 1CJLA 4G54A 1CTEA 3N4CA 3IEJA 1NB5A 4WA6A 2G8EA 4XR7A 1F2BA 1EWMA 2ATOA 9PAPA 3CH2X 4I05A 3OISA 1AU3A 2DC7A 2OULA 3K24A 3MTNA 3KKUA 3IV2A 1EWOA 2JQFR 3ERVA 1PCIA 4YYVA 2G7YA 3OVZA 1TL9A 1GCBA 1GLOA 1TU6A 3I06A 5EGWA 2E03A 3IHPA 1AIMA 1NPZA 1PBHA 3DF0A 3BCNA 2NQIA 1MS6A 1NL6A 3HHAA 2DZYA 3NHEA 4YYQA 2HXZA 3LFYA 5K16A 4W5BA 2ACTA 4AXMA 2AU1A 1EWPA 3MHSA 1Y4HA 4AXLA 5JA7A 1TLOA 1MEMA 2OP3A 1AU2A 3O1GA 2R6NA 1QDQA 2E01A 4MSXA 1QOLA 2PADA 1AYVA 2BDZA 3H8CA 3F75A 1AECA 4FIPA 4W4UA 3S3RA 2AYOA 2DCAA 5PADA 1PPPA 2O6XA 1YK8A 2NQAA 1CVZA 1KFUL 1U5IA 1PIPA 1CQDA 3RVXA 2E02A 3BPFA 2H7JA 5JH3A 2XU1A 4KLBA 3GCBA 1YVBA 1YK7A 2HH5A 4YYRA 3O0UA 3PNRA 4BS6A 4X6JA 4I07A 4QRGA 2DCBA 3MHHA 4DMYA 3PDFA 3H6SA 2XU4A 1U9VA 2R9NA 4PI3A 3RVVA 3S3QA
chains in the Genus database with same CATH superfamily
3KWZA 3O65A 4PT5A 1PPDA 1AYUA 1F2CA 3KSEA 2P0RA 1BGOA 3IUTA 2VHFA 1DEUA 1QMYA 1Y08A 3PW3A 4QRVA 1Q6KA 3MTVA 4X6IA 3HHIA 2Z84A 1PADA 2AIMA 4BOZA 1DF0A 2FRQA 4RF0A 5F02A 2YJ9A 4CDDB 1VJVA 4CDCB 2DCDA 1F2AA 4YV8A 1THEA 2PBHA 3N3KA 3W30A 4MM3B 1KHQA 4Q8GA 1U9WA 4I04A 4RKXA 2P86A 3BC3A 2R9OA 4XZXA 4BOQA 2HWKA 5CVMA 3KFQA 1STFE 2AS8A 2G8JA 4IP3A 1MEGA 4CDFB 1BQIA 4FJCA 4K7CA 1U9XA 2B1MA 7PCKA 3TRKA 3WXFA 2DCCA 3HD3A 4BOPA 4RNAA 1CPJA 1AYWA 2GHUA 2F7DA 4MZSA 3ZNHA 3RVWA 4BPVA 2OZ2A 4HXDB 3KWBX 3TNXA 1SNKA 1CB5A 4CDEB 1KHPA 2HHNA 3OF9A 2NQGA 1CSBB 1BY8A 3H7DA 2JTCA 3MORA 2F1GA 2IPPB 4HWYA 1YT7A 1ME3A 2PREA 1HUCB 3OVXA 2J7QC 3QSDA 1MDWA 4PP2E 2WBFX 2DJFB 2IBIA 2BU3A 3B79A 2AYNA 1U9QX 4QBBA 2G6DA 4OELA 2PNSA 1AU0A 4RF1A 2FYEA 2YJ8A 2AUZA 3C9EA 2C0YA 3D6SA 5EF4A 4DMXA 1NLJA 3V6EA 3M99A 3P5VA 1SP4B 2CB5A 3H8BA 1AU4A 4QRXA 1PVJA 1O0EA 3N3GA 3P5XA 4REZA 2AVWA 3PHWA 1YALA 4BQVA 4CZWA 1PXVA 2B1NA 1XKGA 2VHSA 4WURA 1ATKA 3RNVA 4YYUA 1NB3A 3PBHA 4M0WA 3C0RA 1MIRA 2P7UA 3IFUA 1KFXL 1EWLA 1BP4A 1K3BB 4P6EA 1NQCA 2DZZA 1JQPA 3CBKA 2R9MA 1A6RA 4D8EA 3BY4A 5A24A 3ZUAA 2DJGB 2ARYA 4YVAA 5CHTA 4N79A 1S4VA 3KW9A 2YJCA 2GFOA 2JQGR 1ITOA 2AGAA 3E1ZB 4P16A 4PADA 4YYWA 3K8UA 4RY2A 2E00A 1ICFA 1CS8A 3BOWA 2FE8A 2DC9A 1PPNA 2CIOA 1ZIVA 4N4ZA 4N8WA 5E6JA 2DC6A 4BOUA 5EZSA 1X9YA 1CV8A 2YJ2A 2FQ9A 1PE6A 3MJ5A 3BPMA 3IMAA 4ZUXU 4FK5A 3QJ3A 2HD5A 5JZEA 3V6CA 2FO5A 2BDLA 4R3DA 2FTDA 2Y6EA 1POPA 1EF7A 3F5VA 4BOSA 1ME4A 1ZCMA 2R9FA 3PRPA 1F29A 3E9SA 4YYSA 4OEMA 1MHWA 4ZTBA 4MI7A 3CBJA 4X6HA 1PPOA 3CH3X 2XU3A 3USVA 2NQDB 5J94A 3WXEA 8PCHA 2DC8A 1GECE 1GMYA 4MZOA 4XUIA 3AI8A 3K9MA 3P5WA 3PSEA 2R9CA 3HWNA 1IWDA 3BWKA 5CVNB 2Y5BA 3I3TA 4BSQA 2BTWA 1M6DA 3PT2A 3WXGA 4D8IA 2FUDA 3LXSA 3U8EA 4W5CA 5FPWA 1QXPA 4A5UA 4QH6A 4BS5A 6PADA 5CVOB 2XU5A 3PHXA 4GUAA 1YZBA 2FRAA 3QT4A 2DOSA 4D8BA 4PP1A 4IUMA 2AUXA 1KXRA 4Q8HA 3P5UA 3KX1A 4P6GA 3H89A 1FH0A 2FT2A 1VSNA 1DKIA 5CHVA 2YJBA 4OW0A 3OF8A 3IOQA 1CJLA 4G54A 1CTEA 3N4CA 3IEJA 1NB5A 4WA6A 2G8EA 4XR7A 1F2BA 1EWMA 2ATOA 9PAPA 3CH2X 4I05A 3OISA 1AU3A 2DC7A 2OULA 5KO3A 3K24A 3MTNA 3KKUA 3IV2A 1EWOA 2JQFR 3ERVA 4OVZA 1PCIA 2J7QA 3B21A 3W31A 4YYVA 2G7YA 3OVZA 1TL9A 1GCBA 1GLOA 1TU6A 3I06A 5EGWA 2E03A 3IHPA 1AIMA 1NPZA 1PBHA 3DF0A 3BCNA 3OQCA 2NQIA 1MS6A 1NL6A 3HHAA 2DZYA 2JRIA 1UKFA 3NHEA 2BTWB 4YYQA 2HXZA 3LFYA 3PRMA 5K16A 4W5BA 2ACTA 4AXMA 2AU1A 2UZJA 1EWPA 3MHSA 1Y4HA 4AXLA 5JA7A 1TLOA 1MEMA 2OP3A 1AU2A 3O1GA 2R6NA 3MP2A 1QDQA 2E01A 4MSXA 1QOLA 2PADA 1AYVA 2BDZA 3PHUA 3H8CA 3F75A 1AECA 4FIPA 4W4UA 3S3RA 3TMPA 2AYOA 2DCAA 5PADA 1PPPA 2O6XA 1YK8A 2NQAA 1CVZA 1KFUL 5EZQA 1U5IA 1PIPA 3BBAA 1CQDA 3RVXA 2E02A 3BPFA 2H7JA 5JH3A 2XU1A 4KLBA 3GCBA 1YVBA 4OVZB 1YK7A 2HH5A 3BB7A 4YYRA 3O0UA 3PNRA 4BS6A 4X6JA 4I07A 4QRGA 2DCBA 3MHHA 4DMYA 3PDFA 3H6SA 2XU4A 1U9VA 2R9NA 4PI3A 3RVVA 3S3QA
chains in the Genus database with same CATH topology
3KWZA 1PPDA 1AYUA 1F2CA 4GUZA 3KSEA 2P0RA 1BGOA 3IUTA 2VHFA 1DEUA 1QMYA 1Y08A 3PW3A 4QRVA 1Q6KA 4X6IA 3HHIA 1PADA 2AIMA 1DF0A 2FRQA 4C5PA 5F02A 4BGFA 2YJ9A 4CDDB 1VJVA 4CDCB 2DCDA 2BSZA 1F2AA 4YV8A 1THEA 2PBHA 3N3KA 1KHQA 4Q8GA 1U9WA 4NV7A 4I04A 2P86A 3BC3A 2R9OA 5CVMA 3KFQA 1STFE 2AS8A 2G8JA 1MEGA 4CDFB 1BQIA 4FJCA 4K7CA 1U9XA 2B1MA 7PCKA 3WXFA 2DCCA 3HD3A 1CPJA 1AYWA 2GHUA 2F7DA 4MZSA 3RVWA 4BPVA 2OZ2A 3KWBX 3TNXA 1SNKA 1CB5A 4CDEB 1KHPA 2HHNA 3OF9A 2NQGA 1CSBB 1BY8A 3H7DA 3MORA 2F1GA 2IPPB 4HWYA 1YT7A 1ME3A 2PREA 1HUCB 3OVXA 3QSDA 1MDWA 4PP2E 1W6FA 2WBFX 2DJFB 2IBIA 3B79A 2AYNA 1U9QX 4QBBA 2G6DA 4OELA 2PNSA 1AU0A 2FYEA 2YJ8A 2AUZA 3C9EA 2C0YA 3D6SA 5EF4A 4DMXA 1NLJA 3V6EA 3M99A 3P5VA 1SP4B 2CB5A 3H8BA 1AU4A 4QRXA 1O0EA 3N3GA 3P5XA 2AVWA 1YALA 4BQVA 4CZWA 1PXVA 2B1NA 1XKGA 2VHSA 1ATKA 4YYUA 1NB3A 3PBHA 1MIRA 2P7UA 1KFXL 1EWLA 1BP4A 1K3BB 4P6EA 1NQCA 2DZZA 1JQPA 3CBKA 2R9MA 1A6RA 5A24A 3ZUAA 2DJGB 2ARYA 4YVAA 5CHTA 4N79A 1S4VA 3KW9A 2YJCA 2GFOA 2JQGR 1ITOA 3E1ZB 4PADA 4YYWA 3K8UA 4RY2A 2E00A 1ICFA 1CS8A 3BOWA 2DC9A 1PPNA 2CIOA 1ZIVA 4N4ZA 4N8WA 2DC6A 1X9YA 1CV8A 2YJ2A 2FQ9A 1PE6A 3BPMA 3IMAA 4ZUXU 4FK5A 3QJ3A 2HD5A 3V6CA 2FO5A 1GX3A 2BDLA 2FTDA 2Y6EA 1POPA 1EF7A 3F5VA 1ME4A 1ZCMA 2R9FA 1F29A 4YYSA 4OEMA 1MHWA 2VFCA 3CBJA 4X6HA 1PPOA 3CH3X 2XU3A 3USVA 2NQDB 5J94A 3WXEA 8PCHA 2DC8A 1GECE 1GMYA 4MZOA 4XUIA 3AI8A 3K9MA 3P5WA 2R9CA 3HWNA 1IWDA 3BWKA 5CVNB 2Y5BA 3I3TA 4BSQA 1M6DA 3WXGA 2FUDA 3LXSA 3U8EA 4W5CA 5FPWA 1QXPA 4QH6A 4BS5A 6PADA 5CVOB 2XU5A 2FRAA 3QT4A 3LTWA 4PP1A 2AUXA 1KXRA 4Q8HA 3P5UA 3KX1A 4P6GA 3H89A 1FH0A 2FT2A 2VFBA 1VSNA 5CHVA 2YJBA 3OF8A 3IOQA 1CJLA 4G54A 1CTEA 3N4CA 3IEJA 1NB5A 4WA6A 2G8EA 4XR7A 1F2BA 1EWMA 2ATOA 9PAPA 3CH2X 4I05A 3OISA 1AU3A 2DC7A 2OULA 3K24A 3MTNA 3KKUA 3IV2A 1EWOA 2JQFR 3ERVA 1PCIA 4YYVA 2G7YA 3OVZA 1TL9A 1GCBA 1GLOA 1TU6A 3I06A 5EGWA 2E03A 3IHPA 1AIMA 1NPZA 1PBHA 3DF0A 3BCNA 2NQIA 1MS6A 1NL6A 3HHAA 2DZYA 3NHEA 4YYQA 2HXZA 3LFYA 5K16A 4W5BA 2ACTA 4AXMA 2AU1A 1EWPA 3MHSA 1E2TA 1Y4HA 4AXLA 5JA7A 1TLOA 1MEMA 2OP3A 1AU2A 3D9WA 3O1GA 2R6NA 1QDQA 2E01A 4MSXA 1QOLA 2PADA 1AYVA 2BDZA 3H8CA 3F75A 1AECA 4FIPA 4W4UA 3S3RA 2AYOA 2DCAA 5PADA 1PPPA 2O6XA 1YK8A 2NQAA 1CVZA 1KFUL 1U5IA 1PIPA 1CQDA 3RVXA 4B55A 1W5RA 2E02A 3BPFA 2H7JA 5JH3A 2XU1A 4KLBA 3GCBA 1YVBA 1YK7A 2HH5A 4YYRA 3O0UA 3PNRA 4BS6A 4X6JA 4I07A 4QRGA 1W4TA 2DCBA 3MHHA 4DMYA 3PDFA 3H6SA 2XU4A 1U9VA 2R9NA 4NV8A 4PI3A 3RVVA 3S3QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KWZ A;  1PPD A;  1AYU A;  1F2C A;  3KSE A;  2P0R A;  1BGO A;  3IUT A;  2VHF A;  1DEU A;  1QMY A;  1Y08 A;  3PW3 A;  4QRV A;  1Q6K A;  4X6I A;  3HHI A;  1PAD A;  2AIM A;  1DF0 A;  2FRQ A;  5F02 A;  2YJ9 A;  4CDD B;  1VJV A;  4CDC B;  2DCD A;  1F2A A;  4YV8 A;  1THE A;  2PBH A;  3N3K A;  1KHQ A;  4Q8G A;  1U9W A;  4I04 A;  2P86 A;  3BC3 A;  2R9O A;  5CVM A;  3KFQ A;  1STF E;  2AS8 A;  2G8J A;  1MEG A;  4CDF B;  1BQI A;  4FJC A;  4K7C A;  1U9X A;  2B1M A;  7PCK A;  3WXF A;  2DCC A;  3HD3 A;  1CPJ A;  1AYW A;  2GHU A;  2F7D A;  4MZS A;  3RVW A;  4BPV A;  2OZ2 A;  3KWB X;  3TNX A;  1SNK A;  1CB5 A;  4CDE B;  1KHP A;  2HHN A;  3OF9 A;  2NQG A;  1CSB B;  1BY8 A;  3H7D A;  3MOR A;  2F1G A;  2IPP B;  4HWY A;  1YT7 A;  1ME3 A;  2PRE A;  1HUC B;  3OVX A;  3QSD A;  1MDW A;  4PP2 E;  2WBF X;  2DJF B;  2IBI A;  3B79 A;  2AYN A;  1U9Q X;  4QBB A;  2G6D A;  4OEL A;  2PNS A;  1AU0 A;  2FYE A;  2YJ8 A;  2AUZ A;  3C9E A;  2C0Y A;  3D6S A;  5EF4 A;  4DMX A;  1NLJ A;  3V6E A;  3M99 A;  3P5V A;  1SP4 B;  2CB5 A;  3H8B A;  1AU4 A;  4QRX A;  1O0E A;  3N3G A;  3P5X A;  2AVW A;  1YAL A;  4BQV A;  4CZW A;  1PXV A;  2B1N A;  1XKG A;  2VHS A;  1ATK A;  4YYU A;  1NB3 A;  3PBH A;  1MIR A;  2P7U A;  1KFX L;  1EWL A;  1BP4 A;  1K3B B;  4P6E A;  1NQC A;  2DZZ A;  1JQP A;  3CBK A;  2R9M A;  1A6R A;  5A24 A;  3ZUA A;  2DJG B;  2ARY A;  4YVA A;  5CHT A;  4N79 A;  1S4V A;  3KW9 A;  2YJC A;  2GFO A;  2JQG R;  1ITO A;  3E1Z B;  4PAD A;  4YYW A;  3K8U A;  4RY2 A;  2E00 A;  1ICF A;  1CS8 A;  3BOW A;  2DC9 A;  1PPN A;  2CIO A;  1ZIV A;  4N4Z A;  4N8W A;  2DC6 A;  1X9Y A;  1CV8 A;  2YJ2 A;  2FQ9 A;  1PE6 A;  3BPM A;  3IMA A;  4ZUX U;  4FK5 A;  3QJ3 A;  2HD5 A;  3V6C A;  2FO5 A;  2BDL A;  2FTD A;  2Y6E A;  1POP A;  1EF7 A;  3F5V A;  1ME4 A;  1ZCM A;  2R9F A;  1F29 A;  4YYS A;  4OEM A;  1MHW A;  3CBJ A;  4X6H A;  1PPO A;  3CH3 X;  2XU3 A;  3USV A;  2NQD B;  5J94 A;  3WXE A;  8PCH A;  2DC8 A;  1GEC E;  1GMY A;  4MZO A;  4XUI A;  3AI8 A;  3K9M A;  3P5W A;  2R9C A;  3HWN A;  1IWD A;  3BWK A;  5CVN B;  2Y5B A;  3I3T A;  4BSQ A;  1M6D A;  3WXG A;  2FUD A;  3LXS A;  3U8E A;  4W5C A;  5FPW A;  1QXP A;  4QH6 A;  4BS5 A;  6PAD A;  5CVO B;  2XU5 A;  2FRA A;  3QT4 A;  4PP1 A;  2AUX A;  1KXR A;  4Q8H A;  3P5U A;  3KX1 A;  4P6G A;  3H89 A;  1FH0 A;  2FT2 A;  1VSN A;  5CHV A;  2YJB A;  3OF8 A;  3IOQ A;  1CJL A;  4G54 A;  1CTE A;  3N4C A;  3IEJ A;  1NB5 A;  4WA6 A;  2G8E A;  4XR7 A;  1F2B A;  1EWM A;  2ATO A;  9PAP A;  3CH2 X;  4I05 A;  3OIS A;  1AU3 A;  2DC7 A;  2OUL A;  3K24 A;  3MTN A;  3KKU A;  3IV2 A;  1EWO A;  2JQF R;  3ERV A;  1PCI A;  4YYV A;  2G7Y A;  3OVZ A;  1TL9 A;  1GCB A;  1GLO A;  1TU6 A;  3I06 A;  5EGW A;  2E03 A;  3IHP A;  1AIM A;  1NPZ A;  1PBH A;  3DF0 A;  3BCN A;  2NQI A;  1MS6 A;  1NL6 A;  3HHA A;  2DZY A;  3NHE A;  4YYQ A;  2HXZ A;  3LFY A;  5K16 A;  4W5B A;  2ACT A;  4AXM A;  2AU1 A;  1EWP A;  3MHS A;  1Y4H A;  4AXL A;  5JA7 A;  1TLO A;  1MEM A;  2OP3 A;  1AU2 A;  3O1G A;  2R6N A;  1QDQ A;  2E01 A;  4MSX A;  1QOL A;  2PAD A;  1AYV A;  2BDZ A;  3H8C A;  3F75 A;  1AEC A;  4FIP A;  4W4U A;  3S3R A;  2AYO A;  2DCA A;  5PAD A;  1PPP A;  2O6X A;  1YK8 A;  2NQA A;  1CVZ A;  1KFU L;  1U5I A;  1PIP A;  1CQD A;  3RVX A;  2E02 A;  3BPF A;  2H7J A;  5JH3 A;  2XU1 A;  4KLB A;  3GCB A;  1YVB A;  1YK7 A;  2HH5 A;  4YYR A;  3O0U A;  3PNR A;  4BS6 A;  4X6J A;  4I07 A;  4QRG A;  2DCB A;  3MHH A;  4DMY A;  3PDF A;  3H6S A;  2XU4 A;  1U9V A;  2R9N A;  4PI3 A;  3RVV A;  3S3Q A; 
#chains in the Genus database with same CATH topology
 3KWZ A;  3O65 A;  4PT5 A;  1PPD A;  1AYU A;  1F2C A;  3KSE A;  2P0R A;  1BGO A;  3IUT A;  2VHF A;  1DEU A;  1QMY A;  1Y08 A;  3PW3 A;  4QRV A;  1Q6K A;  3MTV A;  4X6I A;  3HHI A;  2Z84 A;  1PAD A;  2AIM A;  4BOZ A;  1DF0 A;  2FRQ A;  4RF0 A;  5F02 A;  2YJ9 A;  4CDD B;  1VJV A;  4CDC B;  2DCD A;  1F2A A;  4YV8 A;  1THE A;  2PBH A;  3N3K A;  3W30 A;  4MM3 B;  1KHQ A;  4Q8G A;  1U9W A;  4I04 A;  4RKX A;  2P86 A;  3BC3 A;  2R9O A;  4XZX A;  4BOQ A;  2HWK A;  5CVM A;  3KFQ A;  1STF E;  2AS8 A;  2G8J A;  4IP3 A;  1MEG A;  4CDF B;  1BQI A;  4FJC A;  4K7C A;  1U9X A;  2B1M A;  7PCK A;  3TRK A;  3WXF A;  2DCC A;  3HD3 A;  4BOP A;  4RNA A;  1CPJ A;  1AYW A;  2GHU A;  2F7D A;  4MZS A;  3ZNH A;  3RVW A;  4BPV A;  2OZ2 A;  4HXD B;  3KWB X;  3TNX A;  1SNK A;  1CB5 A;  4CDE B;  1KHP A;  2HHN A;  3OF9 A;  2NQG A;  1CSB B;  1BY8 A;  3H7D A;  2JTC A;  3MOR A;  2F1G A;  2IPP B;  4HWY A;  1YT7 A;  1ME3 A;  2PRE A;  1HUC B;  3OVX A;  2J7Q C;  3QSD A;  1MDW A;  4PP2 E;  2WBF X;  2DJF B;  2IBI A;  2BU3 A;  3B79 A;  2AYN A;  1U9Q X;  4QBB A;  2G6D A;  4OEL A;  2PNS A;  1AU0 A;  4RF1 A;  2FYE A;  2YJ8 A;  2AUZ A;  3C9E A;  2C0Y A;  3D6S A;  5EF4 A;  4DMX A;  1NLJ A;  3V6E A;  3M99 A;  3P5V A;  1SP4 B;  2CB5 A;  3H8B A;  1AU4 A;  4QRX A;  1PVJ A;  1O0E A;  3N3G A;  3P5X A;  4REZ A;  2AVW A;  3PHW A;  1YAL A;  4BQV A;  4CZW A;  1PXV A;  2B1N A;  1XKG A;  2VHS A;  4WUR A;  1ATK A;  3RNV A;  4YYU A;  1NB3 A;  3PBH A;  4M0W A;  3C0R A;  1MIR A;  2P7U A;  3IFU A;  1KFX L;  1EWL A;  1BP4 A;  1K3B B;  4P6E A;  1NQC A;  2DZZ A;  1JQP A;  3CBK A;  2R9M A;  1A6R A;  4D8E A;  3BY4 A;  5A24 A;  3ZUA A;  2DJG B;  2ARY A;  4YVA A;  5CHT A;  4N79 A;  1S4V A;  3KW9 A;  2YJC A;  2GFO A;  2JQG R;  1ITO A;  2AGA A;  3E1Z B;  4P16 A;  4PAD A;  4YYW A;  3K8U A;  4RY2 A;  2E00 A;  1ICF A;  1CS8 A;  3BOW A;  2FE8 A;  2DC9 A;  1PPN A;  2CIO A;  1ZIV A;  4N4Z A;  4N8W A;  5E6J A;  2DC6 A;  4BOU A;  5EZS A;  1X9Y A;  1CV8 A;  2YJ2 A;  2FQ9 A;  1PE6 A;  3MJ5 A;  3BPM A;  3IMA A;  4ZUX U;  4FK5 A;  3QJ3 A;  2HD5 A;  5JZE A;  3V6C A;  2FO5 A;  2BDL A;  4R3D A;  2FTD A;  2Y6E A;  1POP A;  1EF7 A;  3F5V A;  4BOS A;  1ME4 A;  1ZCM A;  2R9F A;  3PRP A;  1F29 A;  3E9S A;  4YYS A;  4OEM A;  1MHW A;  4ZTB A;  4MI7 A;  3CBJ A;  4X6H A;  1PPO A;  3CH3 X;  2XU3 A;  3USV A;  2NQD B;  5J94 A;  3WXE A;  8PCH A;  2DC8 A;  1GEC E;  1GMY A;  4MZO A;  4XUI A;  3AI8 A;  3K9M A;  3P5W A;  3PSE A;  2R9C A;  3HWN A;  1IWD A;  3BWK A;  5CVN B;  2Y5B A;  3I3T A;  4BSQ A;  2BTW A;  1M6D A;  3PT2 A;  3WXG A;  4D8I A;  2FUD A;  3LXS A;  3U8E A;  4W5C A;  5FPW A;  1QXP A;  4A5U A;  4QH6 A;  4BS5 A;  6PAD A;  5CVO B;  2XU5 A;  3PHX A;  4GUA A;  1YZB A;  2FRA A;  3QT4 A;  2DOS A;  4D8B A;  4PP1 A;  4IUM A;  2AUX A;  1KXR A;  4Q8H A;  3P5U A;  3KX1 A;  4P6G A;  3H89 A;  1FH0 A;  2FT2 A;  1VSN A;  1DKI A;  5CHV A;  2YJB A;  4OW0 A;  3OF8 A;  3IOQ A;  1CJL A;  4G54 A;  1CTE A;  3N4C A;  3IEJ A;  1NB5 A;  4WA6 A;  2G8E A;  4XR7 A;  1F2B A;  1EWM A;  2ATO A;  9PAP A;  3CH2 X;  4I05 A;  3OIS A;  1AU3 A;  2DC7 A;  2OUL A;  5KO3 A;  3K24 A;  3MTN A;  3KKU A;  3IV2 A;  1EWO A;  2JQF R;  3ERV A;  4OVZ A;  1PCI A;  2J7Q A;  3B21 A;  3W31 A;  4YYV A;  2G7Y A;  3OVZ A;  1TL9 A;  1GCB A;  1GLO A;  1TU6 A;  3I06 A;  5EGW A;  2E03 A;  3IHP A;  1AIM A;  1NPZ A;  1PBH A;  3DF0 A;  3BCN A;  3OQC A;  2NQI A;  1MS6 A;  1NL6 A;  3HHA A;  2DZY A;  2JRI A;  1UKF A;  3NHE A;  2BTW B;  4YYQ A;  2HXZ A;  3LFY A;  3PRM A;  5K16 A;  4W5B A;  2ACT A;  4AXM A;  2AU1 A;  2UZJ A;  1EWP A;  3MHS A;  1Y4H A;  4AXL A;  5JA7 A;  1TLO A;  1MEM A;  2OP3 A;  1AU2 A;  3O1G A;  2R6N A;  3MP2 A;  1QDQ A;  2E01 A;  4MSX A;  1QOL A;  2PAD A;  1AYV A;  2BDZ A;  3PHU A;  3H8C A;  3F75 A;  1AEC A;  4FIP A;  4W4U A;  3S3R A;  3TMP A;  2AYO A;  2DCA A;  5PAD A;  1PPP A;  2O6X A;  1YK8 A;  2NQA A;  1CVZ A;  1KFU L;  5EZQ A;  1U5I A;  1PIP A;  3BBA A;  1CQD A;  3RVX A;  2E02 A;  3BPF A;  2H7J A;  5JH3 A;  2XU1 A;  4KLB A;  3GCB A;  1YVB A;  4OVZ B;  1YK7 A;  2HH5 A;  3BB7 A;  4YYR A;  3O0U A;  3PNR A;  4BS6 A;  4X6J A;  4I07 A;  4QRG A;  2DCB A;  3MHH A;  4DMY A;  3PDF A;  3H6S A;  2XU4 A;  1U9V A;  2R9N A;  4PI3 A;  3RVV A;  3S3Q A; 
#chains in the Genus database with same CATH homology
 3KWZ A;  1PPD A;  1AYU A;  1F2C A;  4GUZ A;  3KSE A;  2P0R A;  1BGO A;  3IUT A;  2VHF A;  1DEU A;  1QMY A;  1Y08 A;  3PW3 A;  4QRV A;  1Q6K A;  4X6I A;  3HHI A;  1PAD A;  2AIM A;  1DF0 A;  2FRQ A;  4C5P A;  5F02 A;  4BGF A;  2YJ9 A;  4CDD B;  1VJV A;  4CDC B;  2DCD A;  2BSZ A;  1F2A A;  4YV8 A;  1THE A;  2PBH A;  3N3K A;  1KHQ A;  4Q8G A;  1U9W A;  4NV7 A;  4I04 A;  2P86 A;  3BC3 A;  2R9O A;  5CVM A;  3KFQ A;  1STF E;  2AS8 A;  2G8J A;  1MEG A;  4CDF B;  1BQI A;  4FJC A;  4K7C A;  1U9X A;  2B1M A;  7PCK A;  3WXF A;  2DCC A;  3HD3 A;  1CPJ A;  1AYW A;  2GHU A;  2F7D A;  4MZS A;  3RVW A;  4BPV A;  2OZ2 A;  3KWB X;  3TNX A;  1SNK A;  1CB5 A;  4CDE B;  1KHP A;  2HHN A;  3OF9 A;  2NQG A;  1CSB B;  1BY8 A;  3H7D A;  3MOR A;  2F1G A;  2IPP B;  4HWY A;  1YT7 A;  1ME3 A;  2PRE A;  1HUC B;  3OVX A;  3QSD A;  1MDW A;  4PP2 E;  1W6F A;  2WBF X;  2DJF B;  2IBI A;  3B79 A;  2AYN A;  1U9Q X;  4QBB A;  2G6D A;  4OEL A;  2PNS A;  1AU0 A;  2FYE A;  2YJ8 A;  2AUZ A;  3C9E A;  2C0Y A;  3D6S A;  5EF4 A;  4DMX A;  1NLJ A;  3V6E A;  3M99 A;  3P5V A;  1SP4 B;  2CB5 A;  3H8B A;  1AU4 A;  4QRX A;  1O0E A;  3N3G A;  3P5X A;  2AVW A;  1YAL A;  4BQV A;  4CZW A;  1PXV A;  2B1N A;  1XKG A;  2VHS A;  1ATK A;  4YYU A;  1NB3 A;  3PBH A;  1MIR A;  2P7U A;  1KFX L;  1EWL A;  1BP4 A;  1K3B B;  4P6E A;  1NQC A;  2DZZ A;  1JQP A;  3CBK A;  2R9M A;  1A6R A;  5A24 A;  3ZUA A;  2DJG B;  2ARY A;  4YVA A;  5CHT A;  4N79 A;  1S4V A;  3KW9 A;  2YJC A;  2GFO A;  2JQG R;  1ITO A;  3E1Z B;  4PAD A;  4YYW A;  3K8U A;  4RY2 A;  2E00 A;  1ICF A;  1CS8 A;  3BOW A;  2DC9 A;  1PPN A;  2CIO A;  1ZIV A;  4N4Z A;  4N8W A;  2DC6 A;  1X9Y A;  1CV8 A;  2YJ2 A;  2FQ9 A;  1PE6 A;  3BPM A;  3IMA A;  4ZUX U;  4FK5 A;  3QJ3 A;  2HD5 A;  3V6C A;  2FO5 A;  1GX3 A;  2BDL A;  2FTD A;  2Y6E A;  1POP A;  1EF7 A;  3F5V A;  1ME4 A;  1ZCM A;  2R9F A;  1F29 A;  4YYS A;  4OEM A;  1MHW A;  2VFC A;  3CBJ A;  4X6H A;  1PPO A;  3CH3 X;  2XU3 A;  3USV A;  2NQD B;  5J94 A;  3WXE A;  8PCH A;  2DC8 A;  1GEC E;  1GMY A;  4MZO A;  4XUI A;  3AI8 A;  3K9M A;  3P5W A;  2R9C A;  3HWN A;  1IWD A;  3BWK A;  5CVN B;  2Y5B A;  3I3T A;  4BSQ A;  1M6D A;  3WXG A;  2FUD A;  3LXS A;  3U8E A;  4W5C A;  5FPW A;  1QXP A;  4QH6 A;  4BS5 A;  6PAD A;  5CVO B;  2XU5 A;  2FRA A;  3QT4 A;  3LTW A;  4PP1 A;  2AUX A;  1KXR A;  4Q8H A;  3P5U A;  3KX1 A;  4P6G A;  3H89 A;  1FH0 A;  2FT2 A;  2VFB A;  1VSN A;  5CHV A;  2YJB A;  3OF8 A;  3IOQ A;  1CJL A;  4G54 A;  1CTE A;  3N4C A;  3IEJ A;  1NB5 A;  4WA6 A;  2G8E A;  4XR7 A;  1F2B A;  1EWM A;  2ATO A;  9PAP A;  3CH2 X;  4I05 A;  3OIS A;  1AU3 A;  2DC7 A;  2OUL A;  3K24 A;  3MTN A;  3KKU A;  3IV2 A;  1EWO A;  2JQF R;  3ERV A;  1PCI A;  4YYV A;  2G7Y A;  3OVZ A;  1TL9 A;  1GCB A;  1GLO A;  1TU6 A;  3I06 A;  5EGW A;  2E03 A;  3IHP A;  1AIM A;  1NPZ A;  1PBH A;  3DF0 A;  3BCN A;  2NQI A;  1MS6 A;  1NL6 A;  3HHA A;  2DZY A;  3NHE A;  4YYQ A;  2HXZ A;  3LFY A;  5K16 A;  4W5B A;  2ACT A;  4AXM A;  2AU1 A;  1EWP A;  3MHS A;  1E2T A;  1Y4H A;  4AXL A;  5JA7 A;  1TLO A;  1MEM A;  2OP3 A;  1AU2 A;  3D9W A;  3O1G A;  2R6N A;  1QDQ A;  2E01 A;  4MSX A;  1QOL A;  2PAD A;  1AYV A;  2BDZ A;  3H8C A;  3F75 A;  1AEC A;  4FIP A;  4W4U A;  3S3R A;  2AYO A;  2DCA A;  5PAD A;  1PPP A;  2O6X A;  1YK8 A;  2NQA A;  1CVZ A;  1KFU L;  1U5I A;  1PIP A;  1CQD A;  3RVX A;  4B55 A;  1W5R A;  2E02 A;  3BPF A;  2H7J A;  5JH3 A;  2XU1 A;  4KLB A;  3GCB A;  1YVB A;  1YK7 A;  2HH5 A;  4YYR A;  3O0U A;  3PNR A;  4BS6 A;  4X6J A;  4I07 A;  4QRG A;  1W4T A;  2DCB A;  3MHH A;  4DMY A;  3PDF A;  3H6S A;  2XU4 A;  1U9V A;  2R9N A;  4NV8 A;  4PI3 A;  3RVV A;  3S3Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...