1F2BA

Crystal structure analysis of cruzain bound to vinyl sulfone derived inhibitor (iii)
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
215
structure length
215
Chain Sequence
APAAVDWRARGAVTAVKDQGQCGSCWAFSAIGNVECQWFLAGHPLTNLSEQMLVSCDKTDSGCSGGLMNNAFEWIVQENNGAVYTEDSYPYASGEGISPPCTTSGHTVGATITGHVELPQDEAQIAAWLAVNGPVAVAVDASSWMTYTGGVMTSCVSEQLDHGVLLVGYNDSAAVPYWIIKNSWTTQWGEEGYIRIAKGSNQCLVKEEASSAVVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A target within the target: probing cruzain's P1' site to define structural determinants for the Chagas' disease protease.
pubmed doi rcsb
source organism Trypanosoma cruzi
molecule tags Hydrolase
molecule keywords CRUZAIN
total genus 66
structure length 215
sequence length 215
ec nomenclature ec 3.4.22.51: Cruzipain.
pdb deposition date 2000-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1f2bA00
1F2AA 1PPNA 2NQDB 1F2CA 1PPOA 2DCDA 3H8BA 2ARYA 1AU3A 2O6XA 1Q6KA 2JQGR 3PW3A 2G8EA 1CV8A 1POPA 4HWYA 1AU0A 1PIPA 4P6EA 3HHIA 1NQCA 4P6GA 2VHSA 3I06A 1NB5A 2IBIA 2DC7A 4YYVA 1U9XA 2PREA 3BC3A 4YYQA 3E1ZB 2YJBA 1PPDA 2Y6EA 3H89A 3N4CA 2P7UA 4DMYA 2AUXA 3WXFA 1PCIA 1KHPA 5EF4A 1ZCMA 2FUDA 8PCHA 1KFUL 4WA6A 1BY8A 2Y5BA 1GCBA 4BSQA 5CHVA 5FPWA 3HHAA 4XUIA 1TLOA 2G6DA 1CS8A 1NPZA 2NQIA 2ACTA 2YJ2A 2ATOA 1PBHA 1VJVA 1EWLA 2FRAA 4FIPA 1AECA 1CPJA 1GLOA 2XU3A 2FT2A 3IUTA 2E02A 1CSBB 1QXPA 1BQIA 1GECE 3CH3X 1CB5A 2R9MA 2FTDA 1CVZA 4CZWA 1AYVA 4QRVA 3BOWA 4W4UA 3S3RA 2HH5A 1MIRA 1IWDA 2H7JA 3H6SA 3DF0A 4DMXA 4N79A 2AYOA 2FQ9A 1DEUA 2P0RA 2AS8A 4YVAA 3KWZA 3OF8A 4I04A 3MHSA 2OULA 4OEMA 2DZYA 5J94A 2F1GA 2GHUA 1XKGA 1A6RA 4QH6A 3QT4A 2DCBA 4BQVA 3M99A 3K24A 1O0EA 2FYEA 4YYRA 2PADA 2G8JA 3GCBA 2NQAA 2R9FA 1JQPA 3C9EA 3I3TA 4QBBA 5F02A 2YJCA 3USVA 3O0UA 4MZOA 3P5WA 4X6HA 1PE6A 1TU6A 2PBHA 3BPMA 3K8UA 3LFYA 3CBJA 1YK8A 2FRQA 1U5IA 2OZ2A 2G7YA 1Y4HA 2E03A 2NQGA 3OISA 3HWNA 2CIOA 1FH0A 4W5BA 5JH3A 1AIMA 1QMYA 1YVBA 1YT7A 3F75A 1BGOA 1MS6A 2DJGB 1EF7A 4PI3A 1EWPA 1EWMA 1THEA 5PADA 4YV8A 3MTNA 4QRXA 3ZUAA 2B1MA 3RVWA 1U9WA 2AVWA 3RVXA 4YYWA 4AXMA 3OVXA 3KSEA 5K16A 3QSDA 1X9YA 1TL9A 4X6IA 3IOQA 3BPFA 3PDFA 1ICFA 3KX1A 4YYSA 1S4VA 2DZZA 2IPPB 3F5VA 1ZIVA 3O1GA 4N8WA 1PXVA 2YJ8A 4I05A 1STFE 4CDCB 2JQFR 1NLJA 4K7CA 1MHWA 1KHQA 3IMAA 1ITOA 1NL6A 1F2BA 1KFXL 5JA7A 4MZSA 2HHNA 2AYNA 1MDWA 2P86A 3QJ3A 3KWBX 3U8EA 2CB5A 2WBFX 3LXSA 4BPVA 3NHEA 5CVMA 5CVOB 1PADA 4Q8GA 3KFQA 1ATKA 1K3BB 4XR7A 5CHTA 1YALA 1CJLA 4Q8HA 3CBKA 3AI8A 3OVZA 1QDQA 2DCAA 3TNXA 3OF9A 3H7DA 3V6CA 1AYWA 2DC6A 4PP1A 3WXGA 2E01A 1YK7A 4RY2A 2PNSA 2DJFB 1AU4A 3D6SA 2E00A 4N4ZA 7PCKA 1KXRA 2XU1A 1SP4B 2OP3A 3V6EA 3KKUA 4CDEB 3BCNA 6PADA 3S3QA 4YYUA 1QOLA 4MSXA 2XU4A 2FO5A 4I07A 3WXEA 4PP2E 3PNRA 4OELA 2C0YA 4G54A 4BS5A 2R9OA 1Y08A 1PPPA 1F29A 2DC8A 2AUZA 3K9MA 1U9QX 3PBHA 2AU1A 3MORA 1VSNA 1AU2A 4CDFB 3B79A 1SNKA 3H8CA 2R9NA 3ERVA 3IEJA 4ZUXU 2YJ9A 4KLBA 4AXLA 3IHPA 1EWOA 1ME4A 1ME3A 4FJCA 1CTEA 3N3GA 5EGWA 3MHHA 2XU5A 1GMYA 3IV2A 3CH2X 1MEMA 2GFOA 2BDZA 2B1NA 1BP4A 2F7DA 4QRGA 3KW9A 4W5CA 2DC9A 9PAPA 2AIMA 2HD5A 1U9VA 4CDDB 2R9CA 1MEGA 1HUCB 3P5XA 4BS6A 5CVNB 3BWKA 3HD3A 3RVVA 1AYUA 4FK5A 4X6JA 2BDLA 1M6DA 4PADA 2DCCA 2VHFA 5A24A 1DF0A 2R6NA 1NB3A 1CQDA 2HXZA 3N3KA 3P5VA 3P5UA
chains in the Genus database with same CATH superfamily
3PHXA 1F2AA 1PPNA 2NQDB 1F2CA 1PPOA 2DCDA 3H8BA 2ARYA 1AU3A 2DOSA 2O6XA 1Q6KA 3ZNHA 2JQGR 3PW3A 4PT5A 5EZQA 3BB7A 2G8EA 1CV8A 1POPA 3C0RA 4HWYA 4RNAA 1AU0A 1PIPA 4P6EA 3HHIA 1NQCA 4P6GA 2VHSA 3I06A 1NB5A 2IBIA 4OW0A 2DC7A 4YYVA 1U9XA 2PREA 3BC3A 4RKXA 4YYQA 3E1ZB 2YJBA 1PPDA 2Y6EA 3H89A 3N4CA 2P7UA 4DMYA 2AUXA 3BY4A 3WXFA 1PCIA 1KHPA 5EF4A 1ZCMA 2FUDA 8PCHA 1KFUL 4WA6A 1BY8A 2Y5BA 1GCBA 4BSQA 4MI7A 5CHVA 5FPWA 3HHAA 4XUIA 1TLOA 2AGAA 4D8BA 2G6DA 1CS8A 1NPZA 2NQIA 2ACTA 2YJ2A 2JRIA 4HXDB 2ATOA 1PBHA 1VJVA 1EWLA 2FRAA 4FIPA 1AECA 1CPJA 3PT2A 2JTCA 4A5UA 1GLOA 2XU3A 2FT2A 3IUTA 2BTWA 2E02A 1CSBB 1QXPA 3PHUA 1DKIA 1BQIA 1GECE 3CH3X 1CB5A 2R9MA 2FTDA 3E9SA 1CVZA 4CZWA 1AYVA 4QRVA 3BOWA 4W4UA 3S3RA 2HH5A 1MIRA 1IWDA 2H7JA 3H6SA 3DF0A 4DMXA 4N79A 2AYOA 3MP2A 4OVZA 2FQ9A 1DEUA 2P0RA 2AS8A 4YVAA 3KWZA 3OF8A 4I04A 3MHSA 2OULA 4OEMA 2DZYA 5J94A 3O65A 2F1GA 3W31A 2GHUA 1XKGA 1A6RA 4QH6A 3QT4A 2DCBA 4BQVA 3M99A 4IP3A 3K24A 1O0EA 2FYEA 4YYRA 2PADA 2G8JA 3GCBA 2NQAA 3PRMA 2R9FA 1JQPA 3C9EA 4RF0A 3I3TA 4QBBA 5F02A 2UZJA 2YJCA 3USVA 3IFUA 3O0UA 4MZOA 3P5WA 3BBAA 4X6HA 1PE6A 1TU6A 2PBHA 3MTVA 3BPMA 3K8UA 3LFYA 3CBJA 1YK8A 2FRQA 1U5IA 2BU3A 2G7YA 1Y4HA 2OZ2A 2E03A 2NQGA 3OISA 2J7QC 3HWNA 4D8IA 2CIOA 1FH0A 4W5BA 5JH3A 1AIMA 4OVZB 1QMYA 1YVBA 1YT7A 4M0WA 3F75A 1BGOA 1MS6A 2DJGB 2FE8A 1EF7A 4PI3A 1EWPA 1EWMA 1THEA 5PADA 4YV8A 3MTNA 4QRXA 3ZUAA 2B1MA 4ZTBA 1U9WA 3RVWA 2AVWA 3RVXA 4YYWA 4AXMA 3OVXA 3KSEA 5K16A 3QSDA 1X9YA 1TL9A 4X6IA 3IOQA 4R3DA 3BPFA 3PDFA 1ICFA 2J7QA 3KX1A 4YYSA 1S4VA 2DZZA 2IPPB 3F5VA 4BOZA 1ZIVA 3O1GA 4N8WA 1PXVA 2YJ8A 4I05A 1STFE 4CDCB 3RNVA 2JQFR 1NLJA 4K7CA 1MHWA 1KHQA 3IMAA 1ITOA 1NL6A 1F2BA 1KFXL 5JA7A 4MZSA 2HHNA 2AYNA 1MDWA 2P86A 3QJ3A 3KWBX 3U8EA 2CB5A 2BTWB 2WBFX 3LXSA 4BPVA 3NHEA 5CVMA 5CVOB 5E6JA 1PADA 4Q8GA 3KFQA 1ATKA 1PVJA 1K3BB 4XR7A 5CHTA 3PHWA 3OQCA 1UKFA 1YALA 1CJLA 4BOPA 4Q8HA 3CBKA 3AI8A 3OVZA 3B21A 3PRPA 1QDQA 2DCAA 4P16A 4D8EA 3TNXA 4MM3B 4GUAA 5KO3A 3OF9A 3H7DA 3V6CA 1AYWA 2DC6A 4PP1A 3WXGA 2E01A 1YK7A 4RY2A 2PNSA 2DJFB 4REZA 1AU4A 3D6SA 2E00A 4N4ZA 7PCKA 1KXRA 2XU1A 4BOSA 1SP4B 2OP3A 3V6EA 3KKUA 4CDEB 3BCNA 6PADA 3S3QA 4YYUA 3PSEA 1QOLA 4MSXA 2XU4A 4BOQA 2HWKA 2FO5A 4I07A 3WXEA 4PP2E 3W30A 3PNRA 4OELA 2C0YA 4WURA 4G54A 4BS5A 3TMPA 2R9OA 1Y08A 1PPPA 1F29A 2DC8A 2AUZA 3K9MA 1U9QX 3PBHA 2AU1A 3MORA 1VSNA 1AU2A 4CDFB 3B79A 4RF1A 1SNKA 3H8CA 2R9NA 3TRKA 3ERVA 3IEJA 4ZUXU 2YJ9A 4KLBA 4AXLA 3IHPA 1EWOA 1ME4A 1ME3A 4FJCA 1CTEA 3N3GA 5EGWA 3MHHA 2XU5A 1GMYA 3IV2A 3CH2X 1MEMA 2GFOA 5JZEA 2BDZA 2B1NA 1BP4A 2F7DA 4QRGA 3KW9A 4W5CA 2DC9A 9PAPA 4BOUA 2AIMA 2HD5A 1U9VA 4CDDB 2R9CA 1MEGA 1HUCB 3P5XA 4BS6A 5CVNB 2Z84A 3BWKA 3HD3A 4XZXA 3RVVA 1AYUA 4FK5A 1YZBA 4X6JA 2BDLA 1M6DA 3MJ5A 4PADA 2DCCA 2VHFA 5EZSA 5A24A 1DF0A 2R6NA 1NB3A 1CQDA 2HXZA 3N3KA 4IUMA 3P5VA 3P5UA
chains in the Genus database with same CATH topology
1F2AA 1PPNA 2NQDB 1F2CA 1PPOA 2DCDA 3H8BA 2ARYA 1AU3A 2O6XA 4C5PA 1Q6KA 2JQGR 3PW3A 2G8EA 1CV8A 1POPA 4HWYA 1AU0A 1PIPA 4P6EA 3HHIA 1NQCA 4P6GA 2VHSA 3I06A 1NB5A 2IBIA 2DC7A 4YYVA 1U9XA 2PREA 3BC3A 4YYQA 4BGFA 3E1ZB 2YJBA 1PPDA 2Y6EA 3H89A 3N4CA 2P7UA 4DMYA 2AUXA 3WXFA 1PCIA 1KHPA 5EF4A 1ZCMA 2FUDA 8PCHA 1KFUL 4WA6A 1BY8A 2Y5BA 1GCBA 4BSQA 5CHVA 5FPWA 3HHAA 4XUIA 1TLOA 2G6DA 1CS8A 1NPZA 2NQIA 2ACTA 2YJ2A 2ATOA 1PBHA 1VJVA 1EWLA 2FRAA 4FIPA 1AECA 1CPJA 1GLOA 2XU3A 2FT2A 3IUTA 2E02A 1CSBB 1QXPA 1BQIA 1GECE 3CH3X 1CB5A 2R9MA 2FTDA 1CVZA 4CZWA 1AYVA 4QRVA 3BOWA 4W4UA 3S3RA 2HH5A 1MIRA 1IWDA 2H7JA 3H6SA 3DF0A 4DMXA 4N79A 2AYOA 2FQ9A 1DEUA 2P0RA 2AS8A 4YVAA 3KWZA 3OF8A 4I04A 3MHSA 2OULA 4OEMA 2DZYA 5J94A 2F1GA 2GHUA 1XKGA 1A6RA 4QH6A 3QT4A 2DCBA 4BQVA 3M99A 3K24A 1O0EA 2FYEA 4YYRA 1W4TA 2PADA 2G8JA 3GCBA 2NQAA 2R9FA 1JQPA 3C9EA 3I3TA 4QBBA 5F02A 2YJCA 3USVA 3O0UA 4MZOA 3P5WA 4X6HA 1PE6A 1TU6A 2PBHA 3BPMA 3K8UA 3LFYA 3CBJA 1YK8A 2FRQA 1U5IA 2OZ2A 2G7YA 1Y4HA 2E03A 2NQGA 3OISA 3HWNA 2CIOA 1FH0A 4W5BA 5JH3A 1AIMA 1QMYA 1YVBA 1YT7A 3F75A 1BGOA 1MS6A 2DJGB 1EF7A 4PI3A 1EWPA 1GX3A 1EWMA 1THEA 5PADA 4YV8A 3MTNA 4QRXA 3ZUAA 2B1MA 3RVWA 1U9WA 2AVWA 3RVXA 4YYWA 4AXMA 3OVXA 3D9WA 3KSEA 5K16A 3QSDA 1X9YA 1TL9A 4X6IA 3IOQA 3BPFA 3PDFA 1ICFA 3KX1A 4YYSA 1S4VA 2DZZA 2IPPB 3F5VA 1ZIVA 3O1GA 4N8WA 1PXVA 2YJ8A 4I05A 1STFE 4CDCB 2JQFR 1NLJA 4K7CA 1MHWA 1KHQA 3IMAA 1ITOA 1NL6A 1F2BA 1KFXL 5JA7A 4MZSA 2HHNA 2AYNA 1MDWA 2P86A 3QJ3A 3KWBX 3U8EA 2CB5A 2WBFX 4NV8A 3LXSA 4BPVA 3NHEA 5CVMA 4NV7A 5CVOB 1PADA 4Q8GA 3KFQA 1ATKA 1K3BB 4XR7A 5CHTA 3LTWA 1YALA 1CJLA 2VFBA 4Q8HA 3CBKA 3AI8A 3OVZA 1QDQA 2DCAA 3TNXA 3OF9A 3H7DA 3V6CA 1AYWA 2DC6A 4PP1A 3WXGA 2BSZA 2E01A 1YK7A 4RY2A 2PNSA 2DJFB 1AU4A 3D6SA 2E00A 4N4ZA 7PCKA 1KXRA 2XU1A 1SP4B 2OP3A 3V6EA 3KKUA 4CDEB 3BCNA 6PADA 3S3QA 4YYUA 1QOLA 4MSXA 4GUZA 2XU4A 2FO5A 4I07A 3WXEA 4PP2E 1E2TA 3PNRA 4OELA 2C0YA 4G54A 4BS5A 2R9OA 1Y08A 1PPPA 2VFCA 1F29A 2DC8A 2AUZA 3K9MA 1U9QX 3PBHA 2AU1A 3MORA 1VSNA 1AU2A 4B55A 4CDFB 3B79A 1SNKA 3H8CA 2R9NA 3ERVA 3IEJA 4ZUXU 2YJ9A 4KLBA 4AXLA 1W6FA 3IHPA 1EWOA 1ME4A 1ME3A 4FJCA 1CTEA 3N3GA 5EGWA 3MHHA 2XU5A 1GMYA 3IV2A 3CH2X 1MEMA 2GFOA 2BDZA 2B1NA 1BP4A 2F7DA 4QRGA 3KW9A 4W5CA 2DC9A 9PAPA 2AIMA 2HD5A 1W5RA 1U9VA 4CDDB 2R9CA 1MEGA 1HUCB 3P5XA 4BS6A 5CVNB 3BWKA 3HD3A 3RVVA 1AYUA 4FK5A 4X6JA 2BDLA 1M6DA 4PADA 2DCCA 2VHFA 5A24A 1DF0A 2R6NA 1NB3A 1CQDA 2HXZA 3N3KA 3P5VA 3P5UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F2A A;  1PPN A;  2NQD B;  1F2C A;  1PPO A;  2DCD A;  3H8B A;  2ARY A;  1AU3 A;  2O6X A;  1Q6K A;  2JQG R;  3PW3 A;  2G8E A;  1CV8 A;  1POP A;  4HWY A;  1AU0 A;  1PIP A;  4P6E A;  3HHI A;  1NQC A;  4P6G A;  2VHS A;  3I06 A;  1NB5 A;  2IBI A;  2DC7 A;  4YYV A;  1U9X A;  2PRE A;  3BC3 A;  4YYQ A;  3E1Z B;  2YJB A;  1PPD A;  2Y6E A;  3H89 A;  3N4C A;  2P7U A;  4DMY A;  2AUX A;  3WXF A;  1PCI A;  1KHP A;  5EF4 A;  1ZCM A;  2FUD A;  8PCH A;  1KFU L;  4WA6 A;  1BY8 A;  2Y5B A;  1GCB A;  4BSQ A;  5CHV A;  5FPW A;  3HHA A;  4XUI A;  1TLO A;  2G6D A;  1CS8 A;  1NPZ A;  2NQI A;  2ACT A;  2YJ2 A;  2ATO A;  1PBH A;  1VJV A;  1EWL A;  2FRA A;  4FIP A;  1AEC A;  1CPJ A;  1GLO A;  2XU3 A;  2FT2 A;  3IUT A;  2E02 A;  1CSB B;  1QXP A;  1BQI A;  1GEC E;  3CH3 X;  1CB5 A;  2R9M A;  2FTD A;  1CVZ A;  4CZW A;  1AYV A;  4QRV A;  3BOW A;  4W4U A;  3S3R A;  2HH5 A;  1MIR A;  1IWD A;  2H7J A;  3H6S A;  3DF0 A;  4DMX A;  4N79 A;  2AYO A;  2FQ9 A;  1DEU A;  2P0R A;  2AS8 A;  4YVA A;  3KWZ A;  3OF8 A;  4I04 A;  3MHS A;  2OUL A;  4OEM A;  2DZY A;  5J94 A;  2F1G A;  2GHU A;  1XKG A;  1A6R A;  4QH6 A;  3QT4 A;  2DCB A;  4BQV A;  3M99 A;  3K24 A;  1O0E A;  2FYE A;  4YYR A;  2PAD A;  2G8J A;  3GCB A;  2NQA A;  2R9F A;  1JQP A;  3C9E A;  3I3T A;  4QBB A;  5F02 A;  2YJC A;  3USV A;  3O0U A;  4MZO A;  3P5W A;  4X6H A;  1PE6 A;  1TU6 A;  2PBH A;  3BPM A;  3K8U A;  3LFY A;  3CBJ A;  1YK8 A;  2FRQ A;  1U5I A;  2OZ2 A;  2G7Y A;  1Y4H A;  2E03 A;  2NQG A;  3OIS A;  3HWN A;  2CIO A;  1FH0 A;  4W5B A;  5JH3 A;  1AIM A;  1QMY A;  1YVB A;  1YT7 A;  3F75 A;  1BGO A;  1MS6 A;  2DJG B;  1EF7 A;  4PI3 A;  1EWP A;  1EWM A;  1THE A;  5PAD A;  4YV8 A;  3MTN A;  4QRX A;  3ZUA A;  2B1M A;  3RVW A;  1U9W A;  2AVW A;  3RVX A;  4YYW A;  4AXM A;  3OVX A;  3KSE A;  5K16 A;  3QSD A;  1X9Y A;  1TL9 A;  4X6I A;  3IOQ A;  3BPF A;  3PDF A;  1ICF A;  3KX1 A;  4YYS A;  1S4V A;  2DZZ A;  2IPP B;  3F5V A;  1ZIV A;  3O1G A;  4N8W A;  1PXV A;  2YJ8 A;  4I05 A;  1STF E;  4CDC B;  2JQF R;  1NLJ A;  4K7C A;  1MHW A;  1KHQ A;  3IMA A;  1ITO A;  1NL6 A;  1F2B A;  1KFX L;  5JA7 A;  4MZS A;  2HHN A;  2AYN A;  1MDW A;  2P86 A;  3QJ3 A;  3KWB X;  3U8E A;  2CB5 A;  2WBF X;  3LXS A;  4BPV A;  3NHE A;  5CVM A;  5CVO B;  1PAD A;  4Q8G A;  3KFQ A;  1ATK A;  1K3B B;  4XR7 A;  5CHT A;  1YAL A;  1CJL A;  4Q8H A;  3CBK A;  3AI8 A;  3OVZ A;  1QDQ A;  2DCA A;  3TNX A;  3OF9 A;  3H7D A;  3V6C A;  1AYW A;  2DC6 A;  4PP1 A;  3WXG A;  2E01 A;  1YK7 A;  4RY2 A;  2PNS A;  2DJF B;  1AU4 A;  3D6S A;  2E00 A;  4N4Z A;  7PCK A;  1KXR A;  2XU1 A;  1SP4 B;  2OP3 A;  3V6E A;  3KKU A;  4CDE B;  3BCN A;  6PAD A;  3S3Q A;  4YYU A;  1QOL A;  4MSX A;  2XU4 A;  2FO5 A;  4I07 A;  3WXE A;  4PP2 E;  3PNR A;  4OEL A;  2C0Y A;  4G54 A;  4BS5 A;  2R9O A;  1Y08 A;  1PPP A;  1F29 A;  2DC8 A;  2AUZ A;  3K9M A;  1U9Q X;  3PBH A;  2AU1 A;  3MOR A;  1VSN A;  1AU2 A;  4CDF B;  3B79 A;  1SNK A;  3H8C A;  2R9N A;  3ERV A;  3IEJ A;  4ZUX U;  2YJ9 A;  4KLB A;  4AXL A;  3IHP A;  1EWO A;  1ME4 A;  1ME3 A;  4FJC A;  1CTE A;  3N3G A;  5EGW A;  3MHH A;  2XU5 A;  1GMY A;  3IV2 A;  3CH2 X;  1MEM A;  2GFO A;  2BDZ A;  2B1N A;  1BP4 A;  2F7D A;  4QRG A;  3KW9 A;  4W5C A;  2DC9 A;  9PAP A;  2AIM A;  2HD5 A;  1U9V A;  4CDD B;  2R9C A;  1MEG A;  1HUC B;  3P5X A;  4BS6 A;  5CVN B;  3BWK A;  3HD3 A;  3RVV A;  1AYU A;  4FK5 A;  4X6J A;  2BDL A;  1M6D A;  4PAD A;  2DCC A;  2VHF A;  5A24 A;  1DF0 A;  2R6N A;  1NB3 A;  1CQD A;  2HXZ A;  3N3K A;  3P5V A;  3P5U A; 
#chains in the Genus database with same CATH topology
 3PHX A;  1F2A A;  1PPN A;  2NQD B;  1F2C A;  1PPO A;  2DCD A;  3H8B A;  2ARY A;  1AU3 A;  2DOS A;  2O6X A;  1Q6K A;  3ZNH A;  2JQG R;  3PW3 A;  4PT5 A;  5EZQ A;  3BB7 A;  2G8E A;  1CV8 A;  1POP A;  3C0R A;  4HWY A;  4RNA A;  1AU0 A;  1PIP A;  4P6E A;  3HHI A;  1NQC A;  4P6G A;  2VHS A;  3I06 A;  1NB5 A;  2IBI A;  4OW0 A;  2DC7 A;  4YYV A;  1U9X A;  2PRE A;  3BC3 A;  4RKX A;  4YYQ A;  3E1Z B;  2YJB A;  1PPD A;  2Y6E A;  3H89 A;  3N4C A;  2P7U A;  4DMY A;  2AUX A;  3BY4 A;  3WXF A;  1PCI A;  1KHP A;  5EF4 A;  1ZCM A;  2FUD A;  8PCH A;  1KFU L;  4WA6 A;  1BY8 A;  2Y5B A;  1GCB A;  4BSQ A;  4MI7 A;  5CHV A;  5FPW A;  3HHA A;  4XUI A;  1TLO A;  2AGA A;  4D8B A;  2G6D A;  1CS8 A;  1NPZ A;  2NQI A;  2ACT A;  2YJ2 A;  2JRI A;  4HXD B;  2ATO A;  1PBH A;  1VJV A;  1EWL A;  2FRA A;  4FIP A;  1AEC A;  1CPJ A;  3PT2 A;  2JTC A;  4A5U A;  1GLO A;  2XU3 A;  2FT2 A;  3IUT A;  2BTW A;  2E02 A;  1CSB B;  1QXP A;  3PHU A;  1DKI A;  1BQI A;  1GEC E;  3CH3 X;  1CB5 A;  2R9M A;  2FTD A;  3E9S A;  1CVZ A;  4CZW A;  1AYV A;  4QRV A;  3BOW A;  4W4U A;  3S3R A;  2HH5 A;  1MIR A;  1IWD A;  2H7J A;  3H6S A;  3DF0 A;  4DMX A;  4N79 A;  2AYO A;  3MP2 A;  4OVZ A;  2FQ9 A;  1DEU A;  2P0R A;  2AS8 A;  4YVA A;  3KWZ A;  3OF8 A;  4I04 A;  3MHS A;  2OUL A;  4OEM A;  2DZY A;  5J94 A;  3O65 A;  2F1G A;  3W31 A;  2GHU A;  1XKG A;  1A6R A;  4QH6 A;  3QT4 A;  2DCB A;  4BQV A;  3M99 A;  4IP3 A;  3K24 A;  1O0E A;  2FYE A;  4YYR A;  2PAD A;  2G8J A;  3GCB A;  2NQA A;  3PRM A;  2R9F A;  1JQP A;  3C9E A;  4RF0 A;  3I3T A;  4QBB A;  5F02 A;  2UZJ A;  2YJC A;  3USV A;  3IFU A;  3O0U A;  4MZO A;  3P5W A;  3BBA A;  4X6H A;  1PE6 A;  1TU6 A;  2PBH A;  3MTV A;  3BPM A;  3K8U A;  3LFY A;  3CBJ A;  1YK8 A;  2FRQ A;  1U5I A;  2BU3 A;  2G7Y A;  1Y4H A;  2OZ2 A;  2E03 A;  2NQG A;  3OIS A;  2J7Q C;  3HWN A;  4D8I A;  2CIO A;  1FH0 A;  4W5B A;  5JH3 A;  1AIM A;  4OVZ B;  1QMY A;  1YVB A;  1YT7 A;  4M0W A;  3F75 A;  1BGO A;  1MS6 A;  2DJG B;  2FE8 A;  1EF7 A;  4PI3 A;  1EWP A;  1EWM A;  1THE A;  5PAD A;  4YV8 A;  3MTN A;  4QRX A;  3ZUA A;  2B1M A;  4ZTB A;  1U9W A;  3RVW A;  2AVW A;  3RVX A;  4YYW A;  4AXM A;  3OVX A;  3KSE A;  5K16 A;  3QSD A;  1X9Y A;  1TL9 A;  4X6I A;  3IOQ A;  4R3D A;  3BPF A;  3PDF A;  1ICF A;  2J7Q A;  3KX1 A;  4YYS A;  1S4V A;  2DZZ A;  2IPP B;  3F5V A;  4BOZ A;  1ZIV A;  3O1G A;  4N8W A;  1PXV A;  2YJ8 A;  4I05 A;  1STF E;  4CDC B;  3RNV A;  2JQF R;  1NLJ A;  4K7C A;  1MHW A;  1KHQ A;  3IMA A;  1ITO A;  1NL6 A;  1F2B A;  1KFX L;  5JA7 A;  4MZS A;  2HHN A;  2AYN A;  1MDW A;  2P86 A;  3QJ3 A;  3KWB X;  3U8E A;  2CB5 A;  2BTW B;  2WBF X;  3LXS A;  4BPV A;  3NHE A;  5CVM A;  5CVO B;  5E6J A;  1PAD A;  4Q8G A;  3KFQ A;  1ATK A;  1PVJ A;  1K3B B;  4XR7 A;  5CHT A;  3PHW A;  3OQC A;  1UKF A;  1YAL A;  1CJL A;  4BOP A;  4Q8H A;  3CBK A;  3AI8 A;  3OVZ A;  3B21 A;  3PRP A;  1QDQ A;  2DCA A;  4P16 A;  4D8E A;  3TNX A;  4MM3 B;  4GUA A;  5KO3 A;  3OF9 A;  3H7D A;  3V6C A;  1AYW A;  2DC6 A;  4PP1 A;  3WXG A;  2E01 A;  1YK7 A;  4RY2 A;  2PNS A;  2DJF B;  4REZ A;  1AU4 A;  3D6S A;  2E00 A;  4N4Z A;  7PCK A;  1KXR A;  2XU1 A;  4BOS A;  1SP4 B;  2OP3 A;  3V6E A;  3KKU A;  4CDE B;  3BCN A;  6PAD A;  3S3Q A;  4YYU A;  3PSE A;  1QOL A;  4MSX A;  2XU4 A;  4BOQ A;  2HWK A;  2FO5 A;  4I07 A;  3WXE A;  4PP2 E;  3W30 A;  3PNR A;  4OEL A;  2C0Y A;  4WUR A;  4G54 A;  4BS5 A;  3TMP A;  2R9O A;  1Y08 A;  1PPP A;  1F29 A;  2DC8 A;  2AUZ A;  3K9M A;  1U9Q X;  3PBH A;  2AU1 A;  3MOR A;  1VSN A;  1AU2 A;  4CDF B;  3B79 A;  4RF1 A;  1SNK A;  3H8C A;  2R9N A;  3TRK A;  3ERV A;  3IEJ A;  4ZUX U;  2YJ9 A;  4KLB A;  4AXL A;  3IHP A;  1EWO A;  1ME4 A;  1ME3 A;  4FJC A;  1CTE A;  3N3G A;  5EGW A;  3MHH A;  2XU5 A;  1GMY A;  3IV2 A;  3CH2 X;  1MEM A;  2GFO A;  5JZE A;  2BDZ A;  2B1N A;  1BP4 A;  2F7D A;  4QRG A;  3KW9 A;  4W5C A;  2DC9 A;  9PAP A;  4BOU A;  2AIM A;  2HD5 A;  1U9V A;  4CDD B;  2R9C A;  1MEG A;  1HUC B;  3P5X A;  4BS6 A;  5CVN B;  2Z84 A;  3BWK A;  3HD3 A;  4XZX A;  3RVV A;  1AYU A;  4FK5 A;  1YZB A;  4X6J A;  2BDL A;  1M6D A;  3MJ5 A;  4PAD A;  2DCC A;  2VHF A;  5EZS A;  5A24 A;  1DF0 A;  2R6N A;  1NB3 A;  1CQD A;  2HXZ A;  3N3K A;  4IUM A;  3P5V A;  3P5U A; 
#chains in the Genus database with same CATH homology
 1F2A A;  1PPN A;  2NQD B;  1F2C A;  1PPO A;  2DCD A;  3H8B A;  2ARY A;  1AU3 A;  2O6X A;  4C5P A;  1Q6K A;  2JQG R;  3PW3 A;  2G8E A;  1CV8 A;  1POP A;  4HWY A;  1AU0 A;  1PIP A;  4P6E A;  3HHI A;  1NQC A;  4P6G A;  2VHS A;  3I06 A;  1NB5 A;  2IBI A;  2DC7 A;  4YYV A;  1U9X A;  2PRE A;  3BC3 A;  4YYQ A;  4BGF A;  3E1Z B;  2YJB A;  1PPD A;  2Y6E A;  3H89 A;  3N4C A;  2P7U A;  4DMY A;  2AUX A;  3WXF A;  1PCI A;  1KHP A;  5EF4 A;  1ZCM A;  2FUD A;  8PCH A;  1KFU L;  4WA6 A;  1BY8 A;  2Y5B A;  1GCB A;  4BSQ A;  5CHV A;  5FPW A;  3HHA A;  4XUI A;  1TLO A;  2G6D A;  1CS8 A;  1NPZ A;  2NQI A;  2ACT A;  2YJ2 A;  2ATO A;  1PBH A;  1VJV A;  1EWL A;  2FRA A;  4FIP A;  1AEC A;  1CPJ A;  1GLO A;  2XU3 A;  2FT2 A;  3IUT A;  2E02 A;  1CSB B;  1QXP A;  1BQI A;  1GEC E;  3CH3 X;  1CB5 A;  2R9M A;  2FTD A;  1CVZ A;  4CZW A;  1AYV A;  4QRV A;  3BOW A;  4W4U A;  3S3R A;  2HH5 A;  1MIR A;  1IWD A;  2H7J A;  3H6S A;  3DF0 A;  4DMX A;  4N79 A;  2AYO A;  2FQ9 A;  1DEU A;  2P0R A;  2AS8 A;  4YVA A;  3KWZ A;  3OF8 A;  4I04 A;  3MHS A;  2OUL A;  4OEM A;  2DZY A;  5J94 A;  2F1G A;  2GHU A;  1XKG A;  1A6R A;  4QH6 A;  3QT4 A;  2DCB A;  4BQV A;  3M99 A;  3K24 A;  1O0E A;  2FYE A;  4YYR A;  1W4T A;  2PAD A;  2G8J A;  3GCB A;  2NQA A;  2R9F A;  1JQP A;  3C9E A;  3I3T A;  4QBB A;  5F02 A;  2YJC A;  3USV A;  3O0U A;  4MZO A;  3P5W A;  4X6H A;  1PE6 A;  1TU6 A;  2PBH A;  3BPM A;  3K8U A;  3LFY A;  3CBJ A;  1YK8 A;  2FRQ A;  1U5I A;  2OZ2 A;  2G7Y A;  1Y4H A;  2E03 A;  2NQG A;  3OIS A;  3HWN A;  2CIO A;  1FH0 A;  4W5B A;  5JH3 A;  1AIM A;  1QMY A;  1YVB A;  1YT7 A;  3F75 A;  1BGO A;  1MS6 A;  2DJG B;  1EF7 A;  4PI3 A;  1EWP A;  1GX3 A;  1EWM A;  1THE A;  5PAD A;  4YV8 A;  3MTN A;  4QRX A;  3ZUA A;  2B1M A;  3RVW A;  1U9W A;  2AVW A;  3RVX A;  4YYW A;  4AXM A;  3OVX A;  3D9W A;  3KSE A;  5K16 A;  3QSD A;  1X9Y A;  1TL9 A;  4X6I A;  3IOQ A;  3BPF A;  3PDF A;  1ICF A;  3KX1 A;  4YYS A;  1S4V A;  2DZZ A;  2IPP B;  3F5V A;  1ZIV A;  3O1G A;  4N8W A;  1PXV A;  2YJ8 A;  4I05 A;  1STF E;  4CDC B;  2JQF R;  1NLJ A;  4K7C A;  1MHW A;  1KHQ A;  3IMA A;  1ITO A;  1NL6 A;  1F2B A;  1KFX L;  5JA7 A;  4MZS A;  2HHN A;  2AYN A;  1MDW A;  2P86 A;  3QJ3 A;  3KWB X;  3U8E A;  2CB5 A;  2WBF X;  4NV8 A;  3LXS A;  4BPV A;  3NHE A;  5CVM A;  4NV7 A;  5CVO B;  1PAD A;  4Q8G A;  3KFQ A;  1ATK A;  1K3B B;  4XR7 A;  5CHT A;  3LTW A;  1YAL A;  1CJL A;  2VFB A;  4Q8H A;  3CBK A;  3AI8 A;  3OVZ A;  1QDQ A;  2DCA A;  3TNX A;  3OF9 A;  3H7D A;  3V6C A;  1AYW A;  2DC6 A;  4PP1 A;  3WXG A;  2BSZ A;  2E01 A;  1YK7 A;  4RY2 A;  2PNS A;  2DJF B;  1AU4 A;  3D6S A;  2E00 A;  4N4Z A;  7PCK A;  1KXR A;  2XU1 A;  1SP4 B;  2OP3 A;  3V6E A;  3KKU A;  4CDE B;  3BCN A;  6PAD A;  3S3Q A;  4YYU A;  1QOL A;  4MSX A;  4GUZ A;  2XU4 A;  2FO5 A;  4I07 A;  3WXE A;  4PP2 E;  1E2T A;  3PNR A;  4OEL A;  2C0Y A;  4G54 A;  4BS5 A;  2R9O A;  1Y08 A;  1PPP A;  2VFC A;  1F29 A;  2DC8 A;  2AUZ A;  3K9M A;  1U9Q X;  3PBH A;  2AU1 A;  3MOR A;  1VSN A;  1AU2 A;  4B55 A;  4CDF B;  3B79 A;  1SNK A;  3H8C A;  2R9N A;  3ERV A;  3IEJ A;  4ZUX U;  2YJ9 A;  4KLB A;  4AXL A;  1W6F A;  3IHP A;  1EWO A;  1ME4 A;  1ME3 A;  4FJC A;  1CTE A;  3N3G A;  5EGW A;  3MHH A;  2XU5 A;  1GMY A;  3IV2 A;  3CH2 X;  1MEM A;  2GFO A;  2BDZ A;  2B1N A;  1BP4 A;  2F7D A;  4QRG A;  3KW9 A;  4W5C A;  2DC9 A;  9PAP A;  2AIM A;  2HD5 A;  1W5R A;  1U9V A;  4CDD B;  2R9C A;  1MEG A;  1HUC B;  3P5X A;  4BS6 A;  5CVN B;  3BWK A;  3HD3 A;  3RVV A;  1AYU A;  4FK5 A;  4X6J A;  2BDL A;  1M6D A;  4PAD A;  2DCC A;  2VHF A;  5A24 A;  1DF0 A;  2R6N A;  1NB3 A;  1CQD A;  2HXZ A;  3N3K A;  3P5V A;  3P5U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...