4DMYA

Cathepsin k inhibitor
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
215
structure length
215
Chain Sequence
APDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Cathepsin K
publication title (1R,2R)-N-(1-cyanocyclopropyl)-2-(6-methoxy-1,3,4,5-tetrahydropyrido[4,3-b]indole-2-carbonyl)cyclohexanecarboxamide (AZD4996): a potent and highly selective cathepsin K inhibitor for the treatment of osteoarthritis.
pubmed doi rcsb
source organism Homo sapiens
total genus 61
structure length 215
sequence length 215
chains with identical sequence B
ec nomenclature ec 3.4.22.38: Cathepsin K.
pdb deposition date 2012-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 4dmyA00
1YK7A 3TNXA 2NQAA 3QJ3A 3OF9A 1NB5A 1TU6A 1NB3A 2YJCA 1DEUA 1CQDA 1GECE 4BPVA 4FJCA 3V6CA 2AS8A 3K9MA 2AVWA 3MORA 4BS5A 4QRGA 2NQGA 1Y08A 2PADA 1FH0A 2FQ9A 3O1GA 4CDEB 2YJ9A 2AYNA 2G8JA 3LXSA 1YT7A 1EWPA 2G8EA 3KW9A 2AYOA 3I06A 3H8BA 3QSDA 3OVXA 2HXZA 3RVXA 1POPA 1GMYA 1MS6A 2JQGR 4P6GA 2YJ8A 1AIMA 1MHWA 5EF4A 4I07A 3PNRA 5K16A 5FPWA 2DZZA 2XU5A 4QH6A 4CZWA 4QRXA 2FO5A 1U9VA 1MIRA 1NL6A 3IOQA 3WXFA 2CIOA 3S3RA 1JQPA 1ZIVA 2DJFB 4QRVA 4BSQA 2ATOA 3BC3A 1A6RA 1AYUA 3H6SA 5JH3A 2FRQA 1SNKA 2DCDA 2AU1A 1AYVA 1EWMA 1YALA 2DC7A 2R6NA 3PW3A 1TLOA 4YVAA 1AU2A 2DCBA 2JQFR 3CBKA 4W5CA 3E1ZB 4CDFB 1PIPA 4OELA 1S4VA 1BQIA 4MZOA 2AUZA 3HWNA 3QT4A 4ZUXU 2OULA 1ZCMA 5J94A 3IUTA 3P5XA 1NLJA 4X6HA 3RVWA 4PI3A 2VHFA 3I3TA 4N79A 1O0EA 4P6EA 2E01A 5CHVA 1BY8A 3N4CA 3KSEA 1F29A 1NQCA 5CVMA 5PADA 2NQDB 3BOWA 3F5VA 2PBHA 2IBIA 2VHSA 3ZUAA 1EWLA 1F2AA 1CS8A 1QDQA 2DC9A 5CVNB 2G7YA 4DMXA 3P5WA 3MHSA 1CTEA 1QOLA 3WXGA 1M6DA 1STFE 2OZ2A 5CVOB 4YYQA 4XUIA 3HD3A 2HH5A 1AU4A 4PP1A 2E02A 3U8EA 3K24A 2FTDA 1K3BB 3HHIA 1IWDA 4MSXA 3IMAA 4N4ZA 5F02A 1GLOA 3IHPA 3WXEA 1Q6KA 1HUCB 4AXMA 3MTNA 4W5BA 2AUXA 2FUDA 4RY2A 1YK8A 2IPPB 1NPZA 2G6DA 3P5UA 1PPNA 2HHNA 2FT2A 3OISA 3O0UA 5A24A 3KFQA 2B1MA 4YYRA 1EF7A 4BQVA 3KWZA 4PADA 1AECA 4Q8GA 4CDCB 2BDLA 3BWKA 2PREA 1PE6A 2P0RA 4I05A 2WBFX 3CH3X 3H7DA 9PAPA 1ME3A 1SP4B 1KHPA 1MEGA 3HHAA 4KLBA 1ITOA 3ERVA 2R9OA 2B1NA 2BDZA 4FIPA 3KKUA 3PDFA 3GCBA 3H8CA 1F2BA 1CPJA 3IV2A 4YYWA 1EWOA 8PCHA 4K7CA 1CVZA 1Y4HA 1MEMA 1KFUL 5JA7A 2Y6EA 4YYSA 2GFOA 2FRAA 3KWBX 2E00A 3D6SA 4XR7A 4AXLA 1U9XA 3B79A 3MHHA 2P86A 4OEMA 1AU3A 3KX1A 2GHUA 2DJGB 1QMYA 1QXPA 2DC8A 2P7UA 4QBBA 3P5VA 1U9WA 7PCKA 2F1GA 3DF0A 1YVBA 3CBJA 1MDWA 4YV8A 4PP2E 1BP4A 2H7JA 1ME4A 1XKGA 2YJBA 1PPDA 3RVVA 1AU0A 4FK5A 1AYWA 1GCBA 1U5IA 1ATKA 1X9YA 2R9CA 1PCIA 1CB5A 2FYEA 1CV8A 4CDDB 5CHTA 2PNSA 4W4UA 2AIMA 3USVA 2ARYA 2O6XA 1ICFA 3S3QA 3C9EA 3BPMA 3OF8A 1PADA 2E03A 1PXVA 1KHQA 1VJVA 2R9MA 1TL9A 2R9FA 3AI8A 3LFYA 2ACTA 1KFXL 1PPOA 4MZSA 4I04A 1U9QX 2XU3A 4X6JA 4HWYA 4WA6A 2DCAA 4X6IA 2HD5A 3BCNA 3K8UA 3BPFA 1CSBB 2C0YA 3V6EA 1DF0A 3H89A 2CB5A 4DMYA 3PBHA 2XU4A 4BS6A 2R9NA 4YYUA 3F75A 4Q8HA 3IEJA 3CH2X 2F7DA 2OP3A 4YYVA 3N3GA 2DC6A 2NQIA 2XU1A 1VSNA 3NHEA 3M99A 1PBHA 1KXRA 4G54A 6PADA 1F2CA 1BGOA 2YJ2A 1PPPA 1THEA 3OVZA 1CJLA 4N8WA 5EGWA 2Y5BA 2DZYA 2DCCA 3N3KA
chains in the Genus database with same CATH superfamily
1YK7A 3TNXA 2NQAA 3QJ3A 3OF9A 3PHUA 1NB5A 1TU6A 1NB3A 2YJCA 1DEUA 1CQDA 1GECE 4BPVA 4FJCA 3RNVA 3V6CA 2AS8A 3K9MA 4RKXA 2AVWA 3MORA 4BS5A 4QRGA 2NQGA 1Y08A 2PADA 1FH0A 2FQ9A 3O1GA 4MI7A 4CDEB 2YJ9A 2AYNA 2AGAA 2G8JA 2J7QA 3LXSA 1YT7A 1EWPA 2G8EA 3KW9A 2AYOA 3I06A 3H8BA 4RF1A 3QSDA 3OVXA 2HXZA 3RVXA 5KO3A 1POPA 1GMYA 1MS6A 2JQGR 1PVJA 4P6GA 2YJ8A 1AIMA 1MHWA 3MP2A 5EF4A 4I07A 3PNRA 5K16A 5FPWA 2DZZA 2XU5A 4ZTBA 4QH6A 4CZWA 4QRXA 4D8IA 2FO5A 1U9VA 1MIRA 1NL6A 3IOQA 3TMPA 3WXFA 2CIOA 3S3RA 1JQPA 3OQCA 1ZIVA 2DJFB 4QRVA 4BSQA 2ATOA 3BC3A 1A6RA 1AYUA 3H6SA 3ZNHA 5JH3A 2FRQA 1SNKA 2DCDA 2AU1A 1AYVA 1EWMA 1YALA 2DC7A 2R6NA 3PW3A 1TLOA 4YVAA 1AU2A 2DCBA 2JQFR 3CBKA 4W5CA 3E1ZB 4CDFB 1PIPA 4OELA 5JZEA 1S4VA 1BQIA 4MZOA 2AUZA 2BTWA 3HWNA 3QT4A 4ZUXU 4WURA 2OULA 1ZCMA 5J94A 3IUTA 3P5XA 1NLJA 4X6HA 3RVWA 4PI3A 2VHFA 3I3TA 4N79A 3PSEA 1O0EA 4BOUA 4P6EA 4RF0A 2E01A 3C0RA 5CHVA 1BY8A 3N4CA 3KSEA 3O65A 1F29A 1NQCA 5CVMA 5PADA 1DKIA 2NQDB 3BOWA 3F5VA 2PBHA 2IBIA 2VHSA 3ZUAA 4GUAA 1EWLA 3PHXA 2BTWB 1F2AA 1CS8A 1QDQA 2DC9A 5CVNB 2G7YA 4DMXA 3P5WA 3MHSA 1CTEA 1QOLA 4HXDB 3WXGA 1M6DA 1STFE 2OZ2A 5CVOB 4YYQA 4XUIA 3HD3A 2HH5A 1AU4A 4PP1A 2E02A 3U8EA 3K24A 2FTDA 1K3BB 4P16A 3HHIA 4REZA 1IWDA 4MSXA 3IMAA 4N4ZA 5F02A 1GLOA 3IHPA 3WXEA 1Q6KA 1HUCB 4AXMA 3MTNA 4W5BA 4IP3A 4MM3B 2FE8A 3TRKA 2AUXA 2FUDA 3W31A 4RY2A 1YK8A 2IPPB 2DOSA 1NPZA 2G6DA 3P5UA 3MTVA 1PPNA 2HHNA 2FT2A 3OISA 3O0UA 5E6JA 5A24A 3KFQA 1YZBA 2B1MA 4YYRA 4IUMA 1EF7A 4BQVA 3KWZA 4PADA 1AECA 4Q8GA 4CDCB 4M0WA 1UKFA 2BDLA 3BWKA 2PREA 1PE6A 2P0RA 4I05A 2WBFX 2J7QC 3CH3X 3H7DA 9PAPA 1ME3A 1SP4B 1KHPA 1MEGA 3HHAA 2Z84A 4KLBA 1ITOA 3ERVA 2R9OA 2B1NA 2BDZA 4FIPA 3KKUA 3PDFA 3GCBA 4BOQA 3H8CA 1F2BA 1CPJA 3IV2A 4YYWA 1EWOA 8PCHA 4K7CA 1CVZA 1Y4HA 1MEMA 1KFUL 2BU3A 5JA7A 4D8BA 2Y6EA 3IFUA 4YYSA 2GFOA 3PHWA 2FRAA 3KWBX 2E00A 3PRPA 4PT5A 4BOPA 3D6SA 4XR7A 2JRIA 4AXLA 1U9XA 4A5UA 3BB7A 4BOZA 3B79A 5EZSA 3MHHA 2JTCA 2P86A 4OEMA 1AU3A 3KX1A 2GHUA 2DJGB 1QMYA 1QXPA 2DC8A 3PT2A 2P7UA 4R3DA 4QBBA 4XZXA 3P5VA 1U9WA 7PCKA 2F1GA 4OVZB 3MJ5A 3DF0A 1YVBA 3CBJA 1MDWA 3BBAA 2UZJA 4YV8A 4PP2E 1BP4A 2H7JA 1ME4A 1XKGA 2YJBA 1PPDA 3RVVA 1AU0A 4FK5A 1AYWA 1GCBA 1U5IA 1ATKA 1X9YA 2R9CA 4RNAA 1PCIA 1CB5A 2FYEA 1CV8A 4CDDB 3W30A 5CHTA 2PNSA 4W4UA 2AIMA 3USVA 4D8EA 2ARYA 2O6XA 1ICFA 3S3QA 3C9EA 3BPMA 3OF8A 1PADA 2E03A 1PXVA 3E9SA 1KHQA 1VJVA 2R9MA 1TL9A 2R9FA 3AI8A 3LFYA 2ACTA 1KFXL 1PPOA 4MZSA 4I04A 1U9QX 3B21A 2XU3A 4X6JA 4HWYA 4WA6A 2DCAA 4X6IA 2HD5A 3BCNA 3K8UA 3BPFA 1CSBB 2C0YA 3V6EA 1DF0A 3BY4A 3H89A 2CB5A 4DMYA 3PBHA 2XU4A 4BS6A 2R9NA 4YYUA 3F75A 4Q8HA 3IEJA 3CH2X 2F7DA 2OP3A 4YYVA 3N3GA 2DC6A 2NQIA 5EZQA 2XU1A 4OW0A 3PRMA 1VSNA 3NHEA 4OVZA 3M99A 1PBHA 1KXRA 4G54A 6PADA 1F2CA 1BGOA 2YJ2A 2HWKA 1PPPA 1THEA 3OVZA 1CJLA 4N8WA 5EGWA 2Y5BA 2DZYA 2DCCA 4BOSA 3N3KA
chains in the Genus database with same CATH topology
1YK7A 3TNXA 2NQAA 3QJ3A 3OF9A 1NB5A 1TU6A 1NB3A 2VFCA 2YJCA 1DEUA 1CQDA 1GECE 4BPVA 4FJCA 3V6CA 2AS8A 3K9MA 2AVWA 4B55A 3MORA 4BS5A 4QRGA 2NQGA 1Y08A 2PADA 1FH0A 2FQ9A 3O1GA 4CDEB 2YJ9A 2AYNA 2G8JA 3LXSA 1YT7A 1EWPA 2G8EA 3KW9A 2AYOA 3I06A 3H8BA 3QSDA 3OVXA 2HXZA 3RVXA 1POPA 1GMYA 1MS6A 2JQGR 4P6GA 2YJ8A 1AIMA 1MHWA 5EF4A 4I07A 3PNRA 5K16A 5FPWA 2DZZA 2XU5A 4QH6A 4CZWA 4QRXA 2FO5A 1U9VA 1MIRA 1NL6A 3IOQA 1W4TA 3WXFA 2CIOA 3S3RA 1JQPA 1ZIVA 2DJFB 4QRVA 4BSQA 2ATOA 3BC3A 1A6RA 1AYUA 3H6SA 5JH3A 2FRQA 1SNKA 2DCDA 2AU1A 1AYVA 1EWMA 1YALA 2DC7A 2R6NA 3PW3A 1TLOA 4YVAA 1AU2A 2DCBA 2JQFR 3CBKA 4W5CA 3E1ZB 4CDFB 1PIPA 4OELA 1S4VA 1BQIA 4MZOA 2AUZA 3HWNA 3QT4A 4ZUXU 2OULA 1ZCMA 5J94A 3IUTA 3P5XA 1NLJA 4X6HA 3RVWA 4PI3A 2VHFA 3I3TA 4N79A 1O0EA 4P6EA 2E01A 5CHVA 1BY8A 3N4CA 2VFBA 3KSEA 1F29A 1NQCA 5CVMA 5PADA 2NQDB 3BOWA 3F5VA 2PBHA 2IBIA 2VHSA 3LTWA 3ZUAA 1EWLA 1F2AA 1CS8A 1QDQA 2DC9A 5CVNB 2G7YA 4DMXA 3P5WA 3MHSA 1CTEA 1QOLA 3WXGA 1M6DA 1STFE 2OZ2A 5CVOB 4YYQA 4XUIA 3HD3A 2HH5A 1AU4A 4PP1A 2E02A 3U8EA 3K24A 2FTDA 1K3BB 3HHIA 1IWDA 4MSXA 3IMAA 4N4ZA 5F02A 1GLOA 3IHPA 3WXEA 1Q6KA 1HUCB 4AXMA 3MTNA 4W5BA 2AUXA 2FUDA 4RY2A 1YK8A 2IPPB 1NPZA 2G6DA 3P5UA 1PPNA 2HHNA 2FT2A 3OISA 3O0UA 5A24A 3KFQA 2B1MA 4YYRA 1EF7A 4BQVA 3KWZA 4PADA 1AECA 4Q8GA 4CDCB 2BDLA 3BWKA 2PREA 1PE6A 2P0RA 4I05A 2BSZA 2WBFX 3CH3X 3H7DA 9PAPA 1ME3A 1SP4B 1KHPA 1MEGA 3HHAA 4KLBA 1ITOA 3ERVA 2R9OA 2B1NA 2BDZA 4FIPA 3KKUA 3PDFA 3GCBA 3H8CA 1F2BA 1CPJA 3IV2A 4YYWA 1EWOA 8PCHA 4K7CA 1CVZA 1Y4HA 1MEMA 1KFUL 5JA7A 1E2TA 2Y6EA 4GUZA 4C5PA 4YYSA 2GFOA 2FRAA 3KWBX 2E00A 3D6SA 4XR7A 3D9WA 4AXLA 1U9XA 3B79A 3MHHA 2P86A 4OEMA 1AU3A 3KX1A 2GHUA 2DJGB 1W5RA 1QMYA 1QXPA 2DC8A 2P7UA 4QBBA 3P5VA 1U9WA 7PCKA 2F1GA 3DF0A 1YVBA 3CBJA 1MDWA 4YV8A 4PP2E 1BP4A 2H7JA 1ME4A 1XKGA 2YJBA 1PPDA 3RVVA 1AU0A 4FK5A 1AYWA 1GCBA 1U5IA 1ATKA 1X9YA 2R9CA 1PCIA 1CB5A 2FYEA 4NV7A 1CV8A 4CDDB 5CHTA 2PNSA 4W4UA 2AIMA 3USVA 2ARYA 2O6XA 1ICFA 3S3QA 3C9EA 3BPMA 3OF8A 1PADA 2E03A 1PXVA 1KHQA 1VJVA 2R9MA 4NV8A 1TL9A 2R9FA 3AI8A 3LFYA 2ACTA 1KFXL 1PPOA 4MZSA 4I04A 1U9QX 2XU3A 4X6JA 4HWYA 4WA6A 2DCAA 4X6IA 2HD5A 3BCNA 3K8UA 3BPFA 1CSBB 2C0YA 3V6EA 1DF0A 3H89A 2CB5A 4DMYA 3PBHA 2XU4A 4BS6A 2R9NA 4YYUA 3F75A 4Q8HA 3IEJA 3CH2X 2F7DA 2OP3A 4YYVA 3N3GA 2DC6A 2NQIA 2XU1A 1VSNA 3NHEA 3M99A 1GX3A 1PBHA 1KXRA 4G54A 6PADA 1F2CA 1BGOA 2YJ2A 1PPPA 1THEA 4BGFA 3OVZA 1CJLA 4N8WA 5EGWA 2Y5BA 2DZYA 2DCCA 1W6FA 3N3KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YK7 A;  3TNX A;  2NQA A;  3QJ3 A;  3OF9 A;  1NB5 A;  1TU6 A;  1NB3 A;  2YJC A;  1DEU A;  1CQD A;  1GEC E;  4BPV A;  4FJC A;  3V6C A;  2AS8 A;  3K9M A;  2AVW A;  3MOR A;  4BS5 A;  4QRG A;  2NQG A;  1Y08 A;  2PAD A;  1FH0 A;  2FQ9 A;  3O1G A;  4CDE B;  2YJ9 A;  2AYN A;  2G8J A;  3LXS A;  1YT7 A;  1EWP A;  2G8E A;  3KW9 A;  2AYO A;  3I06 A;  3H8B A;  3QSD A;  3OVX A;  2HXZ A;  3RVX A;  1POP A;  1GMY A;  1MS6 A;  2JQG R;  4P6G A;  2YJ8 A;  1AIM A;  1MHW A;  5EF4 A;  4I07 A;  3PNR A;  5K16 A;  5FPW A;  2DZZ A;  2XU5 A;  4QH6 A;  4CZW A;  4QRX A;  2FO5 A;  1U9V A;  1MIR A;  1NL6 A;  3IOQ A;  3WXF A;  2CIO A;  3S3R A;  1JQP A;  1ZIV A;  2DJF B;  4QRV A;  4BSQ A;  2ATO A;  3BC3 A;  1A6R A;  1AYU A;  3H6S A;  5JH3 A;  2FRQ A;  1SNK A;  2DCD A;  2AU1 A;  1AYV A;  1EWM A;  1YAL A;  2DC7 A;  2R6N A;  3PW3 A;  1TLO A;  4YVA A;  1AU2 A;  2DCB A;  2JQF R;  3CBK A;  4W5C A;  3E1Z B;  4CDF B;  1PIP A;  4OEL A;  1S4V A;  1BQI A;  4MZO A;  2AUZ A;  3HWN A;  3QT4 A;  4ZUX U;  2OUL A;  1ZCM A;  5J94 A;  3IUT A;  3P5X A;  1NLJ A;  4X6H A;  3RVW A;  4PI3 A;  2VHF A;  3I3T A;  4N79 A;  1O0E A;  4P6E A;  2E01 A;  5CHV A;  1BY8 A;  3N4C A;  3KSE A;  1F29 A;  1NQC A;  5CVM A;  5PAD A;  2NQD B;  3BOW A;  3F5V A;  2PBH A;  2IBI A;  2VHS A;  3ZUA A;  1EWL A;  1F2A A;  1CS8 A;  1QDQ A;  2DC9 A;  5CVN B;  2G7Y A;  4DMX A;  3P5W A;  3MHS A;  1CTE A;  1QOL A;  3WXG A;  1M6D A;  1STF E;  2OZ2 A;  5CVO B;  4YYQ A;  4XUI A;  3HD3 A;  2HH5 A;  1AU4 A;  4PP1 A;  2E02 A;  3U8E A;  3K24 A;  2FTD A;  1K3B B;  3HHI A;  1IWD A;  4MSX A;  3IMA A;  4N4Z A;  5F02 A;  1GLO A;  3IHP A;  3WXE A;  1Q6K A;  1HUC B;  4AXM A;  3MTN A;  4W5B A;  2AUX A;  2FUD A;  4RY2 A;  1YK8 A;  2IPP B;  1NPZ A;  2G6D A;  3P5U A;  1PPN A;  2HHN A;  2FT2 A;  3OIS A;  3O0U A;  5A24 A;  3KFQ A;  2B1M A;  4YYR A;  1EF7 A;  4BQV A;  3KWZ A;  4PAD A;  1AEC A;  4Q8G A;  4CDC B;  2BDL A;  3BWK A;  2PRE A;  1PE6 A;  2P0R A;  4I05 A;  2WBF X;  3CH3 X;  3H7D A;  9PAP A;  1ME3 A;  1SP4 B;  1KHP A;  1MEG A;  3HHA A;  4KLB A;  1ITO A;  3ERV A;  2R9O A;  2B1N A;  2BDZ A;  4FIP A;  3KKU A;  3PDF A;  3GCB A;  3H8C A;  1F2B A;  1CPJ A;  3IV2 A;  4YYW A;  1EWO A;  8PCH A;  4K7C A;  1CVZ A;  1Y4H A;  1MEM A;  1KFU L;  5JA7 A;  2Y6E A;  4YYS A;  2GFO A;  2FRA A;  3KWB X;  2E00 A;  3D6S A;  4XR7 A;  4AXL A;  1U9X A;  3B79 A;  3MHH A;  2P86 A;  4OEM A;  1AU3 A;  3KX1 A;  2GHU A;  2DJG B;  1QMY A;  1QXP A;  2DC8 A;  2P7U A;  4QBB A;  3P5V A;  1U9W A;  7PCK A;  2F1G A;  3DF0 A;  1YVB A;  3CBJ A;  1MDW A;  4YV8 A;  4PP2 E;  1BP4 A;  2H7J A;  1ME4 A;  1XKG A;  2YJB A;  1PPD A;  3RVV A;  1AU0 A;  4FK5 A;  1AYW A;  1GCB A;  1U5I A;  1ATK A;  1X9Y A;  2R9C A;  1PCI A;  1CB5 A;  2FYE A;  1CV8 A;  4CDD B;  5CHT A;  2PNS A;  4W4U A;  2AIM A;  3USV A;  2ARY A;  2O6X A;  1ICF A;  3S3Q A;  3C9E A;  3BPM A;  3OF8 A;  1PAD A;  2E03 A;  1PXV A;  1KHQ A;  1VJV A;  2R9M A;  1TL9 A;  2R9F A;  3AI8 A;  3LFY A;  2ACT A;  1KFX L;  1PPO A;  4MZS A;  4I04 A;  1U9Q X;  2XU3 A;  4X6J A;  4HWY A;  4WA6 A;  2DCA A;  4X6I A;  2HD5 A;  3BCN A;  3K8U A;  3BPF A;  1CSB B;  2C0Y A;  3V6E A;  1DF0 A;  3H89 A;  2CB5 A;  4DMY A;  3PBH A;  2XU4 A;  4BS6 A;  2R9N A;  4YYU A;  3F75 A;  4Q8H A;  3IEJ A;  3CH2 X;  2F7D A;  2OP3 A;  4YYV A;  3N3G A;  2DC6 A;  2NQI A;  2XU1 A;  1VSN A;  3NHE A;  3M99 A;  1PBH A;  1KXR A;  4G54 A;  6PAD A;  1F2C A;  1BGO A;  2YJ2 A;  1PPP A;  1THE A;  3OVZ A;  1CJL A;  4N8W A;  5EGW A;  2Y5B A;  2DZY A;  2DCC A;  3N3K A; 
#chains in the Genus database with same CATH topology
 1YK7 A;  3TNX A;  2NQA A;  3QJ3 A;  3OF9 A;  3PHU A;  1NB5 A;  1TU6 A;  1NB3 A;  2YJC A;  1DEU A;  1CQD A;  1GEC E;  4BPV A;  4FJC A;  3RNV A;  3V6C A;  2AS8 A;  3K9M A;  4RKX A;  2AVW A;  3MOR A;  4BS5 A;  4QRG A;  2NQG A;  1Y08 A;  2PAD A;  1FH0 A;  2FQ9 A;  3O1G A;  4MI7 A;  4CDE B;  2YJ9 A;  2AYN A;  2AGA A;  2G8J A;  2J7Q A;  3LXS A;  1YT7 A;  1EWP A;  2G8E A;  3KW9 A;  2AYO A;  3I06 A;  3H8B A;  4RF1 A;  3QSD A;  3OVX A;  2HXZ A;  3RVX A;  5KO3 A;  1POP A;  1GMY A;  1MS6 A;  2JQG R;  1PVJ A;  4P6G A;  2YJ8 A;  1AIM A;  1MHW A;  3MP2 A;  5EF4 A;  4I07 A;  3PNR A;  5K16 A;  5FPW A;  2DZZ A;  2XU5 A;  4ZTB A;  4QH6 A;  4CZW A;  4QRX A;  4D8I A;  2FO5 A;  1U9V A;  1MIR A;  1NL6 A;  3IOQ A;  3TMP A;  3WXF A;  2CIO A;  3S3R A;  1JQP A;  3OQC A;  1ZIV A;  2DJF B;  4QRV A;  4BSQ A;  2ATO A;  3BC3 A;  1A6R A;  1AYU A;  3H6S A;  3ZNH A;  5JH3 A;  2FRQ A;  1SNK A;  2DCD A;  2AU1 A;  1AYV A;  1EWM A;  1YAL A;  2DC7 A;  2R6N A;  3PW3 A;  1TLO A;  4YVA A;  1AU2 A;  2DCB A;  2JQF R;  3CBK A;  4W5C A;  3E1Z B;  4CDF B;  1PIP A;  4OEL A;  5JZE A;  1S4V A;  1BQI A;  4MZO A;  2AUZ A;  2BTW A;  3HWN A;  3QT4 A;  4ZUX U;  4WUR A;  2OUL A;  1ZCM A;  5J94 A;  3IUT A;  3P5X A;  1NLJ A;  4X6H A;  3RVW A;  4PI3 A;  2VHF A;  3I3T A;  4N79 A;  3PSE A;  1O0E A;  4BOU A;  4P6E A;  4RF0 A;  2E01 A;  3C0R A;  5CHV A;  1BY8 A;  3N4C A;  3KSE A;  3O65 A;  1F29 A;  1NQC A;  5CVM A;  5PAD A;  1DKI A;  2NQD B;  3BOW A;  3F5V A;  2PBH A;  2IBI A;  2VHS A;  3ZUA A;  4GUA A;  1EWL A;  3PHX A;  2BTW B;  1F2A A;  1CS8 A;  1QDQ A;  2DC9 A;  5CVN B;  2G7Y A;  4DMX A;  3P5W A;  3MHS A;  1CTE A;  1QOL A;  4HXD B;  3WXG A;  1M6D A;  1STF E;  2OZ2 A;  5CVO B;  4YYQ A;  4XUI A;  3HD3 A;  2HH5 A;  1AU4 A;  4PP1 A;  2E02 A;  3U8E A;  3K24 A;  2FTD A;  1K3B B;  4P16 A;  3HHI A;  4REZ A;  1IWD A;  4MSX A;  3IMA A;  4N4Z A;  5F02 A;  1GLO A;  3IHP A;  3WXE A;  1Q6K A;  1HUC B;  4AXM A;  3MTN A;  4W5B A;  4IP3 A;  4MM3 B;  2FE8 A;  3TRK A;  2AUX A;  2FUD A;  3W31 A;  4RY2 A;  1YK8 A;  2IPP B;  2DOS A;  1NPZ A;  2G6D A;  3P5U A;  3MTV A;  1PPN A;  2HHN A;  2FT2 A;  3OIS A;  3O0U A;  5E6J A;  5A24 A;  3KFQ A;  1YZB A;  2B1M A;  4YYR A;  4IUM A;  1EF7 A;  4BQV A;  3KWZ A;  4PAD A;  1AEC A;  4Q8G A;  4CDC B;  4M0W A;  1UKF A;  2BDL A;  3BWK A;  2PRE A;  1PE6 A;  2P0R A;  4I05 A;  2WBF X;  2J7Q C;  3CH3 X;  3H7D A;  9PAP A;  1ME3 A;  1SP4 B;  1KHP A;  1MEG A;  3HHA A;  2Z84 A;  4KLB A;  1ITO A;  3ERV A;  2R9O A;  2B1N A;  2BDZ A;  4FIP A;  3KKU A;  3PDF A;  3GCB A;  4BOQ A;  3H8C A;  1F2B A;  1CPJ A;  3IV2 A;  4YYW A;  1EWO A;  8PCH A;  4K7C A;  1CVZ A;  1Y4H A;  1MEM A;  1KFU L;  2BU3 A;  5JA7 A;  4D8B A;  2Y6E A;  3IFU A;  4YYS A;  2GFO A;  3PHW A;  2FRA A;  3KWB X;  2E00 A;  3PRP A;  4PT5 A;  4BOP A;  3D6S A;  4XR7 A;  2JRI A;  4AXL A;  1U9X A;  4A5U A;  3BB7 A;  4BOZ A;  3B79 A;  5EZS A;  3MHH A;  2JTC A;  2P86 A;  4OEM A;  1AU3 A;  3KX1 A;  2GHU A;  2DJG B;  1QMY A;  1QXP A;  2DC8 A;  3PT2 A;  2P7U A;  4R3D A;  4QBB A;  4XZX A;  3P5V A;  1U9W A;  7PCK A;  2F1G A;  4OVZ B;  3MJ5 A;  3DF0 A;  1YVB A;  3CBJ A;  1MDW A;  3BBA A;  2UZJ A;  4YV8 A;  4PP2 E;  1BP4 A;  2H7J A;  1ME4 A;  1XKG A;  2YJB A;  1PPD A;  3RVV A;  1AU0 A;  4FK5 A;  1AYW A;  1GCB A;  1U5I A;  1ATK A;  1X9Y A;  2R9C A;  4RNA A;  1PCI A;  1CB5 A;  2FYE A;  1CV8 A;  4CDD B;  3W30 A;  5CHT A;  2PNS A;  4W4U A;  2AIM A;  3USV A;  4D8E A;  2ARY A;  2O6X A;  1ICF A;  3S3Q A;  3C9E A;  3BPM A;  3OF8 A;  1PAD A;  2E03 A;  1PXV A;  3E9S A;  1KHQ A;  1VJV A;  2R9M A;  1TL9 A;  2R9F A;  3AI8 A;  3LFY A;  2ACT A;  1KFX L;  1PPO A;  4MZS A;  4I04 A;  1U9Q X;  3B21 A;  2XU3 A;  4X6J A;  4HWY A;  4WA6 A;  2DCA A;  4X6I A;  2HD5 A;  3BCN A;  3K8U A;  3BPF A;  1CSB B;  2C0Y A;  3V6E A;  1DF0 A;  3BY4 A;  3H89 A;  2CB5 A;  4DMY A;  3PBH A;  2XU4 A;  4BS6 A;  2R9N A;  4YYU A;  3F75 A;  4Q8H A;  3IEJ A;  3CH2 X;  2F7D A;  2OP3 A;  4YYV A;  3N3G A;  2DC6 A;  2NQI A;  5EZQ A;  2XU1 A;  4OW0 A;  3PRM A;  1VSN A;  3NHE A;  4OVZ A;  3M99 A;  1PBH A;  1KXR A;  4G54 A;  6PAD A;  1F2C A;  1BGO A;  2YJ2 A;  2HWK A;  1PPP A;  1THE A;  3OVZ A;  1CJL A;  4N8W A;  5EGW A;  2Y5B A;  2DZY A;  2DCC A;  4BOS A;  3N3K A; 
#chains in the Genus database with same CATH homology
 1YK7 A;  3TNX A;  2NQA A;  3QJ3 A;  3OF9 A;  1NB5 A;  1TU6 A;  1NB3 A;  2VFC A;  2YJC A;  1DEU A;  1CQD A;  1GEC E;  4BPV A;  4FJC A;  3V6C A;  2AS8 A;  3K9M A;  2AVW A;  4B55 A;  3MOR A;  4BS5 A;  4QRG A;  2NQG A;  1Y08 A;  2PAD A;  1FH0 A;  2FQ9 A;  3O1G A;  4CDE B;  2YJ9 A;  2AYN A;  2G8J A;  3LXS A;  1YT7 A;  1EWP A;  2G8E A;  3KW9 A;  2AYO A;  3I06 A;  3H8B A;  3QSD A;  3OVX A;  2HXZ A;  3RVX A;  1POP A;  1GMY A;  1MS6 A;  2JQG R;  4P6G A;  2YJ8 A;  1AIM A;  1MHW A;  5EF4 A;  4I07 A;  3PNR A;  5K16 A;  5FPW A;  2DZZ A;  2XU5 A;  4QH6 A;  4CZW A;  4QRX A;  2FO5 A;  1U9V A;  1MIR A;  1NL6 A;  3IOQ A;  1W4T A;  3WXF A;  2CIO A;  3S3R A;  1JQP A;  1ZIV A;  2DJF B;  4QRV A;  4BSQ A;  2ATO A;  3BC3 A;  1A6R A;  1AYU A;  3H6S A;  5JH3 A;  2FRQ A;  1SNK A;  2DCD A;  2AU1 A;  1AYV A;  1EWM A;  1YAL A;  2DC7 A;  2R6N A;  3PW3 A;  1TLO A;  4YVA A;  1AU2 A;  2DCB A;  2JQF R;  3CBK A;  4W5C A;  3E1Z B;  4CDF B;  1PIP A;  4OEL A;  1S4V A;  1BQI A;  4MZO A;  2AUZ A;  3HWN A;  3QT4 A;  4ZUX U;  2OUL A;  1ZCM A;  5J94 A;  3IUT A;  3P5X A;  1NLJ A;  4X6H A;  3RVW A;  4PI3 A;  2VHF A;  3I3T A;  4N79 A;  1O0E A;  4P6E A;  2E01 A;  5CHV A;  1BY8 A;  3N4C A;  2VFB A;  3KSE A;  1F29 A;  1NQC A;  5CVM A;  5PAD A;  2NQD B;  3BOW A;  3F5V A;  2PBH A;  2IBI A;  2VHS A;  3LTW A;  3ZUA A;  1EWL A;  1F2A A;  1CS8 A;  1QDQ A;  2DC9 A;  5CVN B;  2G7Y A;  4DMX A;  3P5W A;  3MHS A;  1CTE A;  1QOL A;  3WXG A;  1M6D A;  1STF E;  2OZ2 A;  5CVO B;  4YYQ A;  4XUI A;  3HD3 A;  2HH5 A;  1AU4 A;  4PP1 A;  2E02 A;  3U8E A;  3K24 A;  2FTD A;  1K3B B;  3HHI A;  1IWD A;  4MSX A;  3IMA A;  4N4Z A;  5F02 A;  1GLO A;  3IHP A;  3WXE A;  1Q6K A;  1HUC B;  4AXM A;  3MTN A;  4W5B A;  2AUX A;  2FUD A;  4RY2 A;  1YK8 A;  2IPP B;  1NPZ A;  2G6D A;  3P5U A;  1PPN A;  2HHN A;  2FT2 A;  3OIS A;  3O0U A;  5A24 A;  3KFQ A;  2B1M A;  4YYR A;  1EF7 A;  4BQV A;  3KWZ A;  4PAD A;  1AEC A;  4Q8G A;  4CDC B;  2BDL A;  3BWK A;  2PRE A;  1PE6 A;  2P0R A;  4I05 A;  2BSZ A;  2WBF X;  3CH3 X;  3H7D A;  9PAP A;  1ME3 A;  1SP4 B;  1KHP A;  1MEG A;  3HHA A;  4KLB A;  1ITO A;  3ERV A;  2R9O A;  2B1N A;  2BDZ A;  4FIP A;  3KKU A;  3PDF A;  3GCB A;  3H8C A;  1F2B A;  1CPJ A;  3IV2 A;  4YYW A;  1EWO A;  8PCH A;  4K7C A;  1CVZ A;  1Y4H A;  1MEM A;  1KFU L;  5JA7 A;  1E2T A;  2Y6E A;  4GUZ A;  4C5P A;  4YYS A;  2GFO A;  2FRA A;  3KWB X;  2E00 A;  3D6S A;  4XR7 A;  3D9W A;  4AXL A;  1U9X A;  3B79 A;  3MHH A;  2P86 A;  4OEM A;  1AU3 A;  3KX1 A;  2GHU A;  2DJG B;  1W5R A;  1QMY A;  1QXP A;  2DC8 A;  2P7U A;  4QBB A;  3P5V A;  1U9W A;  7PCK A;  2F1G A;  3DF0 A;  1YVB A;  3CBJ A;  1MDW A;  4YV8 A;  4PP2 E;  1BP4 A;  2H7J A;  1ME4 A;  1XKG A;  2YJB A;  1PPD A;  3RVV A;  1AU0 A;  4FK5 A;  1AYW A;  1GCB A;  1U5I A;  1ATK A;  1X9Y A;  2R9C A;  1PCI A;  1CB5 A;  2FYE A;  4NV7 A;  1CV8 A;  4CDD B;  5CHT A;  2PNS A;  4W4U A;  2AIM A;  3USV A;  2ARY A;  2O6X A;  1ICF A;  3S3Q A;  3C9E A;  3BPM A;  3OF8 A;  1PAD A;  2E03 A;  1PXV A;  1KHQ A;  1VJV A;  2R9M A;  4NV8 A;  1TL9 A;  2R9F A;  3AI8 A;  3LFY A;  2ACT A;  1KFX L;  1PPO A;  4MZS A;  4I04 A;  1U9Q X;  2XU3 A;  4X6J A;  4HWY A;  4WA6 A;  2DCA A;  4X6I A;  2HD5 A;  3BCN A;  3K8U A;  3BPF A;  1CSB B;  2C0Y A;  3V6E A;  1DF0 A;  3H89 A;  2CB5 A;  4DMY A;  3PBH A;  2XU4 A;  4BS6 A;  2R9N A;  4YYU A;  3F75 A;  4Q8H A;  3IEJ A;  3CH2 X;  2F7D A;  2OP3 A;  4YYV A;  3N3G A;  2DC6 A;  2NQI A;  2XU1 A;  1VSN A;  3NHE A;  3M99 A;  1GX3 A;  1PBH A;  1KXR A;  4G54 A;  6PAD A;  1F2C A;  1BGO A;  2YJ2 A;  1PPP A;  1THE A;  4BGF A;  3OVZ A;  1CJL A;  4N8W A;  5EGW A;  2Y5B A;  2DZY A;  2DCC A;  1W6F A;  3N3K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...