4DMYA

Cathepsin k inhibitor
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
215
structure length
215
Chain Sequence
APDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cathepsin K
publication title (1R,2R)-N-(1-cyanocyclopropyl)-2-(6-methoxy-1,3,4,5-tetrahydropyrido[4,3-b]indole-2-carbonyl)cyclohexanecarboxamide (AZD4996): a potent and highly selective cathepsin K inhibitor for the treatment of osteoarthritis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 61
structure length 215
sequence length 215
chains with identical sequence B
ec nomenclature ec 3.4.22.38: Cathepsin K.
pdb deposition date 2012-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 4dmyA00
1MS6A 2HXZA 4FIPA 1DEUA 3K24A 3D6SA 2E01A 3MHSA 3HHAA 3RVVA 4QH6A 2OP3A 2AYNA 2JQGR 4YV8A 3IEJA 2GHUA 1KFXL 8PCHA 4AXMA 2CIOA 1AIMA 4I04A 3KFQA 3N3KA 2XU1A 2R9FA 3KX1A 4QRGA 4N4ZA 2AU1A 3BCNA 2E03A 3F5VA 3IUTA 1BGOA 3C9EA 2IPPB 3LFYA 2G8JA 2IBIA 4KLBA 3S3QA 1QOLA 9PAPA 1S4VA 1ME3A 2DZZA 5K16A 2YJ2A 3AI8A 1KHPA 3OISA 5CHTA 3OF8A 1TL9A 2DC9A 3CH3X 1ICFA 4QRXA 2FUDA 1BP4A 2DJFB 5CVOB 3KKUA 4OEMA 1AU0A 3WXGA 2P7UA 2OULA 3IHPA 1PCIA 1THEA 3P5WA 5FPWA 2VHFA 5JA7A 4PADA 1YALA 1CSBB 3IOQA 2Y5BA 1XKGA 1YK8A 1X9YA 2NQIA 3MHHA 4BS6A 4BSQA 4CDEB 3IMAA 3P5XA 1MHWA 1Q6KA 1MDWA 1Y08A 1FH0A 3H8BA 3HD3A 4QRVA 2YJ9A 3GCBA 3RVXA 4PP1A 3WXEA 3BPMA 1ZIVA 1EF7A 3P5UA 3MORA 3H89A 1PXVA 3B79A 5CHVA 5EGWA 3K8UA 3ERVA 2FQ9A 3H8CA 3CBKA 2R9MA 1AECA 3CBJA 3V6CA 1ITOA 2GFOA 1YT7A 1ME4A 4CDFB 3O0UA 4PP2E 2B1NA 3MTNA 2YJCA 1AYUA 1NB5A 1ATKA 1JQPA 4G54A 4K7CA 1DF0A 1YVBA 4X6HA 2HD5A 2DJGB 1U9QX 1NQCA 3PDFA 4YYRA 4X6JA 3PW3A 1GMYA 3HWNA 1CPJA 4YYQA 3OVXA 3USVA 1F2AA 2OZ2A 2R6NA 1PBHA 2NQDB 2FTDA 2HHNA 4FK5A 5CVNB 2WBFX 5CVMA 3M99A 3WXFA 1AYWA 1TLOA 1SP4B 2P86A 2Y6EA 2FT2A 1MEGA 5A24A 4P6EA 4MSXA 1PADA 2ARYA 3H7DA 4DMXA 1KXRA 3KWBX 1EWLA 2PADA 2DC8A 4MZSA 3RVWA 2H7JA 4Q8GA 4AXLA 2FRAA 3N3GA 7PCKA 1F2CA 3BPFA 4CDDB 1GCBA 4W5CA 4W4UA 4BPVA 1PIPA 4MZOA 5EF4A 4BQVA 4FJCA 1QMYA 1AU2A 4YYSA 6PADA 1CQDA 1STFE 3P5VA 3OF9A 3BOWA 4I07A 1CJLA 1PPDA 4WA6A 2FO5A 4Q8HA 5F02A 2DCCA 1GLOA 1NPZA 3O1GA 2DCBA 3LXSA 2AVWA 3S3RA 2DCDA 4X6IA 2HH5A 3I06A 1BY8A 2R9CA 3KWZA 4YYUA 3E1ZB 2G8EA 1M6DA 1QXPA 4YYVA 1AU4A 4PI3A 1ZCMA 2PNSA 3CH2X 4CZWA 3TNXA 1POPA 3BC3A 1U9XA 3U8EA 2BDZA 4N79A 2JQFR 1VSNA 4ZUXU 1EWOA 2PREA 3F75A 4XUIA 2XU3A 2AUXA 4W5BA 4YVAA 2YJ8A 2AS8A 2E02A 1SNKA 2YJBA 1NB3A 2P0RA 2XU4A 4QBBA 1CB5A 4CDCB 1QDQA 3H6SA 3K9MA 2NQAA 2NQGA 1KHQA 4I05A 1YK7A 2R9NA 2R9OA 1CVZA 2F7DA 2AYOA 2AIMA 4YYWA 2DC7A 3HHIA 4OELA 1Y4HA 2DZYA 1CTEA 1PPOA 4DMYA 4N8WA 1BQIA 1MIRA 3QJ3A 4RY2A 1IWDA 2FYEA 2AUZA 3NHEA 1CS8A 3OVZA 1TU6A 3QT4A 2BDLA 5J94A 1EWMA 1KFUL 2G7YA 1NLJA 1PPPA 3N4CA 1PPNA 2DC6A 2XU5A 2C0YA 3IV2A 1PE6A 1NL6A 2PBHA 1U9WA 1O0EA 5JH3A 1CV8A 1U5IA 1EWPA 2G6DA 3KW9A 5PADA 3I3TA 4HWYA 2ACTA 2ATOA 3DF0A 1F29A 2O6XA 3V6EA 3BWKA 1GECE 1HUCB 2F1GA 2DCAA 1U9VA 2E00A 3PBHA 3QSDA 2FRQA 4XR7A 1K3BB 2CB5A 1MEMA 1AYVA 2VHSA 1VJVA 1AU3A 4BS5A 2B1MA 3PNRA 1A6RA 3ZUAA 1F2BA 4P6GA 3KSEA
chains in the Genus database with same CATH superfamily
1MS6A 2HXZA 4FIPA 1DEUA 3K24A 2J7QA 3D6SA 2E01A 3MHSA 3HHAA 3RVVA 4QH6A 2OP3A 2AYNA 5EZQA 2JQGR 4YV8A 3IEJA 2BTWA 2GHUA 1KFXL 8PCHA 4AXMA 2CIOA 1AIMA 3BBAA 4I04A 3KFQA 3N3KA 2XU1A 2R9FA 3KX1A 4QRGA 4N4ZA 4RNAA 3PHXA 2AU1A 3BCNA 2E03A 4REZA 3F5VA 3IUTA 1BGOA 3C9EA 2IPPB 3LFYA 2G8JA 2IBIA 4KLBA 3S3QA 1QOLA 4HXDB 3ZNHA 9PAPA 2UZJA 1S4VA 1UKFA 1ME3A 2J7QC 2DZZA 5K16A 4D8IA 4BOUA 2YJ2A 3AI8A 1KHPA 3OISA 5CHTA 3OF8A 1TL9A 2DC9A 3CH3X 1ICFA 4QRXA 2FUDA 3TRKA 1BP4A 1YZBA 2DJFB 5CVOB 3KKUA 3W31A 4OEMA 2FE8A 1AU0A 2Z84A 3WXGA 2P7UA 2OULA 3IHPA 1PCIA 3MTVA 1THEA 3P5WA 5FPWA 2VHFA 5JA7A 4PADA 1YALA 1CSBB 3IOQA 3PHWA 2Y5BA 1XKGA 3W30A 4OVZB 1YK8A 1X9YA 3BY4A 3E9SA 2NQIA 3MHHA 4ZTBA 4BS6A 4BSQA 4CDEB 3IMAA 3P5XA 1MHWA 1Q6KA 4M0WA 1MDWA 1Y08A 1FH0A 3H8BA 3HD3A 4QRVA 2YJ9A 3GCBA 3RVXA 4PP1A 3WXEA 3BPMA 1ZIVA 1EF7A 3B21A 3P5UA 3PHUA 5EZSA 3OQCA 3MORA 3H89A 2JRIA 1PXVA 3B79A 5CHVA 5EGWA 3K8UA 3ERVA 2FQ9A 3H8CA 3CBKA 2R9MA 1AECA 3CBJA 3V6CA 1ITOA 4BOSA 2GFOA 1YT7A 1ME4A 4CDFB 3O0UA 4PP2E 2B1NA 3MTNA 2DOSA 2YJCA 1AYUA 1NB5A 1ATKA 1JQPA 4G54A 4K7CA 1DF0A 1YVBA 5E6JA 4X6HA 2HD5A 2DJGB 1U9QX 1NQCA 3PDFA 4YYRA 4X6JA 3PW3A 1GMYA 2BTWB 3HWNA 1CPJA 4WURA 4YYQA 3OVXA 3USVA 1F2AA 1PVJA 2OZ2A 2R6NA 3RNVA 4BOPA 3IFUA 1PBHA 2NQDB 4P16A 2FTDA 2HHNA 4FK5A 5CVNB 2WBFX 5JZEA 4PT5A 5CVMA 3M99A 3WXFA 1AYWA 1TLOA 1SP4B 2P86A 2Y6EA 2AGAA 2FT2A 1MEGA 5A24A 4P6EA 4MSXA 1PADA 2ARYA 3H7DA 4DMXA 1KXRA 3KWBX 1EWLA 2PADA 2DC8A 4MZSA 3RVWA 2H7JA 4Q8GA 4RF0A 4AXLA 4BOQA 2FRAA 3PRMA 3N3GA 7PCKA 1F2CA 3BPFA 4CDDB 1GCBA 4W5CA 4W4UA 4BPVA 1PIPA 4MZOA 5EF4A 3MJ5A 3C0RA 4BQVA 1DKIA 4FJCA 4IUMA 1QMYA 1AU2A 4YYSA 6PADA 1CQDA 1STFE 3P5VA 3OF9A 3BOWA 4I07A 1CJLA 1PPDA 4WA6A 2FO5A 4Q8HA 4GUAA 5F02A 2DCCA 1GLOA 3MP2A 1NPZA 4BOZA 3O1GA 2DCBA 3LXSA 2AVWA 3S3RA 2DCDA 4X6IA 2HH5A 3I06A 1BY8A 2R9CA 3KWZA 4YYUA 3E1ZB 2G8EA 1M6DA 1QXPA 4YYVA 1AU4A 4PI3A 1ZCMA 2PNSA 3CH2X 4CZWA 3TNXA 1POPA 3BC3A 1U9XA 3U8EA 3BB7A 2BDZA 4N79A 2JQFR 1VSNA 4ZUXU 1EWOA 2PREA 3F75A 4MM3B 4XUIA 2XU3A 2AUXA 4W5BA 3PT2A 4YVAA 2YJ8A 2AS8A 2E02A 1SNKA 2YJBA 1NB3A 2P0RA 3TMPA 2XU4A 4QBBA 1CB5A 5KO3A 4CDCB 1QDQA 3H6SA 3K9MA 2NQAA 2NQGA 1KHQA 4I05A 4MI7A 1YK7A 4OW0A 2R9NA 2R9OA 1CVZA 2F7DA 2AYOA 3PSEA 2AIMA 4YYWA 2DC7A 3HHIA 4OELA 1Y4HA 4D8BA 3O65A 2DZYA 4RKXA 1CTEA 4R3DA 1PPOA 4DMYA 4N8WA 1BQIA 1MIRA 3QJ3A 4RY2A 1IWDA 4D8EA 2FYEA 2AUZA 2BU3A 3NHEA 1CS8A 3OVZA 1TU6A 3QT4A 2BDLA 5J94A 1EWMA 1KFUL 2G7YA 1NLJA 1PPPA 3N4CA 1PPNA 2DC6A 2XU5A 3PRPA 2C0YA 3IV2A 1PE6A 4IP3A 1NL6A 2PBHA 4OVZA 1U9WA 1O0EA 5JH3A 1CV8A 1U5IA 1EWPA 4RF1A 2G6DA 3KW9A 5PADA 3I3TA 4HWYA 2ACTA 4A5UA 2ATOA 2HWKA 3DF0A 1F29A 2O6XA 3V6EA 3BWKA 1GECE 1HUCB 2F1GA 2DCAA 1U9VA 2E00A 3PBHA 3QSDA 2FRQA 4XR7A 1K3BB 2CB5A 1MEMA 1AYVA 2VHSA 2JTCA 1VJVA 1AU3A 4XZXA 4BS5A 2B1MA 3PNRA 1A6RA 3ZUAA 1F2BA 4P6GA 3KSEA
chains in the Genus database with same CATH topology
1MS6A 2HXZA 4FIPA 1DEUA 3K24A 3D6SA 2E01A 3MHSA 3HHAA 3RVVA 4QH6A 2OP3A 2AYNA 2JQGR 4YV8A 3IEJA 2GHUA 1KFXL 8PCHA 4AXMA 2CIOA 1AIMA 4I04A 3KFQA 3N3KA 2XU1A 2R9FA 3KX1A 4QRGA 4B55A 4N4ZA 2AU1A 3BCNA 2E03A 3F5VA 3IUTA 1BGOA 3C9EA 2IPPB 3LFYA 2G8JA 2IBIA 4KLBA 3S3QA 1QOLA 9PAPA 4NV8A 1S4VA 1ME3A 2DZZA 5K16A 2YJ2A 3AI8A 1KHPA 3OISA 5CHTA 3OF8A 1TL9A 2DC9A 3CH3X 1ICFA 4QRXA 2FUDA 1BP4A 2DJFB 5CVOB 3KKUA 4OEMA 1AU0A 3WXGA 2P7UA 2OULA 3IHPA 1PCIA 1THEA 3P5WA 4BGFA 5FPWA 2VHFA 5JA7A 4PADA 1YALA 1CSBB 3IOQA 1W5RA 2Y5BA 1XKGA 1YK8A 1X9YA 2NQIA 3MHHA 4BS6A 4BSQA 4CDEB 3IMAA 3P5XA 1MHWA 1Q6KA 1MDWA 1Y08A 1FH0A 3H8BA 3HD3A 4QRVA 2YJ9A 3GCBA 3RVXA 4PP1A 3WXEA 3BPMA 1ZIVA 1EF7A 3P5UA 3MORA 3H89A 1PXVA 3B79A 5CHVA 5EGWA 3K8UA 3ERVA 2FQ9A 3H8CA 3CBKA 2R9MA 1AECA 3CBJA 3V6CA 1ITOA 2GFOA 1YT7A 1ME4A 4CDFB 3O0UA 4PP2E 2B1NA 3MTNA 2YJCA 1AYUA 1NB5A 4NV7A 1ATKA 1JQPA 4G54A 4K7CA 1DF0A 1YVBA 4X6HA 2HD5A 2DJGB 1U9QX 1NQCA 3PDFA 4YYRA 4X6JA 3PW3A 1GMYA 3HWNA 1CPJA 4YYQA 3OVXA 3USVA 1F2AA 2OZ2A 2R6NA 1PBHA 2NQDB 2FTDA 2HHNA 4FK5A 5CVNB 2WBFX 5CVMA 3M99A 3WXFA 1AYWA 1TLOA 1SP4B 2P86A 2Y6EA 2FT2A 1MEGA 5A24A 4P6EA 4MSXA 1PADA 2ARYA 3H7DA 4DMXA 1KXRA 3KWBX 1EWLA 2PADA 2DC8A 4MZSA 3RVWA 2H7JA 4Q8GA 3LTWA 4AXLA 2FRAA 3N3GA 7PCKA 1F2CA 3BPFA 4CDDB 1GCBA 4W5CA 4GUZA 4W4UA 4BPVA 1PIPA 4MZOA 5EF4A 4BQVA 4FJCA 1QMYA 1AU2A 4YYSA 6PADA 1CQDA 1STFE 3P5VA 3OF9A 3BOWA 4C5PA 4I07A 1CJLA 1PPDA 4WA6A 2FO5A 4Q8HA 5F02A 1E2TA 2DCCA 1GLOA 1NPZA 3O1GA 2DCBA 3LXSA 1W6FA 2AVWA 3S3RA 2DCDA 4X6IA 2VFCA 2HH5A 3I06A 1BY8A 2R9CA 3KWZA 4YYUA 3E1ZB 2G8EA 1M6DA 1QXPA 4YYVA 1AU4A 2VFBA 1ZCMA 4PI3A 2PNSA 3CH2X 4CZWA 3TNXA 1POPA 3BC3A 1U9XA 3U8EA 2BDZA 4N79A 2JQFR 1VSNA 4ZUXU 1EWOA 2PREA 3F75A 4XUIA 2XU3A 2AUXA 4W5BA 4YVAA 2YJ8A 2AS8A 2E02A 1SNKA 2YJBA 1NB3A 2P0RA 1W4TA 2XU4A 4QBBA 1CB5A 4CDCB 1QDQA 3H6SA 3K9MA 2NQAA 2NQGA 1KHQA 4I05A 1YK7A 2R9NA 1GX3A 2R9OA 1CVZA 2F7DA 2AYOA 2AIMA 4YYWA 2DC7A 3HHIA 4OELA 3D9WA 1Y4HA 2DZYA 1CTEA 1PPOA 4DMYA 4N8WA 1BQIA 1MIRA 3QJ3A 4RY2A 1IWDA 2FYEA 2AUZA 3NHEA 1CS8A 3OVZA 1TU6A 3QT4A 2BDLA 5J94A 1EWMA 1KFUL 2G7YA 1NLJA 1PPPA 3N4CA 1PPNA 2DC6A 2XU5A 2C0YA 3IV2A 1PE6A 1NL6A 2PBHA 1U9WA 1O0EA 5JH3A 1CV8A 1U5IA 1EWPA 2G6DA 3KW9A 5PADA 3I3TA 4HWYA 2ACTA 2ATOA 3DF0A 1F29A 2O6XA 3V6EA 3BWKA 1GECE 1HUCB 2F1GA 2DCAA 1U9VA 2E00A 3PBHA 3QSDA 2FRQA 4XR7A 1K3BB 2CB5A 1MEMA 1AYVA 2VHSA 1VJVA 1AU3A 4BS5A 2B1MA 3PNRA 1A6RA 3ZUAA 1F2BA 4P6GA 3KSEA 2BSZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MS6 A;  2HXZ A;  4FIP A;  1DEU A;  3K24 A;  3D6S A;  2E01 A;  3MHS A;  3HHA A;  3RVV A;  4QH6 A;  2OP3 A;  2AYN A;  2JQG R;  4YV8 A;  3IEJ A;  2GHU A;  1KFX L;  8PCH A;  4AXM A;  2CIO A;  1AIM A;  4I04 A;  3KFQ A;  3N3K A;  2XU1 A;  2R9F A;  3KX1 A;  4QRG A;  4N4Z A;  2AU1 A;  3BCN A;  2E03 A;  3F5V A;  3IUT A;  1BGO A;  3C9E A;  2IPP B;  3LFY A;  2G8J A;  2IBI A;  4KLB A;  3S3Q A;  1QOL A;  9PAP A;  1S4V A;  1ME3 A;  2DZZ A;  5K16 A;  2YJ2 A;  3AI8 A;  1KHP A;  3OIS A;  5CHT A;  3OF8 A;  1TL9 A;  2DC9 A;  3CH3 X;  1ICF A;  4QRX A;  2FUD A;  1BP4 A;  2DJF B;  5CVO B;  3KKU A;  4OEM A;  1AU0 A;  3WXG A;  2P7U A;  2OUL A;  3IHP A;  1PCI A;  1THE A;  3P5W A;  5FPW A;  2VHF A;  5JA7 A;  4PAD A;  1YAL A;  1CSB B;  3IOQ A;  2Y5B A;  1XKG A;  1YK8 A;  1X9Y A;  2NQI A;  3MHH A;  4BS6 A;  4BSQ A;  4CDE B;  3IMA A;  3P5X A;  1MHW A;  1Q6K A;  1MDW A;  1Y08 A;  1FH0 A;  3H8B A;  3HD3 A;  4QRV A;  2YJ9 A;  3GCB A;  3RVX A;  4PP1 A;  3WXE A;  3BPM A;  1ZIV A;  1EF7 A;  3P5U A;  3MOR A;  3H89 A;  1PXV A;  3B79 A;  5CHV A;  5EGW A;  3K8U A;  3ERV A;  2FQ9 A;  3H8C A;  3CBK A;  2R9M A;  1AEC A;  3CBJ A;  3V6C A;  1ITO A;  2GFO A;  1YT7 A;  1ME4 A;  4CDF B;  3O0U A;  4PP2 E;  2B1N A;  3MTN A;  2YJC A;  1AYU A;  1NB5 A;  1ATK A;  1JQP A;  4G54 A;  4K7C A;  1DF0 A;  1YVB A;  4X6H A;  2HD5 A;  2DJG B;  1U9Q X;  1NQC A;  3PDF A;  4YYR A;  4X6J A;  3PW3 A;  1GMY A;  3HWN A;  1CPJ A;  4YYQ A;  3OVX A;  3USV A;  1F2A A;  2OZ2 A;  2R6N A;  1PBH A;  2NQD B;  2FTD A;  2HHN A;  4FK5 A;  5CVN B;  2WBF X;  5CVM A;  3M99 A;  3WXF A;  1AYW A;  1TLO A;  1SP4 B;  2P86 A;  2Y6E A;  2FT2 A;  1MEG A;  5A24 A;  4P6E A;  4MSX A;  1PAD A;  2ARY A;  3H7D A;  4DMX A;  1KXR A;  3KWB X;  1EWL A;  2PAD A;  2DC8 A;  4MZS A;  3RVW A;  2H7J A;  4Q8G A;  4AXL A;  2FRA A;  3N3G A;  7PCK A;  1F2C A;  3BPF A;  4CDD B;  1GCB A;  4W5C A;  4W4U A;  4BPV A;  1PIP A;  4MZO A;  5EF4 A;  4BQV A;  4FJC A;  1QMY A;  1AU2 A;  4YYS A;  6PAD A;  1CQD A;  1STF E;  3P5V A;  3OF9 A;  3BOW A;  4I07 A;  1CJL A;  1PPD A;  4WA6 A;  2FO5 A;  4Q8H A;  5F02 A;  2DCC A;  1GLO A;  1NPZ A;  3O1G A;  2DCB A;  3LXS A;  2AVW A;  3S3R A;  2DCD A;  4X6I A;  2HH5 A;  3I06 A;  1BY8 A;  2R9C A;  3KWZ A;  4YYU A;  3E1Z B;  2G8E A;  1M6D A;  1QXP A;  4YYV A;  1AU4 A;  4PI3 A;  1ZCM A;  2PNS A;  3CH2 X;  4CZW A;  3TNX A;  1POP A;  3BC3 A;  1U9X A;  3U8E A;  2BDZ A;  4N79 A;  2JQF R;  1VSN A;  4ZUX U;  1EWO A;  2PRE A;  3F75 A;  4XUI A;  2XU3 A;  2AUX A;  4W5B A;  4YVA A;  2YJ8 A;  2AS8 A;  2E02 A;  1SNK A;  2YJB A;  1NB3 A;  2P0R A;  2XU4 A;  4QBB A;  1CB5 A;  4CDC B;  1QDQ A;  3H6S A;  3K9M A;  2NQA A;  2NQG A;  1KHQ A;  4I05 A;  1YK7 A;  2R9N A;  2R9O A;  1CVZ A;  2F7D A;  2AYO A;  2AIM A;  4YYW A;  2DC7 A;  3HHI A;  4OEL A;  1Y4H A;  2DZY A;  1CTE A;  1PPO A;  4DMY A;  4N8W A;  1BQI A;  1MIR A;  3QJ3 A;  4RY2 A;  1IWD A;  2FYE A;  2AUZ A;  3NHE A;  1CS8 A;  3OVZ A;  1TU6 A;  3QT4 A;  2BDL A;  5J94 A;  1EWM A;  1KFU L;  2G7Y A;  1NLJ A;  1PPP A;  3N4C A;  1PPN A;  2DC6 A;  2XU5 A;  2C0Y A;  3IV2 A;  1PE6 A;  1NL6 A;  2PBH A;  1U9W A;  1O0E A;  5JH3 A;  1CV8 A;  1U5I A;  1EWP A;  2G6D A;  3KW9 A;  5PAD A;  3I3T A;  4HWY A;  2ACT A;  2ATO A;  3DF0 A;  1F29 A;  2O6X A;  3V6E A;  3BWK A;  1GEC E;  1HUC B;  2F1G A;  2DCA A;  1U9V A;  2E00 A;  3PBH A;  3QSD A;  2FRQ A;  4XR7 A;  1K3B B;  2CB5 A;  1MEM A;  1AYV A;  2VHS A;  1VJV A;  1AU3 A;  4BS5 A;  2B1M A;  3PNR A;  1A6R A;  3ZUA A;  1F2B A;  4P6G A;  3KSE A; 
#chains in the Genus database with same CATH topology
 1MS6 A;  2HXZ A;  4FIP A;  1DEU A;  3K24 A;  2J7Q A;  3D6S A;  2E01 A;  3MHS A;  3HHA A;  3RVV A;  4QH6 A;  2OP3 A;  2AYN A;  5EZQ A;  2JQG R;  4YV8 A;  3IEJ A;  2BTW A;  2GHU A;  1KFX L;  8PCH A;  4AXM A;  2CIO A;  1AIM A;  3BBA A;  4I04 A;  3KFQ A;  3N3K A;  2XU1 A;  2R9F A;  3KX1 A;  4QRG A;  4N4Z A;  4RNA A;  3PHX A;  2AU1 A;  3BCN A;  2E03 A;  4REZ A;  3F5V A;  3IUT A;  1BGO A;  3C9E A;  2IPP B;  3LFY A;  2G8J A;  2IBI A;  4KLB A;  3S3Q A;  1QOL A;  4HXD B;  3ZNH A;  9PAP A;  2UZJ A;  1S4V A;  1UKF A;  1ME3 A;  2J7Q C;  2DZZ A;  5K16 A;  4D8I A;  4BOU A;  2YJ2 A;  3AI8 A;  1KHP A;  3OIS A;  5CHT A;  3OF8 A;  1TL9 A;  2DC9 A;  3CH3 X;  1ICF A;  4QRX A;  2FUD A;  3TRK A;  1BP4 A;  1YZB A;  2DJF B;  5CVO B;  3KKU A;  3W31 A;  4OEM A;  2FE8 A;  1AU0 A;  2Z84 A;  3WXG A;  2P7U A;  2OUL A;  3IHP A;  1PCI A;  3MTV A;  1THE A;  3P5W A;  5FPW A;  2VHF A;  5JA7 A;  4PAD A;  1YAL A;  1CSB B;  3IOQ A;  3PHW A;  2Y5B A;  1XKG A;  3W30 A;  4OVZ B;  1YK8 A;  1X9Y A;  3BY4 A;  3E9S A;  2NQI A;  3MHH A;  4ZTB A;  4BS6 A;  4BSQ A;  4CDE B;  3IMA A;  3P5X A;  1MHW A;  1Q6K A;  4M0W A;  1MDW A;  1Y08 A;  1FH0 A;  3H8B A;  3HD3 A;  4QRV A;  2YJ9 A;  3GCB A;  3RVX A;  4PP1 A;  3WXE A;  3BPM A;  1ZIV A;  1EF7 A;  3B21 A;  3P5U A;  3PHU A;  5EZS A;  3OQC A;  3MOR A;  3H89 A;  2JRI A;  1PXV A;  3B79 A;  5CHV A;  5EGW A;  3K8U A;  3ERV A;  2FQ9 A;  3H8C A;  3CBK A;  2R9M A;  1AEC A;  3CBJ A;  3V6C A;  1ITO A;  4BOS A;  2GFO A;  1YT7 A;  1ME4 A;  4CDF B;  3O0U A;  4PP2 E;  2B1N A;  3MTN A;  2DOS A;  2YJC A;  1AYU A;  1NB5 A;  1ATK A;  1JQP A;  4G54 A;  4K7C A;  1DF0 A;  1YVB A;  5E6J A;  4X6H A;  2HD5 A;  2DJG B;  1U9Q X;  1NQC A;  3PDF A;  4YYR A;  4X6J A;  3PW3 A;  1GMY A;  2BTW B;  3HWN A;  1CPJ A;  4WUR A;  4YYQ A;  3OVX A;  3USV A;  1F2A A;  1PVJ A;  2OZ2 A;  2R6N A;  3RNV A;  4BOP A;  3IFU A;  1PBH A;  2NQD B;  4P16 A;  2FTD A;  2HHN A;  4FK5 A;  5CVN B;  2WBF X;  5JZE A;  4PT5 A;  5CVM A;  3M99 A;  3WXF A;  1AYW A;  1TLO A;  1SP4 B;  2P86 A;  2Y6E A;  2AGA A;  2FT2 A;  1MEG A;  5A24 A;  4P6E A;  4MSX A;  1PAD A;  2ARY A;  3H7D A;  4DMX A;  1KXR A;  3KWB X;  1EWL A;  2PAD A;  2DC8 A;  4MZS A;  3RVW A;  2H7J A;  4Q8G A;  4RF0 A;  4AXL A;  4BOQ A;  2FRA A;  3PRM A;  3N3G A;  7PCK A;  1F2C A;  3BPF A;  4CDD B;  1GCB A;  4W5C A;  4W4U A;  4BPV A;  1PIP A;  4MZO A;  5EF4 A;  3MJ5 A;  3C0R A;  4BQV A;  1DKI A;  4FJC A;  4IUM A;  1QMY A;  1AU2 A;  4YYS A;  6PAD A;  1CQD A;  1STF E;  3P5V A;  3OF9 A;  3BOW A;  4I07 A;  1CJL A;  1PPD A;  4WA6 A;  2FO5 A;  4Q8H A;  4GUA A;  5F02 A;  2DCC A;  1GLO A;  3MP2 A;  1NPZ A;  4BOZ A;  3O1G A;  2DCB A;  3LXS A;  2AVW A;  3S3R A;  2DCD A;  4X6I A;  2HH5 A;  3I06 A;  1BY8 A;  2R9C A;  3KWZ A;  4YYU A;  3E1Z B;  2G8E A;  1M6D A;  1QXP A;  4YYV A;  1AU4 A;  4PI3 A;  1ZCM A;  2PNS A;  3CH2 X;  4CZW A;  3TNX A;  1POP A;  3BC3 A;  1U9X A;  3U8E A;  3BB7 A;  2BDZ A;  4N79 A;  2JQF R;  1VSN A;  4ZUX U;  1EWO A;  2PRE A;  3F75 A;  4MM3 B;  4XUI A;  2XU3 A;  2AUX A;  4W5B A;  3PT2 A;  4YVA A;  2YJ8 A;  2AS8 A;  2E02 A;  1SNK A;  2YJB A;  1NB3 A;  2P0R A;  3TMP A;  2XU4 A;  4QBB A;  1CB5 A;  5KO3 A;  4CDC B;  1QDQ A;  3H6S A;  3K9M A;  2NQA A;  2NQG A;  1KHQ A;  4I05 A;  4MI7 A;  1YK7 A;  4OW0 A;  2R9N A;  2R9O A;  1CVZ A;  2F7D A;  2AYO A;  3PSE A;  2AIM A;  4YYW A;  2DC7 A;  3HHI A;  4OEL A;  1Y4H A;  4D8B A;  3O65 A;  2DZY A;  4RKX A;  1CTE A;  4R3D A;  1PPO A;  4DMY A;  4N8W A;  1BQI A;  1MIR A;  3QJ3 A;  4RY2 A;  1IWD A;  4D8E A;  2FYE A;  2AUZ A;  2BU3 A;  3NHE A;  1CS8 A;  3OVZ A;  1TU6 A;  3QT4 A;  2BDL A;  5J94 A;  1EWM A;  1KFU L;  2G7Y A;  1NLJ A;  1PPP A;  3N4C A;  1PPN A;  2DC6 A;  2XU5 A;  3PRP A;  2C0Y A;  3IV2 A;  1PE6 A;  4IP3 A;  1NL6 A;  2PBH A;  4OVZ A;  1U9W A;  1O0E A;  5JH3 A;  1CV8 A;  1U5I A;  1EWP A;  4RF1 A;  2G6D A;  3KW9 A;  5PAD A;  3I3T A;  4HWY A;  2ACT A;  4A5U A;  2ATO A;  2HWK A;  3DF0 A;  1F29 A;  2O6X A;  3V6E A;  3BWK A;  1GEC E;  1HUC B;  2F1G A;  2DCA A;  1U9V A;  2E00 A;  3PBH A;  3QSD A;  2FRQ A;  4XR7 A;  1K3B B;  2CB5 A;  1MEM A;  1AYV A;  2VHS A;  2JTC A;  1VJV A;  1AU3 A;  4XZX A;  4BS5 A;  2B1M A;  3PNR A;  1A6R A;  3ZUA A;  1F2B A;  4P6G A;  3KSE A; 
#chains in the Genus database with same CATH homology
 1MS6 A;  2HXZ A;  4FIP A;  1DEU A;  3K24 A;  3D6S A;  2E01 A;  3MHS A;  3HHA A;  3RVV A;  4QH6 A;  2OP3 A;  2AYN A;  2JQG R;  4YV8 A;  3IEJ A;  2GHU A;  1KFX L;  8PCH A;  4AXM A;  2CIO A;  1AIM A;  4I04 A;  3KFQ A;  3N3K A;  2XU1 A;  2R9F A;  3KX1 A;  4QRG A;  4B55 A;  4N4Z A;  2AU1 A;  3BCN A;  2E03 A;  3F5V A;  3IUT A;  1BGO A;  3C9E A;  2IPP B;  3LFY A;  2G8J A;  2IBI A;  4KLB A;  3S3Q A;  1QOL A;  9PAP A;  4NV8 A;  1S4V A;  1ME3 A;  2DZZ A;  5K16 A;  2YJ2 A;  3AI8 A;  1KHP A;  3OIS A;  5CHT A;  3OF8 A;  1TL9 A;  2DC9 A;  3CH3 X;  1ICF A;  4QRX A;  2FUD A;  1BP4 A;  2DJF B;  5CVO B;  3KKU A;  4OEM A;  1AU0 A;  3WXG A;  2P7U A;  2OUL A;  3IHP A;  1PCI A;  1THE A;  3P5W A;  4BGF A;  5FPW A;  2VHF A;  5JA7 A;  4PAD A;  1YAL A;  1CSB B;  3IOQ A;  1W5R A;  2Y5B A;  1XKG A;  1YK8 A;  1X9Y A;  2NQI A;  3MHH A;  4BS6 A;  4BSQ A;  4CDE B;  3IMA A;  3P5X A;  1MHW A;  1Q6K A;  1MDW A;  1Y08 A;  1FH0 A;  3H8B A;  3HD3 A;  4QRV A;  2YJ9 A;  3GCB A;  3RVX A;  4PP1 A;  3WXE A;  3BPM A;  1ZIV A;  1EF7 A;  3P5U A;  3MOR A;  3H89 A;  1PXV A;  3B79 A;  5CHV A;  5EGW A;  3K8U A;  3ERV A;  2FQ9 A;  3H8C A;  3CBK A;  2R9M A;  1AEC A;  3CBJ A;  3V6C A;  1ITO A;  2GFO A;  1YT7 A;  1ME4 A;  4CDF B;  3O0U A;  4PP2 E;  2B1N A;  3MTN A;  2YJC A;  1AYU A;  1NB5 A;  4NV7 A;  1ATK A;  1JQP A;  4G54 A;  4K7C A;  1DF0 A;  1YVB A;  4X6H A;  2HD5 A;  2DJG B;  1U9Q X;  1NQC A;  3PDF A;  4YYR A;  4X6J A;  3PW3 A;  1GMY A;  3HWN A;  1CPJ A;  4YYQ A;  3OVX A;  3USV A;  1F2A A;  2OZ2 A;  2R6N A;  1PBH A;  2NQD B;  2FTD A;  2HHN A;  4FK5 A;  5CVN B;  2WBF X;  5CVM A;  3M99 A;  3WXF A;  1AYW A;  1TLO A;  1SP4 B;  2P86 A;  2Y6E A;  2FT2 A;  1MEG A;  5A24 A;  4P6E A;  4MSX A;  1PAD A;  2ARY A;  3H7D A;  4DMX A;  1KXR A;  3KWB X;  1EWL A;  2PAD A;  2DC8 A;  4MZS A;  3RVW A;  2H7J A;  4Q8G A;  3LTW A;  4AXL A;  2FRA A;  3N3G A;  7PCK A;  1F2C A;  3BPF A;  4CDD B;  1GCB A;  4W5C A;  4GUZ A;  4W4U A;  4BPV A;  1PIP A;  4MZO A;  5EF4 A;  4BQV A;  4FJC A;  1QMY A;  1AU2 A;  4YYS A;  6PAD A;  1CQD A;  1STF E;  3P5V A;  3OF9 A;  3BOW A;  4C5P A;  4I07 A;  1CJL A;  1PPD A;  4WA6 A;  2FO5 A;  4Q8H A;  5F02 A;  1E2T A;  2DCC A;  1GLO A;  1NPZ A;  3O1G A;  2DCB A;  3LXS A;  1W6F A;  2AVW A;  3S3R A;  2DCD A;  4X6I A;  2VFC A;  2HH5 A;  3I06 A;  1BY8 A;  2R9C A;  3KWZ A;  4YYU A;  3E1Z B;  2G8E A;  1M6D A;  1QXP A;  4YYV A;  1AU4 A;  2VFB A;  1ZCM A;  4PI3 A;  2PNS A;  3CH2 X;  4CZW A;  3TNX A;  1POP A;  3BC3 A;  1U9X A;  3U8E A;  2BDZ A;  4N79 A;  2JQF R;  1VSN A;  4ZUX U;  1EWO A;  2PRE A;  3F75 A;  4XUI A;  2XU3 A;  2AUX A;  4W5B A;  4YVA A;  2YJ8 A;  2AS8 A;  2E02 A;  1SNK A;  2YJB A;  1NB3 A;  2P0R A;  1W4T A;  2XU4 A;  4QBB A;  1CB5 A;  4CDC B;  1QDQ A;  3H6S A;  3K9M A;  2NQA A;  2NQG A;  1KHQ A;  4I05 A;  1YK7 A;  2R9N A;  1GX3 A;  2R9O A;  1CVZ A;  2F7D A;  2AYO A;  2AIM A;  4YYW A;  2DC7 A;  3HHI A;  4OEL A;  3D9W A;  1Y4H A;  2DZY A;  1CTE A;  1PPO A;  4DMY A;  4N8W A;  1BQI A;  1MIR A;  3QJ3 A;  4RY2 A;  1IWD A;  2FYE A;  2AUZ A;  3NHE A;  1CS8 A;  3OVZ A;  1TU6 A;  3QT4 A;  2BDL A;  5J94 A;  1EWM A;  1KFU L;  2G7Y A;  1NLJ A;  1PPP A;  3N4C A;  1PPN A;  2DC6 A;  2XU5 A;  2C0Y A;  3IV2 A;  1PE6 A;  1NL6 A;  2PBH A;  1U9W A;  1O0E A;  5JH3 A;  1CV8 A;  1U5I A;  1EWP A;  2G6D A;  3KW9 A;  5PAD A;  3I3T A;  4HWY A;  2ACT A;  2ATO A;  3DF0 A;  1F29 A;  2O6X A;  3V6E A;  3BWK A;  1GEC E;  1HUC B;  2F1G A;  2DCA A;  1U9V A;  2E00 A;  3PBH A;  3QSD A;  2FRQ A;  4XR7 A;  1K3B B;  2CB5 A;  1MEM A;  1AYV A;  2VHS A;  1VJV A;  1AU3 A;  4BS5 A;  2B1M A;  3PNR A;  1A6R A;  3ZUA A;  1F2B A;  4P6G A;  3KSE A;  2BSZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...