4IP3A

Complex structure of ospi and ubc13
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
192
structure length
192
Chain Sequence
b'NVNVKKLLESLNSKSLGDMDKDSELAATLQKMINPSGGDGNASGCALHACMAMLGYGVREAPVPNEISEYMTGFFHRHLEQIDSEGIVSHPNETYSKFRERIAENILQNTSKGSVVMISIEQATHWIAGFNDGEKIMFLDVQTGKGFNLYDPVEKSPDAFVDENSSVQVIHVSDQEFDHYANSSSWKSKRLC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ORF169b
publication title Structure Analysis of Ubc13 Inactivation
rcsb
source organism Shigella flexneri
molecule tags Unknown function/ligase
total genus 64
structure length 192
sequence length 192
ec nomenclature
pdb deposition date 2013-01-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.140 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 4ip3A00
4IP3A 3W31A 3W30A 3B21A 4XZXA
chains in the Genus database with same CATH superfamily
2G8EA 2DCAA 2CIOA 3MJ5A 2DCBA 1KHPA 4ZTBA 2O6XA 4K7CA 1TLOA 4PT5A 2AYNA 3BPMA 3N3KA 5EGWA 3W30A 1U5IA 2E00A 2Y6EA 3S3QA 3K9MA 2R6NA 1ATKA 2GFOA 4FJCA 2DC9A 3RNVA 4CDFB 1PPPA 2DJFB 2NQGA 2G6DA 3PT2A 3MORA 2JQFR 4X6JA 3BOWA 4BS5A 4N4ZA 5CHVA 3IHPA 2R9CA 3KW9A 1GLOA 1U9XA 4P6EA 4I07A 2HXZA 4MM3B 2J7QC 1CSBB 6PADA 1AYUA 1BGOA 4CDEB 2FRAA 4BPVA 2PBHA 4RY2A 1CV8A 2HH5A 1AU3A 1DF0A 4RF0A 1CS8A 2BU3A 2OP3A 4KLBA 5EZQA 2NQIA 3PBHA 3IFUA 5CVNB 2BDLA 3PW3A 3O1GA 4XR7A 3PDFA 3RVWA 2YJBA 1NLJA 1K3BB 1JQPA 2AU1A 1F2BA 4N8WA 2DC7A 4A5UA 2XU5A 4QRGA 1CB5A 4PI3A 1YK8A 4OW0A 4OVZA 4D8IA 2H7JA 1TL9A 1GECE 1SP4B 5KO3A 1MDWA 3P5UA 1GMYA 4PP2E 2VHFA 4BS6A 3MHHA 3KWBX 2J7QA 3WXEA 3TNXA 1BY8A 3AI8A 3S3RA 3C9EA 2FUDA 3B79A 3CBJA 8PCHA 3N4CA 2E03A 1YALA 2Z84A 4I05A 4BSQA 9PAPA 2Y5BA 1Y08A 4RKXA 5K16A 4BOPA 3CBKA 1PVJA 2F1GA 4OELA 2F7DA 2P7UA 4MI7A 1F29A 2VHSA 4M0WA 2AIMA 3HD3A 1NL6A 3IV2A 4MZOA 4MZSA 3PHXA 2YJ2A 4RF1A 3QJ3A 2DCDA 2ATOA 2R9NA 1QXPA 1QMYA 2IBIA 3F5VA 2OZ2A 3PRPA 1TU6A 1POPA 2JQGR 3KSEA 1EF7A 2BTWA 4FK5A 3HHIA 2C0YA 4Q8GA 3IMAA 1NB5A 2UZJA 2B1MA 2G8JA 1XKGA 2NQDB 4R3DA 1KHQA 5A24A 1AU4A 4WURA 1PIPA 4BQVA 5JA7A 3PNRA 1GCBA 1KFXL 2XU3A 3BB7A 1PE6A 2ARYA 3USVA 5CVMA 3LXSA 2OULA 4P6GA 2R9FA 2DJGB 4OEMA 1YVBA 3BC3A 1PPNA 2DOSA 3P5VA 1THEA 4OVZB 3ZNHA 3BBAA 1MEGA 3I06A 4AXMA 5JZEA 4QRXA 1PBHA 2FRQA 3MP2A 4BOQA 4HXDB 5EF4A 2XU4A 3H8BA 1QDQA 4ZUXU 3K8UA 3HWNA 1MIRA 5CHTA 1UKFA 2AS8A 4AXLA 1BP4A 2FT2A 4G54A 1PADA 1AYVA 2FO5A 1U9WA 2XU1A 1STFE 1NPZA 4DMXA 5JH3A 1DKIA 3IEJA 2HWKA 1VJVA 1FH0A 3CH3X 3H6SA 4YV8A 3H8CA 1ICFA 1F2CA 2DZYA 1M6DA 2R9OA 3KFQA 3IOQA 5CVOB 1SNKA 1A6RA 3PHUA 3NHEA 4D8BA 2HHNA 3BY4A 3QSDA 3KWZA 2PNSA 4RNAA 1PXVA 3U8EA 1MHWA 4MSXA 2DZZA 4W5CA 1DEUA 2DCCA 1F2AA 2FE8A 1S4VA 4YYQA 4YYSA 1YK7A 4YYVA 3HHAA 3H89A 4BOUA 1ME4A 2BTWB 3I3TA 1NB3A 4IP3A 1AYWA 3OVXA 4D8EA 4REZA 1O0EA 3B21A 4I04A 3OQCA 4FIPA 4IUMA 3BCNA 3PHWA 1AU0A 4WA6A 3K24A 4CZWA 3QT4A 3W31A 1Q6KA 1U9QX 5J94A 2FTDA 3IUTA 1Y4HA 1YZBA 3KX1A 2YJ9A 2IPPB 2AVWA 4QH6A 3MTVA 3O0UA 2P0RA 3ERVA 2DC6A 4W5BA 1IWDA 4DMYA 2YJCA 5E6JA 2FQ9A 3BPFA 1AECA 2GHUA 2AGAA 2G7YA 4YYUA 3H7DA 3OISA 4XZXA 2AYOA 3TMPA 4YYWA 2CB5A 1MEMA 3WXFA 2B1NA 3GCBA 3PSEA 3P5XA 5F02A 3MTNA 2BDZA 1KXRA 2HD5A 4PADA 1PPOA 2ACTA 1KFUL 3D6SA 3ZUAA 3BWKA 1EWMA 2AUXA 3TRKA 1HUCB 3DF0A 4PP1A 4CDCB 2FYEA 4QRVA 2JRIA 2E02A 3OVZA 1ITOA 3V6EA 1CTEA 4N79A 4CDDB 1NQCA 1YT7A 2E01A 5PADA 1EWOA 3N3GA 3KKUA 1CVZA 3P5WA 3C0RA 3CH2X 1PCIA 2P86A 5EZSA 4W4UA 4XUIA 1MS6A 1ZCMA 2PREA 5FPWA 3E1ZB 4YYRA 1CJLA 3OF9A 1AIMA 3PRMA 4YVAA 3WXGA 2R9MA 3F75A 1CPJA 1ZIVA 3MHSA 1CQDA 2YJ8A 4HWYA 3LFYA 3V6CA 4BOSA 3OF8A 4X6HA 3RVXA 1PPDA 3O65A 4GUAA 2NQAA 4Q8HA 1ME3A 2WBFX 1U9VA 1QOLA 3M99A 7PCKA 4P16A 1AU2A 2DC8A 1X9YA 1BQIA 2PADA 1VSNA 4X6IA 2AUZA 4QBBA 3RVVA 1EWLA 2JTCA 3E9SA 1EWPA 4BOZA
chains in the Genus database with same CATH topology
3MP2A 5E6JA 4BOQA 4HXDB 3MJ5A 4ZTBA 2AGAA 1UKFA 4PT5A 4XZXA 3TMPA 3W30A 3PSEA 2Z84A 4RKXA 4BOPA 1DKIA 1PVJA 2HWKA 3RNVA 3PT2A 3TRKA 4MI7A 2JRIA 4M0WA 2J7QA 3PHXA 3PHUA 4MM3B 2J7QC 3C0RA 4RF1A 4D8BA 3BY4A 4RNAA 5EZSA 3PRPA 2FE8A 4RF0A 2BU3A 3PRMA 2BTWA 5EZQA 2UZJA 4BOUA 3IFUA 2BTWB 4R3DA 4IP3A 4D8EA 4REZA 4WURA 3B21A 3OQCA 4IUMA 4BOSA 3BB7A 3PHWA 3O65A 4A5UA 4GUAA 3W31A 4OW0A 4OVZA 4D8IA 4P16A 2DOSA 1YZBA 5KO3A 3ZNHA 4OVZB 3BBAA 3MTVA 2JTCA 3E9SA 5JZEA 4BOZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IP3 A;  3W31 A;  3W30 A;  3B21 A;  4XZX A; 
#chains in the Genus database with same CATH topology
 2G8E A;  2DCA A;  2CIO A;  3MJ5 A;  2DCB A;  1KHP A;  4ZTB A;  2O6X A;  4K7C A;  1TLO A;  4PT5 A;  2AYN A;  3BPM A;  3N3K A;  5EGW A;  3W30 A;  1U5I A;  2E00 A;  2Y6E A;  3S3Q A;  3K9M A;  2R6N A;  1ATK A;  2GFO A;  4FJC A;  2DC9 A;  3RNV A;  4CDF B;  1PPP A;  2DJF B;  2NQG A;  2G6D A;  3PT2 A;  3MOR A;  2JQF R;  4X6J A;  3BOW A;  4BS5 A;  4N4Z A;  5CHV A;  3IHP A;  2R9C A;  3KW9 A;  1GLO A;  1U9X A;  4P6E A;  4I07 A;  2HXZ A;  4MM3 B;  2J7Q C;  1CSB B;  6PAD A;  1AYU A;  1BGO A;  4CDE B;  2FRA A;  4BPV A;  2PBH A;  4RY2 A;  1CV8 A;  2HH5 A;  1AU3 A;  1DF0 A;  4RF0 A;  1CS8 A;  2BU3 A;  2OP3 A;  4KLB A;  5EZQ A;  2NQI A;  3PBH A;  3IFU A;  5CVN B;  2BDL A;  3PW3 A;  3O1G A;  4XR7 A;  3PDF A;  3RVW A;  2YJB A;  1NLJ A;  1K3B B;  1JQP A;  2AU1 A;  1F2B A;  4N8W A;  2DC7 A;  4A5U A;  2XU5 A;  4QRG A;  1CB5 A;  4PI3 A;  1YK8 A;  4OW0 A;  4OVZ A;  4D8I A;  2H7J A;  1TL9 A;  1GEC E;  1SP4 B;  5KO3 A;  1MDW A;  3P5U A;  1GMY A;  4PP2 E;  2VHF A;  4BS6 A;  3MHH A;  3KWB X;  2J7Q A;  3WXE A;  3TNX A;  1BY8 A;  3AI8 A;  3S3R A;  3C9E A;  2FUD A;  3B79 A;  3CBJ A;  8PCH A;  3N4C A;  2E03 A;  1YAL A;  2Z84 A;  4I05 A;  4BSQ A;  9PAP A;  2Y5B A;  1Y08 A;  4RKX A;  5K16 A;  4BOP A;  3CBK A;  1PVJ A;  2F1G A;  4OEL A;  2F7D A;  2P7U A;  4MI7 A;  1F29 A;  2VHS A;  4M0W A;  2AIM A;  3HD3 A;  1NL6 A;  3IV2 A;  4MZO A;  4MZS A;  3PHX A;  2YJ2 A;  4RF1 A;  3QJ3 A;  2DCD A;  2ATO A;  2R9N A;  1QXP A;  1QMY A;  2IBI A;  3F5V A;  2OZ2 A;  3PRP A;  1TU6 A;  1POP A;  2JQG R;  3KSE A;  1EF7 A;  2BTW A;  4FK5 A;  3HHI A;  2C0Y A;  4Q8G A;  3IMA A;  1NB5 A;  2UZJ A;  2B1M A;  2G8J A;  1XKG A;  2NQD B;  4R3D A;  1KHQ A;  5A24 A;  1AU4 A;  4WUR A;  1PIP A;  4BQV A;  5JA7 A;  3PNR A;  1GCB A;  1KFX L;  2XU3 A;  3BB7 A;  1PE6 A;  2ARY A;  3USV A;  5CVM A;  3LXS A;  2OUL A;  4P6G A;  2R9F A;  2DJG B;  4OEM A;  1YVB A;  3BC3 A;  1PPN A;  2DOS A;  3P5V A;  1THE A;  4OVZ B;  3ZNH A;  3BBA A;  1MEG A;  3I06 A;  4AXM A;  5JZE A;  4QRX A;  1PBH A;  2FRQ A;  3MP2 A;  4BOQ A;  4HXD B;  5EF4 A;  2XU4 A;  3H8B A;  1QDQ A;  4ZUX U;  3K8U A;  3HWN A;  1MIR A;  5CHT A;  1UKF A;  2AS8 A;  4AXL A;  1BP4 A;  2FT2 A;  4G54 A;  1PAD A;  1AYV A;  2FO5 A;  1U9W A;  2XU1 A;  1STF E;  1NPZ A;  4DMX A;  5JH3 A;  1DKI A;  3IEJ A;  2HWK A;  1VJV A;  1FH0 A;  3CH3 X;  3H6S A;  4YV8 A;  3H8C A;  1ICF A;  1F2C A;  2DZY A;  1M6D A;  2R9O A;  3KFQ A;  3IOQ A;  5CVO B;  1SNK A;  1A6R A;  3PHU A;  3NHE A;  4D8B A;  2HHN A;  3BY4 A;  3QSD A;  3KWZ A;  2PNS A;  4RNA A;  1PXV A;  3U8E A;  1MHW A;  4MSX A;  2DZZ A;  4W5C A;  1DEU A;  2DCC A;  1F2A A;  2FE8 A;  1S4V A;  4YYQ A;  4YYS A;  1YK7 A;  4YYV A;  3HHA A;  3H89 A;  4BOU A;  1ME4 A;  2BTW B;  3I3T A;  1NB3 A;  4IP3 A;  1AYW A;  3OVX A;  4D8E A;  4REZ A;  1O0E A;  3B21 A;  4I04 A;  3OQC A;  4FIP A;  4IUM A;  3BCN A;  3PHW A;  1AU0 A;  4WA6 A;  3K24 A;  4CZW A;  3QT4 A;  3W31 A;  1Q6K A;  1U9Q X;  5J94 A;  2FTD A;  3IUT A;  1Y4H A;  1YZB A;  3KX1 A;  2YJ9 A;  2IPP B;  2AVW A;  4QH6 A;  3MTV A;  3O0U A;  2P0R A;  3ERV A;  2DC6 A;  4W5B A;  1IWD A;  4DMY A;  2YJC A;  5E6J A;  2FQ9 A;  3BPF A;  1AEC A;  2GHU A;  2AGA A;  2G7Y A;  4YYU A;  3H7D A;  3OIS A;  4XZX A;  2AYO A;  3TMP A;  4YYW A;  2CB5 A;  1MEM A;  3WXF A;  2B1N A;  3GCB A;  3PSE A;  3P5X A;  5F02 A;  3MTN A;  2BDZ A;  1KXR A;  2HD5 A;  4PAD A;  1PPO A;  2ACT A;  1KFU L;  3D6S A;  3ZUA A;  3BWK A;  1EWM A;  2AUX A;  3TRK A;  1HUC B;  3DF0 A;  4PP1 A;  4CDC B;  2FYE A;  4QRV A;  2JRI A;  2E02 A;  3OVZ A;  1ITO A;  3V6E A;  1CTE A;  4N79 A;  4CDD B;  1NQC A;  1YT7 A;  2E01 A;  5PAD A;  1EWO A;  3N3G A;  3KKU A;  1CVZ A;  3P5W A;  3C0R A;  3CH2 X;  1PCI A;  2P86 A;  5EZS A;  4W4U A;  4XUI A;  1MS6 A;  1ZCM A;  2PRE A;  5FPW A;  3E1Z B;  4YYR A;  1CJL A;  3OF9 A;  1AIM A;  3PRM A;  4YVA A;  3WXG A;  2R9M A;  3F75 A;  1CPJ A;  1ZIV A;  3MHS A;  1CQD A;  2YJ8 A;  4HWY A;  3LFY A;  3V6C A;  4BOS A;  3OF8 A;  4X6H A;  3RVX A;  1PPD A;  3O65 A;  4GUA A;  2NQA A;  4Q8H A;  1ME3 A;  2WBF X;  1U9V A;  1QOL A;  3M99 A;  7PCK A;  4P16 A;  1AU2 A;  2DC8 A;  1X9Y A;  1BQI A;  2PAD A;  1VSN A;  4X6I A;  2AUZ A;  4QBB A;  3RVV A;  1EWL A;  2JTC A;  3E9S A;  1EWP A;  4BOZ A; 
#chains in the Genus database with same CATH homology
 3MP2 A;  5E6J A;  4BOQ A;  4HXD B;  3MJ5 A;  4ZTB A;  2AGA A;  1UKF A;  4PT5 A;  4XZX A;  3TMP A;  3W30 A;  3PSE A;  2Z84 A;  4RKX A;  4BOP A;  1DKI A;  1PVJ A;  2HWK A;  3RNV A;  3PT2 A;  3TRK A;  4MI7 A;  2JRI A;  4M0W A;  2J7Q A;  3PHX A;  3PHU A;  4MM3 B;  2J7Q C;  3C0R A;  4RF1 A;  4D8B A;  3BY4 A;  4RNA A;  5EZS A;  3PRP A;  2FE8 A;  4RF0 A;  2BU3 A;  3PRM A;  2BTW A;  5EZQ A;  2UZJ A;  4BOU A;  3IFU A;  2BTW B;  4R3D A;  4IP3 A;  4D8E A;  4REZ A;  4WUR A;  3B21 A;  3OQC A;  4IUM A;  4BOS A;  3BB7 A;  3PHW A;  3O65 A;  4A5U A;  4GUA A;  3W31 A;  4OW0 A;  4OVZ A;  4D8I A;  4P16 A;  2DOS A;  1YZB A;  5KO3 A;  3ZNH A;  4OVZ B;  3BBA A;  3MTV A;  2JTC A;  3E9S A;  5JZE A;  4BOZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...