4IP3A

Complex structure of ospi and ubc13
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
192
structure length
192
Chain Sequence
NVNVKKLLESLNSKSLGDMDKDSELAATLQKMINPSGGDGNASGCALHACMAMLGYGVREAPVPNEISEYMTGFFHRHLEQIDSEGIVSHPNETYSKFRERIAENILQNTSKGSVVMISIEQATHWIAGFNDGEKIMFLDVQTGKGFNLYDPVEKSPDAFVDENSSVQVIHVSDQEFDHYANSSSWKSKRLC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ORF169b
publication title Structure Analysis of Ubc13 Inactivation
rcsb
source organism Shigella flexneri
molecule tags Unknown function/ligase
total genus 64
structure length 192
sequence length 192
ec nomenclature
pdb deposition date 2013-01-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.140 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 4ip3A00
3W31A 4IP3A 4XZXA 3W30A 3B21A
chains in the Genus database with same CATH superfamily
1TLOA 3S3RA 1O0EA 3IUTA 2R9CA 3M99A 1PVJA 2DCAA 3W30A 3I3TA 2JQFR 3N4CA 1ZIVA 1K3BB 3AI8A 4P6GA 1CQDA 2XU4A 2BTWB 2PBHA 4BS5A 2AU1A 2JTCA 1U9VA 3PSEA 4IUMA 2PNSA 3OISA 4D8IA 4YYSA 4WURA 3V6EA 5J94A 1QOLA 1VSNA 3F75A 3OF8A 1PADA 1EWLA 1ME3A 1YT7A 4Q8HA 4A5UA 4RF0A 2PREA 4X6JA 3C0RA 4KLBA 2NQDB 3CBJA 1F2CA 4CZWA 3KX1A 3V6CA 3CBKA 4FJCA 2HHNA 4PI3A 2HD5A 3W31A 1ICFA 2XU5A 2E03A 2GFOA 1POPA 3QSDA 4I05A 4OW0A 4D8EA 6PADA 4REZA 3OF9A 2H7JA 4CDFB 2R9OA 1F2BA 4PP1A 1M6DA 3KW9A 2YJCA 3IFUA 2AUZA 1VJVA 1U9XA 2AUXA 5F02A 2R9FA 4AXMA 4QRVA 3MHSA 1PE6A 1F29A 2BDZA 3N3GA 3ZUAA 2DCBA 2XU1A 4W5CA 1DEUA 1TU6A 2FO5A 3PNRA 2HXZA 1KHPA 2FE8A 1CJLA 1ATKA 3PRPA 2DCDA 3RVXA 3O0UA 4YYQA 3B79A 3BWKA 1CVZA 5CHTA 4MZOA 4QH6A 2NQAA 1NPZA 2G8JA 2R6NA 2DC9A 4AXLA 1QDQA 1QMYA 4RKXA 3U8EA 1CSBB 3P5VA 3KFQA 2ACTA 3DF0A 3KKUA 3RNVA 4MI7A 3H8CA 3S3QA 1BQIA 1XKGA 3WXGA 3K9MA 4RY2A 2HWKA 3BBAA 1AYVA 5A24A 1DKIA 2OULA 3N3KA 1EF7A 3P5UA 1EWMA 2JQGR 3H6SA 4HXDB 4YYWA 3H89A 4YYUA 1MHWA 1PPPA 1AECA 4BS6A 4YYVA 3H7DA 3TMPA 2AS8A 4OVZB 4D8BA 4P16A 2F7DA 2DC6A 4XR7A 2YJ2A 1U9QX 1PPNA 4RNAA 1GECE 1GMYA 4BOPA 5CVOB 1Q6KA 5E6JA 3USVA 2AGAA 1ZCMA 4YYRA 1FH0A 2BU3A 3P5XA 4DMXA 2F1GA 4YV8A 3MJ5A 3PHWA 4PP2E 3OVXA 3F5VA 2R9MA 1YALA 4ZUXU 1GLOA 1PPDA 1EWOA 1BP4A 2FUDA 2Y6EA 2VHFA 5CVNB 2C0YA 4GUAA 3MP2A 3IHPA 5CVMA 3MHHA 1U9WA 2FRAA 1PBHA 1U5IA 2G7YA 1SP4B 7PCKA 4P6EA 2CIOA 3LFYA 2ATOA 3C9EA 2R9NA 3ERVA 2B1MA 3CH2X 1UKFA 2OZ2A 3BY4A 1Y08A 5EGWA 3QT4A 1YZBA 2DC7A 1F2AA 4OEMA 4MSXA 3QJ3A 1KFXL 1NB3A 1Y4HA 3P5WA 2FT2A 2P86A 2AYOA 2J7QC 5FPWA 3KWZA 1YK7A 3BPMA 1ME4A 1NL6A 3E1ZB 1THEA 1AU2A 2XU3A 2B1NA 1AU0A 3OVZA 1JQPA 4BOZA 3MTNA 1AU3A 4CDEB 3TNXA 5CHVA 4I07A 1CB5A 3PHUA 2VHSA 3ZNHA 9PAPA 4W4UA 2BTWA 1MEMA 3GCBA 4N8WA 1DF0A 4WA6A 5EF4A 1YK8A 3BC3A 1STFE 2G8EA 2CB5A 2P7UA 2FTDA 1YVBA 4I04A 4QBBA 2IBIA 4BQVA 2BDLA 1CS8A 5PADA 3NHEA 4QRGA 3PT2A 2NQIA 1NLJA 3PHXA 4RF1A 8PCHA 2HH5A 3E9SA 3IV2A 1MS6A 4R3DA 1AIMA 4ZTBA 3O1GA 4OELA 1TL9A 2DCCA 3H8BA 2AVWA 2Y5BA 1MIRA 2DOSA 3RVWA 3BCNA 4IP3A 2WBFX 1PPOA 3D6SA 2YJ9A 3CH3X 4X6HA 1CTEA 2DC8A 4BOSA 4YVAA 5JZEA 2PADA 3O65A 1MEGA 2FRQA 4N4ZA 2YJBA 3KWBX 3MTVA 4BOQA 2E02A 1KHQA 4N79A 3PW3A 1GCBA 2OP3A 2FYEA 2GHUA 2O6XA 2YJ8A 4K7CA 2Z84A 4M0WA 3HD3A 4BOUA 2G6DA 3KSEA 3OQCA 4CDCB 5JH3A 5JA7A 2J7QA 3BB7A 3IOQA 1BY8A 2DZYA 3MORA 2JRIA 3BOWA 1IWDA 2AIMA 2NQGA 3PDFA 4DMYA 1NB5A 1BGOA 2E01A 3I06A 1NQCA 1KFUL 1A6RA 1KXRA 3HHIA 3K24A 3BPFA 4HWYA 1AU4A 1AYWA 5KO3A 2P0RA 2FQ9A 3PRMA 4MZSA 4FK5A 2ARYA 1EWPA 4PT5A 4G54A 4XUIA 3RVVA 1CPJA 4X6IA 3PBHA 2UZJA 1PIPA 4PADA 3TRKA 1HUCB 3HWNA 4OVZA 3WXFA 4CDDB 1AYUA 3IEJA 5EZQA 1X9YA 1ITOA 1QXPA 3LXSA 3HHAA 1CV8A 2E00A 5K16A 4MM3B 4FIPA 1PCIA 2AYNA 1S4VA 3IMAA 5EZSA 4Q8GA 2DJGB 4W5BA 1PXVA 3WXEA 1SNKA 2IPPB 4XZXA 4QRXA 2DZZA 4BPVA 4BSQA 1MDWA 3K8UA 3B21A 2DJFB
chains in the Genus database with same CATH topology
5JZEA 3O65A 1YZBA 1PVJA 4RKXA 3MTVA 4BOQA 3RNVA 3W30A 4MI7A 2BTWB 2HWKA 2Z84A 2J7QC 2JTCA 3BBAA 4M0WA 1DKIA 3PSEA 4BOUA 4IUMA 3OQCA 4HXDB 4D8IA 4WURA 2J7QA 3BB7A 3TMPA 2JRIA 4OVZB 4D8BA 4P16A 4A5UA 4RF0A 4BOZA 3C0RA 4RNAA 4BOPA 3PHUA 3ZNHA 5E6JA 2AGAA 2BTWA 2BU3A 3W31A 5KO3A 3PRMA 3MJ5A 3PHWA 4OW0A 4PT5A 4D8EA 4REZA 2UZJA 3TRKA 4OVZA 3IFUA 5EZQA 3PT2A 3PHXA 4GUAA 3MP2A 4MM3B 4RF1A 3E9SA 4R3DA 4ZTBA 5EZSA 2DOSA 2FE8A 4IP3A 4XZXA 1UKFA 4BOSA 3B21A 3BY4A 3PRPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3W31 A;  4IP3 A;  4XZX A;  3W30 A;  3B21 A; 
#chains in the Genus database with same CATH topology
 1TLO A;  3S3R A;  1O0E A;  3IUT A;  2R9C A;  3M99 A;  1PVJ A;  2DCA A;  3W30 A;  3I3T A;  2JQF R;  3N4C A;  1ZIV A;  1K3B B;  3AI8 A;  4P6G A;  1CQD A;  2XU4 A;  2BTW B;  2PBH A;  4BS5 A;  2AU1 A;  2JTC A;  1U9V A;  3PSE A;  4IUM A;  2PNS A;  3OIS A;  4D8I A;  4YYS A;  4WUR A;  3V6E A;  5J94 A;  1QOL A;  1VSN A;  3F75 A;  3OF8 A;  1PAD A;  1EWL A;  1ME3 A;  1YT7 A;  4Q8H A;  4A5U A;  4RF0 A;  2PRE A;  4X6J A;  3C0R A;  4KLB A;  2NQD B;  3CBJ A;  1F2C A;  4CZW A;  3KX1 A;  3V6C A;  3CBK A;  4FJC A;  2HHN A;  4PI3 A;  2HD5 A;  3W31 A;  1ICF A;  2XU5 A;  2E03 A;  2GFO A;  1POP A;  3QSD A;  4I05 A;  4OW0 A;  4D8E A;  6PAD A;  4REZ A;  3OF9 A;  2H7J A;  4CDF B;  2R9O A;  1F2B A;  4PP1 A;  1M6D A;  3KW9 A;  2YJC A;  3IFU A;  2AUZ A;  1VJV A;  1U9X A;  2AUX A;  5F02 A;  2R9F A;  4AXM A;  4QRV A;  3MHS A;  1PE6 A;  1F29 A;  2BDZ A;  3N3G A;  3ZUA A;  2DCB A;  2XU1 A;  4W5C A;  1DEU A;  1TU6 A;  2FO5 A;  3PNR A;  2HXZ A;  1KHP A;  2FE8 A;  1CJL A;  1ATK A;  3PRP A;  2DCD A;  3RVX A;  3O0U A;  4YYQ A;  3B79 A;  3BWK A;  1CVZ A;  5CHT A;  4MZO A;  4QH6 A;  2NQA A;  1NPZ A;  2G8J A;  2R6N A;  2DC9 A;  4AXL A;  1QDQ A;  1QMY A;  4RKX A;  3U8E A;  1CSB B;  3P5V A;  3KFQ A;  2ACT A;  3DF0 A;  3KKU A;  3RNV A;  4MI7 A;  3H8C A;  3S3Q A;  1BQI A;  1XKG A;  3WXG A;  3K9M A;  4RY2 A;  2HWK A;  3BBA A;  1AYV A;  5A24 A;  1DKI A;  2OUL A;  3N3K A;  1EF7 A;  3P5U A;  1EWM A;  2JQG R;  3H6S A;  4HXD B;  4YYW A;  3H89 A;  4YYU A;  1MHW A;  1PPP A;  1AEC A;  4BS6 A;  4YYV A;  3H7D A;  3TMP A;  2AS8 A;  4OVZ B;  4D8B A;  4P16 A;  2F7D A;  2DC6 A;  4XR7 A;  2YJ2 A;  1U9Q X;  1PPN A;  4RNA A;  1GEC E;  1GMY A;  4BOP A;  5CVO B;  1Q6K A;  5E6J A;  3USV A;  2AGA A;  1ZCM A;  4YYR A;  1FH0 A;  2BU3 A;  3P5X A;  4DMX A;  2F1G A;  4YV8 A;  3MJ5 A;  3PHW A;  4PP2 E;  3OVX A;  3F5V A;  2R9M A;  1YAL A;  4ZUX U;  1GLO A;  1PPD A;  1EWO A;  1BP4 A;  2FUD A;  2Y6E A;  2VHF A;  5CVN B;  2C0Y A;  4GUA A;  3MP2 A;  3IHP A;  5CVM A;  3MHH A;  1U9W A;  2FRA A;  1PBH A;  1U5I A;  2G7Y A;  1SP4 B;  7PCK A;  4P6E A;  2CIO A;  3LFY A;  2ATO A;  3C9E A;  2R9N A;  3ERV A;  2B1M A;  3CH2 X;  1UKF A;  2OZ2 A;  3BY4 A;  1Y08 A;  5EGW A;  3QT4 A;  1YZB A;  2DC7 A;  1F2A A;  4OEM A;  4MSX A;  3QJ3 A;  1KFX L;  1NB3 A;  1Y4H A;  3P5W A;  2FT2 A;  2P86 A;  2AYO A;  2J7Q C;  5FPW A;  3KWZ A;  1YK7 A;  3BPM A;  1ME4 A;  1NL6 A;  3E1Z B;  1THE A;  1AU2 A;  2XU3 A;  2B1N A;  1AU0 A;  3OVZ A;  1JQP A;  4BOZ A;  3MTN A;  1AU3 A;  4CDE B;  3TNX A;  5CHV A;  4I07 A;  1CB5 A;  3PHU A;  2VHS A;  3ZNH A;  9PAP A;  4W4U A;  2BTW A;  1MEM A;  3GCB A;  4N8W A;  1DF0 A;  4WA6 A;  5EF4 A;  1YK8 A;  3BC3 A;  1STF E;  2G8E A;  2CB5 A;  2P7U A;  2FTD A;  1YVB A;  4I04 A;  4QBB A;  2IBI A;  4BQV A;  2BDL A;  1CS8 A;  5PAD A;  3NHE A;  4QRG A;  3PT2 A;  2NQI A;  1NLJ A;  3PHX A;  4RF1 A;  8PCH A;  2HH5 A;  3E9S A;  3IV2 A;  1MS6 A;  4R3D A;  1AIM A;  4ZTB A;  3O1G A;  4OEL A;  1TL9 A;  2DCC A;  3H8B A;  2AVW A;  2Y5B A;  1MIR A;  2DOS A;  3RVW A;  3BCN A;  4IP3 A;  2WBF X;  1PPO A;  3D6S A;  2YJ9 A;  3CH3 X;  4X6H A;  1CTE A;  2DC8 A;  4BOS A;  4YVA A;  5JZE A;  2PAD A;  3O65 A;  1MEG A;  2FRQ A;  4N4Z A;  2YJB A;  3KWB X;  3MTV A;  4BOQ A;  2E02 A;  1KHQ A;  4N79 A;  3PW3 A;  1GCB A;  2OP3 A;  2FYE A;  2GHU A;  2O6X A;  2YJ8 A;  4K7C A;  2Z84 A;  4M0W A;  3HD3 A;  4BOU A;  2G6D A;  3KSE A;  3OQC A;  4CDC B;  5JH3 A;  5JA7 A;  2J7Q A;  3BB7 A;  3IOQ A;  1BY8 A;  2DZY A;  3MOR A;  2JRI A;  3BOW A;  1IWD A;  2AIM A;  2NQG A;  3PDF A;  4DMY A;  1NB5 A;  1BGO A;  2E01 A;  3I06 A;  1NQC A;  1KFU L;  1A6R A;  1KXR A;  3HHI A;  3K24 A;  3BPF A;  4HWY A;  1AU4 A;  1AYW A;  5KO3 A;  2P0R A;  2FQ9 A;  3PRM A;  4MZS A;  4FK5 A;  2ARY A;  1EWP A;  4PT5 A;  4G54 A;  4XUI A;  3RVV A;  1CPJ A;  4X6I A;  3PBH A;  2UZJ A;  1PIP A;  4PAD A;  3TRK A;  1HUC B;  3HWN A;  4OVZ A;  3WXF A;  4CDD B;  1AYU A;  3IEJ A;  5EZQ A;  1X9Y A;  1ITO A;  1QXP A;  3LXS A;  3HHA A;  1CV8 A;  2E00 A;  5K16 A;  4MM3 B;  4FIP A;  1PCI A;  2AYN A;  1S4V A;  3IMA A;  5EZS A;  4Q8G A;  2DJG B;  4W5B A;  1PXV A;  3WXE A;  1SNK A;  2IPP B;  4XZX A;  4QRX A;  2DZZ A;  4BPV A;  4BSQ A;  1MDW A;  3K8U A;  3B21 A;  2DJF B; 
#chains in the Genus database with same CATH homology
 5JZE A;  3O65 A;  1YZB A;  1PVJ A;  4RKX A;  3MTV A;  4BOQ A;  3RNV A;  3W30 A;  4MI7 A;  2BTW B;  2HWK A;  2Z84 A;  2J7Q C;  2JTC A;  3BBA A;  4M0W A;  1DKI A;  3PSE A;  4BOU A;  4IUM A;  3OQC A;  4HXD B;  4D8I A;  4WUR A;  2J7Q A;  3BB7 A;  3TMP A;  2JRI A;  4OVZ B;  4D8B A;  4P16 A;  4A5U A;  4RF0 A;  4BOZ A;  3C0R A;  4RNA A;  4BOP A;  3PHU A;  3ZNH A;  5E6J A;  2AGA A;  2BTW A;  2BU3 A;  3W31 A;  5KO3 A;  3PRM A;  3MJ5 A;  3PHW A;  4OW0 A;  4PT5 A;  4D8E A;  4REZ A;  2UZJ A;  3TRK A;  4OVZ A;  3IFU A;  5EZQ A;  3PT2 A;  3PHX A;  4GUA A;  3MP2 A;  4MM3 B;  4RF1 A;  3E9S A;  4R3D A;  4ZTB A;  5EZS A;  2DOS A;  2FE8 A;  4IP3 A;  4XZX A;  1UKF A;  4BOS A;  3B21 A;  3BY4 A;  3PRP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...