4IP3A

Complex structure of ospi and ubc13
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
192
structure length
192
Chain Sequence
NVNVKKLLESLNSKSLGDMDKDSELAATLQKMINPSGGDGNASGCALHACMAMLGYGVREAPVPNEISEYMTGFFHRHLEQIDSEGIVSHPNETYSKFRERIAENILQNTSKGSVVMISIEQATHWIAGFNDGEKIMFLDVQTGKGFNLYDPVEKSPDAFVDENSSVQVIHVSDQEFDHYANSSSWKSKRLC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function/ligase
molecule keywords ORF169b
publication title Structure Analysis of Ubc13 Inactivation
rcsb
source organism Shigella flexneri
total genus 64
structure length 192
sequence length 192
ec nomenclature
pdb deposition date 2013-01-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.140 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 4ip3A00
3B21A 3W31A 3W30A 4IP3A 4XZXA
chains in the Genus database with same CATH superfamily
2FTDA 3RVWA 3HWNA 6PADA 1KFXL 3BCNA 4QRXA 4GUAA 4PP1A 5EF4A 2F1GA 3HHAA 5K16A 3B79A 1PADA 2GFOA 1CVZA 4WURA 3PHWA 2DC9A 2YJ2A 3C9EA 3MTNA 2VHFA 4W4UA 4RF0A 2E03A 2JRIA 3KKUA 2FE8A 3N4CA 1YZBA 1ICFA 2AVWA 3WXGA 1NB3A 4D8BA 1ME3A 5CHTA 3WXFA 2HXZA 3P5XA 1PPDA 3M99A 2DJGB 1BQIA 3BPFA 4BOPA 3IEJA 4QRGA 2G7YA 1KFUL 2DCCA 3F75A 1VJVA 3NHEA 4RKXA 2PNSA 3OF9A 2BTWA 3KFQA 3W30A 3PDFA 4D8IA 3F5VA 3QSDA 1PE6A 2R9CA 1CV8A 3CBJA 4DMYA 2NQIA 3MORA 3PHUA 1XKGA 2YJBA 2FQ9A 3S3RA 3ERVA 4IP3A 3I06A 4REZA 2ARYA 1Y08A 3IMAA 1F2BA 4OW0A 4P6EA 3ZUAA 1KHQA 1IWDA 3TMPA 7PCKA 2DJFB 1AU2A 2R9FA 1U9QX 3V6EA 2F7DA 5JH3A 4N79A 3C0RA 3HHIA 5FPWA 3MHSA 3KW9A 2IBIA 2JTCA 1THEA 3RNVA 1QDQA 2FUDA 3IHPA 4PP2E 4A5UA 3PBHA 1CJLA 1MDWA 1QMYA 3IOQA 1NQCA 1PPPA 3BOWA 5KO3A 3LFYA 3K9MA 2B1MA 1TU6A 4I07A 4MI7A 5EGWA 1ATKA 1NLJA 2DCBA 1ITOA 1HUCB 2HWKA 3D6SA 3RVVA 4X6IA 1GCBA 4XZXA 9PAPA 1CSBB 3HD3A 3BB7A 1EWLA 3TNXA 1PBHA 2AUXA 3H7DA 2E02A 2YJCA 2VHSA 2B1NA 1AECA 2PADA 3E9SA 4Q8HA 1F2AA 1POPA 1EWPA 2DOSA 5J94A 2PBHA 2DZYA 4CZWA 3O1GA 3BC3A 1KXRA 2G6DA 4KLBA 4OELA 1YK8A 3PW3A 2P0RA 4BS5A 5EZQA 3E1ZB 4D8EA 2YJ9A 2CIOA 5CVNB 2GHUA 2DC7A 2DC8A 3OVXA 4BSQA 4YYVA 1CTEA 1YALA 1SP4B 4YV8A 3RVXA 2BTWB 2YJ8A 4YYRA 1U5IA 4CDFB 4YYUA 4XR7A 1MHWA 4I05A 4N4ZA 2FRAA 2R9NA 3H6SA 3IUTA 3USVA 2DZZA 3CH2X 1CQDA 4CDCB 2G8JA 1MIRA 4HXDB 2AS8A 2H7JA 2J7QA 1ZCMA 2R6NA 4PT5A 3KSEA 3BY4A 3PNRA 3AI8A 1AIMA 1TLOA 3P5UA 1PCIA 4N8WA 1PPOA 1YK7A 3ZNHA 1VSNA 4BOSA 1O0EA 3PRMA 1JQPA 3PSEA 1DF0A 5EZSA 4DMXA 4OVZA 4MM3B 2J7QC 4W5CA 3I3TA 1BGOA 3OF8A 4BOUA 3H8BA 4P16A 2XU4A 5CVMA 4AXLA 3GCBA 1BP4A 1PXVA 4ZUXU 3PT2A 4CDDB 1EWOA 3N3KA 2E01A 1GMYA 1CB5A 2DCAA 2C0YA 2Y5BA 1UKFA 3BWKA 1SNKA 1GLOA 3K8UA 3PRPA 3O65A 2E00A 2UZJA 3MTVA 2IPPB 1QXPA 2FT2A 3OISA 2CB5A 5CHVA 1AU3A 3QT4A 2AGAA 2XU5A 4QRVA 5JZEA 1DKIA 2BU3A 5E6JA 1S4VA 2OP3A 3P5WA 2BDLA 1MS6A 1MEGA 3QJ3A 4X6JA 3CH3X 3KWZA 3N3GA 2O6XA 1ZIVA 4YYSA 3MP2A 5A24A 1X9YA 4FJCA 3DF0A 1AYUA 1NPZA 4BPVA 4PI3A 3BPMA 2ATOA 3B21A 2HHNA 3V6CA 2OZ2A 3O0UA 3OVZA 3K24A 4I04A 1CPJA 1YVBA 1U9VA 4BS6A 1STFE 4BOZA 4R3DA 2FRQA 1BY8A 2DC6A 3BBAA 4YVAA 2FO5A 2Z84A 1M6DA 1PVJA 3OQCA 4OEMA 4G54A 4RY2A 4BOQA 4Q8GA 4P6GA 4MZOA 3IV2A 1ME4A 3WXEA 4BQVA 3W31A 4XUIA 3H89A 2AUZA 3S3QA 3MJ5A 5F02A 1GECE 2WBFX 2R9OA 2PREA 4W5BA 4K7CA 2HH5A 2AYNA 1U9XA 3PHXA 4OVZB 8PCHA 4RNAA 2NQGA 4FK5A 3CBKA 2XU1A 4YYQA 2DCDA 1TL9A 1AU4A 2OULA 5JA7A 4WA6A 4X6HA 2FYEA 1K3BB 2P86A 2NQDB 2G8EA 4RF1A 1AYVA 2P7UA 1DEUA 1Q6KA 2HD5A 4CDEB 1EWMA 2JQGR 4IUMA 2AU1A 4YYWA 2AIMA 3KX1A 2Y6EA 3LXSA 1Y4HA 3IFUA 4M0WA 1PIPA 2JQFR 1NL6A 1AYWA 1FH0A 4AXMA 3H8CA 1CS8A 4HWYA 4MSXA 5CVOB 3KWBX 4QH6A 1QOLA 1U9WA 4ZTBA 1F2CA 2BDZA 2NQAA 1MEMA 3MHHA 1A6RA 1NB5A 4QBBA 1EF7A 1KHPA 4PADA 3P5VA 2AYOA 3TRKA 1F29A 2XU3A 5PADA 2R9MA 4FIPA 4MZSA 1YT7A 1PPNA 1AU0A 3U8EA 2ACTA
chains in the Genus database with same CATH topology
1PVJA 3OQCA 4BOSA 4BOQA 3PRMA 3PSEA 4MI7A 5EZSA 4OVZA 3W31A 4GUAA 3MJ5A 4MM3B 2J7QC 2HWKA 4WURA 4XZXA 3PHWA 3PHXA 4OVZB 4BOUA 3BB7A 4P16A 4RNAA 4RF0A 2JRIA 2FE8A 3PT2A 1YZBA 3E9SA 4D8BA 2DOSA 1UKFA 4RF1A 3PRPA 3O65A 4BOPA 2UZJA 3MTVA 4IUMA 5EZQA 4RKXA 4D8EA 2BTWA 3W30A 2AGAA 4D8IA 5JZEA 3IFUA 1DKIA 2BU3A 4M0WA 5E6JA 3PHUA 4IP3A 2BTWB 4REZA 4OW0A 3MP2A 3TMPA 4ZTBA 3C0RA 3B21A 2JTCA 4HXDB 3RNVA 2J7QA 4PT5A 3BY4A 4A5UA 3TRKA 4BOZA 4R3DA 3ZNHA 3BBAA 5KO3A 2Z84A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B21 A;  3W31 A;  3W30 A;  4IP3 A;  4XZX A; 
#chains in the Genus database with same CATH topology
 2FTD A;  3RVW A;  3HWN A;  6PAD A;  1KFX L;  3BCN A;  4QRX A;  4GUA A;  4PP1 A;  5EF4 A;  2F1G A;  3HHA A;  5K16 A;  3B79 A;  1PAD A;  2GFO A;  1CVZ A;  4WUR A;  3PHW A;  2DC9 A;  2YJ2 A;  3C9E A;  3MTN A;  2VHF A;  4W4U A;  4RF0 A;  2E03 A;  2JRI A;  3KKU A;  2FE8 A;  3N4C A;  1YZB A;  1ICF A;  2AVW A;  3WXG A;  1NB3 A;  4D8B A;  1ME3 A;  5CHT A;  3WXF A;  2HXZ A;  3P5X A;  1PPD A;  3M99 A;  2DJG B;  1BQI A;  3BPF A;  4BOP A;  3IEJ A;  4QRG A;  2G7Y A;  1KFU L;  2DCC A;  3F75 A;  1VJV A;  3NHE A;  4RKX A;  2PNS A;  3OF9 A;  2BTW A;  3KFQ A;  3W30 A;  3PDF A;  4D8I A;  3F5V A;  3QSD A;  1PE6 A;  2R9C A;  1CV8 A;  3CBJ A;  4DMY A;  2NQI A;  3MOR A;  3PHU A;  1XKG A;  2YJB A;  2FQ9 A;  3S3R A;  3ERV A;  4IP3 A;  3I06 A;  4REZ A;  2ARY A;  1Y08 A;  3IMA A;  1F2B A;  4OW0 A;  4P6E A;  3ZUA A;  1KHQ A;  1IWD A;  3TMP A;  7PCK A;  2DJF B;  1AU2 A;  2R9F A;  1U9Q X;  3V6E A;  2F7D A;  5JH3 A;  4N79 A;  3C0R A;  3HHI A;  5FPW A;  3MHS A;  3KW9 A;  2IBI A;  2JTC A;  1THE A;  3RNV A;  1QDQ A;  2FUD A;  3IHP A;  4PP2 E;  4A5U A;  3PBH A;  1CJL A;  1MDW A;  1QMY A;  3IOQ A;  1NQC A;  1PPP A;  3BOW A;  5KO3 A;  3LFY A;  3K9M A;  2B1M A;  1TU6 A;  4I07 A;  4MI7 A;  5EGW A;  1ATK A;  1NLJ A;  2DCB A;  1ITO A;  1HUC B;  2HWK A;  3D6S A;  3RVV A;  4X6I A;  1GCB A;  4XZX A;  9PAP A;  1CSB B;  3HD3 A;  3BB7 A;  1EWL A;  3TNX A;  1PBH A;  2AUX A;  3H7D A;  2E02 A;  2YJC A;  2VHS A;  2B1N A;  1AEC A;  2PAD A;  3E9S A;  4Q8H A;  1F2A A;  1POP A;  1EWP A;  2DOS A;  5J94 A;  2PBH A;  2DZY A;  4CZW A;  3O1G A;  3BC3 A;  1KXR A;  2G6D A;  4KLB A;  4OEL A;  1YK8 A;  3PW3 A;  2P0R A;  4BS5 A;  5EZQ A;  3E1Z B;  4D8E A;  2YJ9 A;  2CIO A;  5CVN B;  2GHU A;  2DC7 A;  2DC8 A;  3OVX A;  4BSQ A;  4YYV A;  1CTE A;  1YAL A;  1SP4 B;  4YV8 A;  3RVX A;  2BTW B;  2YJ8 A;  4YYR A;  1U5I A;  4CDF B;  4YYU A;  4XR7 A;  1MHW A;  4I05 A;  4N4Z A;  2FRA A;  2R9N A;  3H6S A;  3IUT A;  3USV A;  2DZZ A;  3CH2 X;  1CQD A;  4CDC B;  2G8J A;  1MIR A;  4HXD B;  2AS8 A;  2H7J A;  2J7Q A;  1ZCM A;  2R6N A;  4PT5 A;  3KSE A;  3BY4 A;  3PNR A;  3AI8 A;  1AIM A;  1TLO A;  3P5U A;  1PCI A;  4N8W A;  1PPO A;  1YK7 A;  3ZNH A;  1VSN A;  4BOS A;  1O0E A;  3PRM A;  1JQP A;  3PSE A;  1DF0 A;  5EZS A;  4DMX A;  4OVZ A;  4MM3 B;  2J7Q C;  4W5C A;  3I3T A;  1BGO A;  3OF8 A;  4BOU A;  3H8B A;  4P16 A;  2XU4 A;  5CVM A;  4AXL A;  3GCB A;  1BP4 A;  1PXV A;  4ZUX U;  3PT2 A;  4CDD B;  1EWO A;  3N3K A;  2E01 A;  1GMY A;  1CB5 A;  2DCA A;  2C0Y A;  2Y5B A;  1UKF A;  3BWK A;  1SNK A;  1GLO A;  3K8U A;  3PRP A;  3O65 A;  2E00 A;  2UZJ A;  3MTV A;  2IPP B;  1QXP A;  2FT2 A;  3OIS A;  2CB5 A;  5CHV A;  1AU3 A;  3QT4 A;  2AGA A;  2XU5 A;  4QRV A;  5JZE A;  1DKI A;  2BU3 A;  5E6J A;  1S4V A;  2OP3 A;  3P5W A;  2BDL A;  1MS6 A;  1MEG A;  3QJ3 A;  4X6J A;  3CH3 X;  3KWZ A;  3N3G A;  2O6X A;  1ZIV A;  4YYS A;  3MP2 A;  5A24 A;  1X9Y A;  4FJC A;  3DF0 A;  1AYU A;  1NPZ A;  4BPV A;  4PI3 A;  3BPM A;  2ATO A;  3B21 A;  2HHN A;  3V6C A;  2OZ2 A;  3O0U A;  3OVZ A;  3K24 A;  4I04 A;  1CPJ A;  1YVB A;  1U9V A;  4BS6 A;  1STF E;  4BOZ A;  4R3D A;  2FRQ A;  1BY8 A;  2DC6 A;  3BBA A;  4YVA A;  2FO5 A;  2Z84 A;  1M6D A;  1PVJ A;  3OQC A;  4OEM A;  4G54 A;  4RY2 A;  4BOQ A;  4Q8G A;  4P6G A;  4MZO A;  3IV2 A;  1ME4 A;  3WXE A;  4BQV A;  3W31 A;  4XUI A;  3H89 A;  2AUZ A;  3S3Q A;  3MJ5 A;  5F02 A;  1GEC E;  2WBF X;  2R9O A;  2PRE A;  4W5B A;  4K7C A;  2HH5 A;  2AYN A;  1U9X A;  3PHX A;  4OVZ B;  8PCH A;  4RNA A;  2NQG A;  4FK5 A;  3CBK A;  2XU1 A;  4YYQ A;  2DCD A;  1TL9 A;  1AU4 A;  2OUL A;  5JA7 A;  4WA6 A;  4X6H A;  2FYE A;  1K3B B;  2P86 A;  2NQD B;  2G8E A;  4RF1 A;  1AYV A;  2P7U A;  1DEU A;  1Q6K A;  2HD5 A;  4CDE B;  1EWM A;  2JQG R;  4IUM A;  2AU1 A;  4YYW A;  2AIM A;  3KX1 A;  2Y6E A;  3LXS A;  1Y4H A;  3IFU A;  4M0W A;  1PIP A;  2JQF R;  1NL6 A;  1AYW A;  1FH0 A;  4AXM A;  3H8C A;  1CS8 A;  4HWY A;  4MSX A;  5CVO B;  3KWB X;  4QH6 A;  1QOL A;  1U9W A;  4ZTB A;  1F2C A;  2BDZ A;  2NQA A;  1MEM A;  3MHH A;  1A6R A;  1NB5 A;  4QBB A;  1EF7 A;  1KHP A;  4PAD A;  3P5V A;  2AYO A;  3TRK A;  1F29 A;  2XU3 A;  5PAD A;  2R9M A;  4FIP A;  4MZS A;  1YT7 A;  1PPN A;  1AU0 A;  3U8E A;  2ACT A; 
#chains in the Genus database with same CATH homology
 1PVJ A;  3OQC A;  4BOS A;  4BOQ A;  3PRM A;  3PSE A;  4MI7 A;  5EZS A;  4OVZ A;  3W31 A;  4GUA A;  3MJ5 A;  4MM3 B;  2J7Q C;  2HWK A;  4WUR A;  4XZX A;  3PHW A;  3PHX A;  4OVZ B;  4BOU A;  3BB7 A;  4P16 A;  4RNA A;  4RF0 A;  2JRI A;  2FE8 A;  3PT2 A;  1YZB A;  3E9S A;  4D8B A;  2DOS A;  1UKF A;  4RF1 A;  3PRP A;  3O65 A;  4BOP A;  2UZJ A;  3MTV A;  4IUM A;  5EZQ A;  4RKX A;  4D8E A;  2BTW A;  3W30 A;  2AGA A;  4D8I A;  5JZE A;  3IFU A;  1DKI A;  2BU3 A;  4M0W A;  5E6J A;  3PHU A;  4IP3 A;  2BTW B;  4REZ A;  4OW0 A;  3MP2 A;  3TMP A;  4ZTB A;  3C0R A;  3B21 A;  2JTC A;  4HXD B;  3RNV A;  2J7Q A;  4PT5 A;  3BY4 A;  4A5U A;  3TRK A;  4BOZ A;  4R3D A;  3ZNH A;  3BBA A;  5KO3 A;  2Z84 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...