4CDCB

Human dpp1 in complex with (2s)-2-amino-n-((1s)-1-cyano-2-(4- phenylphenyl)ethyl)butanamide
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
162
structure length
162
Chain Sequence
HLPTSWDWRNVHGINFVSPVRNQASCGSCYSFASMGMLEARIRILTNNSQTPILSPQEVVSCSQYAQGCEGGFPYLIAGKYAQDFGLVEEACFPYTGTDSPCKMKEDCFRYYSSEYHYVGGFYGGCNEALMKLELVHHGPMAVAFEVYDDFLHYKKGIYHHT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Cathepsin C Inhibitors: Property Optimization and Identification of a Clinical Candidate.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords DIPEPTIDYL PEPTIDASE 1 EXCLUSION DOMAIN CHAIN
total genus 43
structure length 162
sequence length 162
chains with identical sequence E, H, K
ec nomenclature ec 3.4.14.1: Dipeptidyl-peptidase I.
pdb deposition date 2013-10-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 4cdcB01
4G54A 3DF0A 2R9MA 1YT7A 2HHNA 3OVZA 7PCKA 2PADA 2DCBA 1PBHA 1Y08A 2G7YA 1GCBA 1THEA 3USVA 4P6GA 2FRQA 4QRGA 1AYWA 3N3GA 1XKGA 2ATOA 4Q8GA 3MORA 1EWLA 4CDEB 2BDZA 1U9WA 3CBKA 1QOLA 5JH3A 4I05A 3LXSA 3CBJA 4W5BA 3H89A 1POPA 2R9OA 3H7DA 3M99A 1CV8A 1EWPA 3U8EA 1KFXL 1NLJA 1MHWA 2R6NA 3LFYA 3P5UA 1PPDA 2NQIA 4AXLA 4XR7A 3S3RA 1F2AA 2FT2A 4AXMA 1NPZA 3OVXA 1MIRA 4P6EA 1KXRA 2AYOA 2AIMA 3IHPA 1PE6A 1CB5A 1PCIA 3IMAA 1YALA 2GFOA 4BS6A 4QRVA 3RVXA 4N79A 3H6SA 4ZUXU 1CJLA 9PAPA 3P5WA 3BC3A 4QBBA 1AU3A 1QXPA 5F02A 4BSQA 1F29A 1AU0A 1PPOA 5FPWA 3AI8A 2P86A 1PADA 3KX1A 1A6RA 5CHTA 1AU2A 2DC7A 3ZUAA 1X9YA 3HD3A 4YYUA 1QMYA 3P5VA 3GCBA 2DJGB 1ZIVA 1DEUA 1S4VA 2DZYA 1U5IA 1BGOA 1MEGA 1U9QX 2FRAA 2O6XA 2R9CA 2P0RA 1KFUL 3K24A 2FO5A 3KW9A 6PADA 5A24A 8PCHA 2YJBA 4YYVA 4FIPA 3I06A 4CDFB 1PIPA 3N4CA 2B1MA 2HD5A 3B79A 1EF7A 1TL9A 4RY2A 4PP1A 2OZ2A 3BOWA 3K8UA 1MDWA 3E1ZB 2HH5A 2G8JA 1ME4A 2OULA 2CIOA 4Q8HA 1BQIA 2IPPB 1QDQA 2YJ9A 3BPFA 4PI3A 1EWOA 4PADA 3IUTA 5EGWA 1Q6KA 1CQDA 3IOQA 4CDDB 3ERVA 3F75A 3HWNA 1AYVA 3BCNA 3MHHA 2B1NA 3QSDA 2XU4A 1U9XA 1AU4A 2VHSA 1F2BA 2DCCA 4BQVA 2AUXA 4MSXA 4HWYA 2AUZA 2FTDA 3IEJA 4YYWA 2FQ9A 3HHIA 2NQGA 3O0UA 3OISA 1PPPA 2YJ2A 2CB5A 3HHAA 2P7UA 2F1GA 2HXZA 3D6SA 5K16A 3CH2X 1NQCA 1MS6A 2VHFA 3WXFA 3WXGA 4DMXA 4QRXA 3KKUA 3KWBX 1GMYA 4OEMA 4WA6A 3PNRA 2PNSA 1AYUA 2YJCA 4XUIA 1AIMA 1CPJA 3K9MA 2JQFR 1NB5A 3OF8A 4PP2E 2ACTA 3KWZA 2BDLA 2JQGR 4CDCB 4OELA 1EWMA 1YK8A 4W4UA 4KLBA 4I04A 1VJVA 2DJFB 3P5XA 3TNXA 1NL6A 2AYNA 1U9VA 5PADA 1NB3A 1PXVA 2DC8A 2YJ8A 3PBHA 1AECA 3BWKA 2R9NA 3KSEA 1SP4B 2E02A 2DC9A 3NHEA 4BPVA 2H7JA 2XU1A 2R9FA 3BPMA 3H8BA 2E03A 4MZSA 2FUDA 4W5CA 5CVMA 3KFQA 3I3TA 2DZZA 3F5VA 2AVWA 2WBFX 2PREA 1KHPA 3O1GA 5J94A 4X6HA 2F7DA 1YVBA 1STFE 3PDFA 4DMYA 4FK5A 1M6DA 1ITOA 2AU1A 5JA7A 4QH6A 1CTEA 1GLOA 1MEMA 3MTNA 4YYRA 1IWDA 3RVWA 4CZWA 1PPNA 1Y4HA 2XU3A 2ARYA 2C0YA 2DC6A 4I07A 1ZCMA 2NQAA 4BS5A 3S3QA 1ME3A 1DF0A 2Y6EA 1F2CA 2FYEA 1HUCB 3WXEA 1KHQA 3QT4A 2NQDB 1ICFA 4N4ZA 2Y5BA 2DCDA 3CH3X 1BP4A 1VSNA 4K7CA 4YVAA 4YV8A 1SNKA 3OF9A 1K3BB 4X6JA 3MHSA 1TU6A 2OP3A 1BY8A 1GECE 3C9EA 2AS8A 3N3KA 2G6DA 3QJ3A 4YYQA 2GHUA 3V6CA 1ATKA 1TLOA 5CHVA 2PBHA 1YK7A 1CVZA 2XU5A 5EF4A 4YYSA 1O0EA 4N8WA 3RVVA 1FH0A 1CSBB 3H8CA 2G8EA 1CS8A 2DCAA 1JQPA 3V6EA 3PW3A 4FJCA 2IBIA 2E00A 5CVOB 3IV2A 4X6IA 5CVNB 4MZOA 2E01A
chains in the Genus database with same CATH superfamily
4G54A 3DF0A 2R9MA 1YT7A 5E6JA 2HHNA 3OVZA 7PCKA 2PADA 2DCBA 1PBHA 1Y08A 2G7YA 4RKXA 1GCBA 1THEA 4HXDB 4BOUA 3USVA 4P6GA 2FRQA 4QRGA 1AYWA 3N3GA 1XKGA 2ATOA 4Q8GA 2BTWA 3MORA 3PSEA 1EWLA 4CDEB 2BDZA 1U9WA 3CBKA 1QOLA 5JH3A 4I05A 3LXSA 3PRMA 3CBJA 4W5BA 3H89A 1POPA 2R9OA 3H7DA 3M99A 1CV8A 1EWPA 3U8EA 1KFXL 1NLJA 3BY4A 1MHWA 2R6NA 3LFYA 3P5UA 1PPDA 2NQIA 4AXLA 4XR7A 3S3RA 1F2AA 4MM3B 3PHWA 2FT2A 4AXMA 1NPZA 3OVXA 4RNAA 1MIRA 4P6EA 1KXRA 2AYOA 2AIMA 3IHPA 1PE6A 1CB5A 1PCIA 4IP3A 3IMAA 1YALA 2GFOA 4BS6A 4QRVA 3RVXA 4N79A 3H6SA 4ZUXU 1CJLA 9PAPA 3P5WA 3BC3A 4QBBA 1AU3A 4REZA 4XZXA 1QXPA 5F02A 4BSQA 3OQCA 1F29A 1AU0A 1PPOA 5FPWA 3AI8A 2P86A 1PADA 3KX1A 1A6RA 5CHTA 1AU2A 2DC7A 3ZUAA 1X9YA 1YZBA 3HD3A 4YYUA 2UZJA 1QMYA 3P5VA 4RF0A 3GCBA 4BOSA 2DJGB 1ZIVA 1DEUA 1S4VA 2DZYA 1U5IA 1BGOA 1MEGA 1U9QX 2FRAA 2JTCA 2O6XA 2R9CA 2P0RA 1KFUL 4WURA 3K24A 2FO5A 3KW9A 3IFUA 6PADA 5A24A 4OVZB 8PCHA 3RNVA 2YJBA 4YYVA 4FIPA 3I06A 4CDFB 4ZTBA 2BU3A 1PIPA 5JZEA 3N4CA 1PVJA 2B1MA 2HD5A 3B79A 1EF7A 1TL9A 4RY2A 2AGAA 4PP1A 4GUAA 2OZ2A 3BOWA 3K8UA 1MDWA 3E1ZB 2HH5A 2G8JA 1ME4A 2OULA 2CIOA 4Q8HA 1BQIA 2IPPB 1QDQA 2YJ9A 3BPFA 4PI3A 1EWOA 4PADA 3IUTA 5EGWA 1Q6KA 1CQDA 3IOQA 4D8EA 4CDDB 3ERVA 3F75A 3HWNA 1AYVA 3BCNA 4RF1A 3MHHA 3W30A 2B1NA 3QSDA 2XU4A 1U9XA 1AU4A 2VHSA 1F2BA 2DCCA 4BQVA 2AUXA 4MSXA 4HWYA 3TRKA 2AUZA 2FTDA 2DOSA 3IEJA 4YYWA 5EZQA 3PRPA 2FQ9A 3HHIA 1DKIA 2NQGA 3O0UA 3OISA 1PPPA 2YJ2A 2CB5A 3HHAA 2P7UA 2F1GA 2HXZA 3PHXA 3D6SA 5K16A 3CH2X 1NQCA 1MS6A 2VHFA 3WXFA 3WXGA 4DMXA 3B21A 4QRXA 3KKUA 3KWBX 1GMYA 4OEMA 4WA6A 3PNRA 2PNSA 1AYUA 2YJCA 4XUIA 1AIMA 1CPJA 3K9MA 2JQFR 3MTVA 1NB5A 3OF8A 4PP2E 2ACTA 3KWZA 2BDLA 2JQGR 2J7QA 4CDCB 4BOPA 4OELA 4OW0A 1EWMA 1YK8A 4W4UA 4KLBA 4I04A 4M0WA 1VJVA 2DJFB 3P5XA 3TNXA 3O65A 3PT2A 1NL6A 2AYNA 1U9VA 5PADA 1NB3A 1PXVA 2DC8A 2YJ8A 3PBHA 3E9SA 2FE8A 1AECA 3BWKA 2R9NA 3KSEA 1SP4B 2E02A 2DC9A 3NHEA 4BPVA 2H7JA 2XU1A 2R9FA 2JRIA 3BPMA 3H8BA 3MP2A 4P16A 4MI7A 2E03A 4MZSA 2FUDA 4W5CA 5CVMA 3KFQA 3I3TA 4BOZA 2DZZA 3F5VA 2AVWA 2WBFX 2PREA 1KHPA 3O1GA 5J94A 4PT5A 3MJ5A 4X6HA 4D8IA 2F7DA 1YVBA 1STFE 3PDFA 4DMYA 4FK5A 1M6DA 4OVZA 1ITOA 2Z84A 4IUMA 2AU1A 5JA7A 4D8BA 2HWKA 4QH6A 1CTEA 1GLOA 1MEMA 3MTNA 4YYRA 1IWDA 3BBAA 3RVWA 4CZWA 1PPNA 1Y4HA 2XU3A 2ARYA 2C0YA 2DC6A 3C0RA 4I07A 1ZCMA 2NQAA 4BS5A 3S3QA 1ME3A 1DF0A 2Y6EA 1F2CA 2FYEA 1HUCB 3WXEA 1KHQA 2J7QC 3QT4A 2NQDB 1ICFA 3BB7A 4N4ZA 2Y5BA 2DCDA 3CH3X 1BP4A 1VSNA 4K7CA 4YVAA 4YV8A 1SNKA 5KO3A 3OF9A 1K3BB 4X6JA 3PHUA 3MHSA 1TU6A 2OP3A 1BY8A 1GECE 4A5UA 5EZSA 3C9EA 2AS8A 3N3KA 2G6DA 3QJ3A 4YYQA 2GHUA 3V6CA 1ATKA 4R3DA 1TLOA 5CHVA 2BTWB 2PBHA 1YK7A 1CVZA 2XU5A 5EF4A 4YYSA 1O0EA 4N8WA 3RVVA 1FH0A 1CSBB 3H8CA 2G8EA 4BOQA 1CS8A 3TMPA 2DCAA 1JQPA 3V6EA 3PW3A 4FJCA 2IBIA 2E00A 3W31A 3ZNHA 5CVOB 3IV2A 4X6IA 5CVNB 1UKFA 4MZOA 2E01A
chains in the Genus database with same CATH topology
4G54A 3DF0A 2R9MA 1YT7A 2HHNA 3OVZA 7PCKA 2PADA 2DCBA 1PBHA 1Y08A 2G7YA 1GCBA 1THEA 3USVA 4P6GA 2FRQA 4QRGA 1W4TA 1AYWA 3N3GA 1XKGA 2ATOA 4Q8GA 3MORA 1EWLA 4CDEB 2BDZA 1U9WA 3CBKA 1QOLA 5JH3A 4I05A 3LXSA 3CBJA 4W5BA 3H89A 1POPA 2R9OA 3H7DA 3M99A 1CV8A 1EWPA 3U8EA 1KFXL 2VFBA 1NLJA 1MHWA 2R6NA 3LFYA 3P5UA 1PPDA 2NQIA 4AXLA 4XR7A 3S3RA 1F2AA 2FT2A 4AXMA 1NPZA 3OVXA 1MIRA 4P6EA 1KXRA 2AYOA 2AIMA 3IHPA 1PE6A 1CB5A 1PCIA 3IMAA 1YALA 2GFOA 4BS6A 4QRVA 3RVXA 4N79A 3H6SA 4ZUXU 1CJLA 9PAPA 3P5WA 3BC3A 4QBBA 1AU3A 1QXPA 5F02A 4BSQA 1F29A 1AU0A 1PPOA 5FPWA 3AI8A 2P86A 1PADA 3KX1A 1A6RA 5CHTA 1AU2A 2DC7A 3ZUAA 1X9YA 3HD3A 4YYUA 1QMYA 3P5VA 3GCBA 2DJGB 1ZIVA 1DEUA 1S4VA 2DZYA 1U5IA 1BGOA 1MEGA 1U9QX 2FRAA 2O6XA 2R9CA 2P0RA 1KFUL 4BGFA 3K24A 2FO5A 3KW9A 4NV8A 6PADA 5A24A 8PCHA 2YJBA 4YYVA 4FIPA 3I06A 4CDFB 1PIPA 3N4CA 2B1MA 2HD5A 3B79A 1EF7A 1TL9A 4RY2A 4PP1A 2OZ2A 3BOWA 3K8UA 1MDWA 3E1ZB 2HH5A 2G8JA 1ME4A 2OULA 2CIOA 4Q8HA 1BQIA 2IPPB 1QDQA 2YJ9A 3BPFA 4PI3A 1EWOA 4PADA 3IUTA 5EGWA 1Q6KA 1CQDA 3IOQA 4CDDB 3ERVA 3F75A 3HWNA 1AYVA 3BCNA 3MHHA 2B1NA 3QSDA 2XU4A 1U9XA 1AU4A 2VHSA 1F2BA 2DCCA 4BQVA 2AUXA 4MSXA 4HWYA 2AUZA 2FTDA 2BSZA 3IEJA 4YYWA 2FQ9A 3HHIA 4C5PA 2NQGA 3O0UA 3OISA 1PPPA 2YJ2A 2CB5A 3HHAA 2P7UA 2F1GA 1GX3A 2HXZA 3D6SA 5K16A 3CH2X 1NQCA 1MS6A 2VHFA 3WXFA 3WXGA 4DMXA 4QRXA 3KKUA 3KWBX 1GMYA 4OEMA 4WA6A 3PNRA 2PNSA 4B55A 1AYUA 2YJCA 4XUIA 1AIMA 1CPJA 3K9MA 2JQFR 1NB5A 3OF8A 4PP2E 2ACTA 3KWZA 2BDLA 2JQGR 4CDCB 4OELA 1EWMA 1YK8A 4W4UA 4KLBA 4I04A 1VJVA 2DJFB 3P5XA 3TNXA 1NL6A 2AYNA 1U9VA 5PADA 1NB3A 1PXVA 2DC8A 2YJ8A 3PBHA 1AECA 3BWKA 2R9NA 3KSEA 1SP4B 2E02A 2DC9A 3NHEA 1W5RA 4BPVA 2H7JA 2XU1A 2R9FA 3BPMA 3H8BA 2E03A 4MZSA 2FUDA 4W5CA 5CVMA 3KFQA 3I3TA 2DZZA 3F5VA 2AVWA 2WBFX 2PREA 1KHPA 3O1GA 5J94A 4GUZA 4X6HA 2F7DA 1E2TA 1YVBA 1STFE 3PDFA 4DMYA 4FK5A 1M6DA 1ITOA 2AU1A 5JA7A 4QH6A 1CTEA 1GLOA 1MEMA 3MTNA 4YYRA 1IWDA 3LTWA 1W6FA 3RVWA 4CZWA 1PPNA 1Y4HA 2XU3A 2ARYA 2C0YA 2DC6A 4I07A 1ZCMA 2NQAA 4BS5A 3S3QA 1ME3A 1DF0A 2Y6EA 1F2CA 2FYEA 1HUCB 3WXEA 1KHQA 4NV7A 3QT4A 3D9WA 2NQDB 1ICFA 4N4ZA 2Y5BA 2DCDA 3CH3X 1BP4A 1VSNA 4K7CA 4YVAA 4YV8A 1SNKA 3OF9A 1K3BB 4X6JA 2VFCA 3MHSA 1TU6A 2OP3A 1BY8A 1GECE 3C9EA 2AS8A 3N3KA 2G6DA 3QJ3A 4YYQA 2GHUA 3V6CA 1ATKA 1TLOA 5CHVA 2PBHA 1YK7A 1CVZA 2XU5A 5EF4A 4YYSA 1O0EA 4N8WA 3RVVA 1FH0A 1CSBB 3H8CA 2G8EA 1CS8A 2DCAA 1JQPA 3V6EA 3PW3A 4FJCA 2IBIA 2E00A 5CVOB 3IV2A 4X6IA 5CVNB 4MZOA 2E01A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G54 A;  3DF0 A;  2R9M A;  1YT7 A;  2HHN A;  3OVZ A;  7PCK A;  2PAD A;  2DCB A;  1PBH A;  1Y08 A;  2G7Y A;  1GCB A;  1THE A;  3USV A;  4P6G A;  2FRQ A;  4QRG A;  1AYW A;  3N3G A;  1XKG A;  2ATO A;  4Q8G A;  3MOR A;  1EWL A;  4CDE B;  2BDZ A;  1U9W A;  3CBK A;  1QOL A;  5JH3 A;  4I05 A;  3LXS A;  3CBJ A;  4W5B A;  3H89 A;  1POP A;  2R9O A;  3H7D A;  3M99 A;  1CV8 A;  1EWP A;  3U8E A;  1KFX L;  1NLJ A;  1MHW A;  2R6N A;  3LFY A;  3P5U A;  1PPD A;  2NQI A;  4AXL A;  4XR7 A;  3S3R A;  1F2A A;  2FT2 A;  4AXM A;  1NPZ A;  3OVX A;  1MIR A;  4P6E A;  1KXR A;  2AYO A;  2AIM A;  3IHP A;  1PE6 A;  1CB5 A;  1PCI A;  3IMA A;  1YAL A;  2GFO A;  4BS6 A;  4QRV A;  3RVX A;  4N79 A;  3H6S A;  4ZUX U;  1CJL A;  9PAP A;  3P5W A;  3BC3 A;  4QBB A;  1AU3 A;  1QXP A;  5F02 A;  4BSQ A;  1F29 A;  1AU0 A;  1PPO A;  5FPW A;  3AI8 A;  2P86 A;  1PAD A;  3KX1 A;  1A6R A;  5CHT A;  1AU2 A;  2DC7 A;  3ZUA A;  1X9Y A;  3HD3 A;  4YYU A;  1QMY A;  3P5V A;  3GCB A;  2DJG B;  1ZIV A;  1DEU A;  1S4V A;  2DZY A;  1U5I A;  1BGO A;  1MEG A;  1U9Q X;  2FRA A;  2O6X A;  2R9C A;  2P0R A;  1KFU L;  3K24 A;  2FO5 A;  3KW9 A;  6PAD A;  5A24 A;  8PCH A;  2YJB A;  4YYV A;  4FIP A;  3I06 A;  4CDF B;  1PIP A;  3N4C A;  2B1M A;  2HD5 A;  3B79 A;  1EF7 A;  1TL9 A;  4RY2 A;  4PP1 A;  2OZ2 A;  3BOW A;  3K8U A;  1MDW A;  3E1Z B;  2HH5 A;  2G8J A;  1ME4 A;  2OUL A;  2CIO A;  4Q8H A;  1BQI A;  2IPP B;  1QDQ A;  2YJ9 A;  3BPF A;  4PI3 A;  1EWO A;  4PAD A;  3IUT A;  5EGW A;  1Q6K A;  1CQD A;  3IOQ A;  4CDD B;  3ERV A;  3F75 A;  3HWN A;  1AYV A;  3BCN A;  3MHH A;  2B1N A;  3QSD A;  2XU4 A;  1U9X A;  1AU4 A;  2VHS A;  1F2B A;  2DCC A;  4BQV A;  2AUX A;  4MSX A;  4HWY A;  2AUZ A;  2FTD A;  3IEJ A;  4YYW A;  2FQ9 A;  3HHI A;  2NQG A;  3O0U A;  3OIS A;  1PPP A;  2YJ2 A;  2CB5 A;  3HHA A;  2P7U A;  2F1G A;  2HXZ A;  3D6S A;  5K16 A;  3CH2 X;  1NQC A;  1MS6 A;  2VHF A;  3WXF A;  3WXG A;  4DMX A;  4QRX A;  3KKU A;  3KWB X;  1GMY A;  4OEM A;  4WA6 A;  3PNR A;  2PNS A;  1AYU A;  2YJC A;  4XUI A;  1AIM A;  1CPJ A;  3K9M A;  2JQF R;  1NB5 A;  3OF8 A;  4PP2 E;  2ACT A;  3KWZ A;  2BDL A;  2JQG R;  4CDC B;  4OEL A;  1EWM A;  1YK8 A;  4W4U A;  4KLB A;  4I04 A;  1VJV A;  2DJF B;  3P5X A;  3TNX A;  1NL6 A;  2AYN A;  1U9V A;  5PAD A;  1NB3 A;  1PXV A;  2DC8 A;  2YJ8 A;  3PBH A;  1AEC A;  3BWK A;  2R9N A;  3KSE A;  1SP4 B;  2E02 A;  2DC9 A;  3NHE A;  4BPV A;  2H7J A;  2XU1 A;  2R9F A;  3BPM A;  3H8B A;  2E03 A;  4MZS A;  2FUD A;  4W5C A;  5CVM A;  3KFQ A;  3I3T A;  2DZZ A;  3F5V A;  2AVW A;  2WBF X;  2PRE A;  1KHP A;  3O1G A;  5J94 A;  4X6H A;  2F7D A;  1YVB A;  1STF E;  3PDF A;  4DMY A;  4FK5 A;  1M6D A;  1ITO A;  2AU1 A;  5JA7 A;  4QH6 A;  1CTE A;  1GLO A;  1MEM A;  3MTN A;  4YYR A;  1IWD A;  3RVW A;  4CZW A;  1PPN A;  1Y4H A;  2XU3 A;  2ARY A;  2C0Y A;  2DC6 A;  4I07 A;  1ZCM A;  2NQA A;  4BS5 A;  3S3Q A;  1ME3 A;  1DF0 A;  2Y6E A;  1F2C A;  2FYE A;  1HUC B;  3WXE A;  1KHQ A;  3QT4 A;  2NQD B;  1ICF A;  4N4Z A;  2Y5B A;  2DCD A;  3CH3 X;  1BP4 A;  1VSN A;  4K7C A;  4YVA A;  4YV8 A;  1SNK A;  3OF9 A;  1K3B B;  4X6J A;  3MHS A;  1TU6 A;  2OP3 A;  1BY8 A;  1GEC E;  3C9E A;  2AS8 A;  3N3K A;  2G6D A;  3QJ3 A;  4YYQ A;  2GHU A;  3V6C A;  1ATK A;  1TLO A;  5CHV A;  2PBH A;  1YK7 A;  1CVZ A;  2XU5 A;  5EF4 A;  4YYS A;  1O0E A;  4N8W A;  3RVV A;  1FH0 A;  1CSB B;  3H8C A;  2G8E A;  1CS8 A;  2DCA A;  1JQP A;  3V6E A;  3PW3 A;  4FJC A;  2IBI A;  2E00 A;  5CVO B;  3IV2 A;  4X6I A;  5CVN B;  4MZO A;  2E01 A; 
#chains in the Genus database with same CATH topology
 4G54 A;  3DF0 A;  2R9M A;  1YT7 A;  5E6J A;  2HHN A;  3OVZ A;  7PCK A;  2PAD A;  2DCB A;  1PBH A;  1Y08 A;  2G7Y A;  4RKX A;  1GCB A;  1THE A;  4HXD B;  4BOU A;  3USV A;  4P6G A;  2FRQ A;  4QRG A;  1AYW A;  3N3G A;  1XKG A;  2ATO A;  4Q8G A;  2BTW A;  3MOR A;  3PSE A;  1EWL A;  4CDE B;  2BDZ A;  1U9W A;  3CBK A;  1QOL A;  5JH3 A;  4I05 A;  3LXS A;  3PRM A;  3CBJ A;  4W5B A;  3H89 A;  1POP A;  2R9O A;  3H7D A;  3M99 A;  1CV8 A;  1EWP A;  3U8E A;  1KFX L;  1NLJ A;  3BY4 A;  1MHW A;  2R6N A;  3LFY A;  3P5U A;  1PPD A;  2NQI A;  4AXL A;  4XR7 A;  3S3R A;  1F2A A;  4MM3 B;  3PHW A;  2FT2 A;  4AXM A;  1NPZ A;  3OVX A;  4RNA A;  1MIR A;  4P6E A;  1KXR A;  2AYO A;  2AIM A;  3IHP A;  1PE6 A;  1CB5 A;  1PCI A;  4IP3 A;  3IMA A;  1YAL A;  2GFO A;  4BS6 A;  4QRV A;  3RVX A;  4N79 A;  3H6S A;  4ZUX U;  1CJL A;  9PAP A;  3P5W A;  3BC3 A;  4QBB A;  1AU3 A;  4REZ A;  4XZX A;  1QXP A;  5F02 A;  4BSQ A;  3OQC A;  1F29 A;  1AU0 A;  1PPO A;  5FPW A;  3AI8 A;  2P86 A;  1PAD A;  3KX1 A;  1A6R A;  5CHT A;  1AU2 A;  2DC7 A;  3ZUA A;  1X9Y A;  1YZB A;  3HD3 A;  4YYU A;  2UZJ A;  1QMY A;  3P5V A;  4RF0 A;  3GCB A;  4BOS A;  2DJG B;  1ZIV A;  1DEU A;  1S4V A;  2DZY A;  1U5I A;  1BGO A;  1MEG A;  1U9Q X;  2FRA A;  2JTC A;  2O6X A;  2R9C A;  2P0R A;  1KFU L;  4WUR A;  3K24 A;  2FO5 A;  3KW9 A;  3IFU A;  6PAD A;  5A24 A;  4OVZ B;  8PCH A;  3RNV A;  2YJB A;  4YYV A;  4FIP A;  3I06 A;  4CDF B;  4ZTB A;  2BU3 A;  1PIP A;  5JZE A;  3N4C A;  1PVJ A;  2B1M A;  2HD5 A;  3B79 A;  1EF7 A;  1TL9 A;  4RY2 A;  2AGA A;  4PP1 A;  4GUA A;  2OZ2 A;  3BOW A;  3K8U A;  1MDW A;  3E1Z B;  2HH5 A;  2G8J A;  1ME4 A;  2OUL A;  2CIO A;  4Q8H A;  1BQI A;  2IPP B;  1QDQ A;  2YJ9 A;  3BPF A;  4PI3 A;  1EWO A;  4PAD A;  3IUT A;  5EGW A;  1Q6K A;  1CQD A;  3IOQ A;  4D8E A;  4CDD B;  3ERV A;  3F75 A;  3HWN A;  1AYV A;  3BCN A;  4RF1 A;  3MHH A;  3W30 A;  2B1N A;  3QSD A;  2XU4 A;  1U9X A;  1AU4 A;  2VHS A;  1F2B A;  2DCC A;  4BQV A;  2AUX A;  4MSX A;  4HWY A;  3TRK A;  2AUZ A;  2FTD A;  2DOS A;  3IEJ A;  4YYW A;  5EZQ A;  3PRP A;  2FQ9 A;  3HHI A;  1DKI A;  2NQG A;  3O0U A;  3OIS A;  1PPP A;  2YJ2 A;  2CB5 A;  3HHA A;  2P7U A;  2F1G A;  2HXZ A;  3PHX A;  3D6S A;  5K16 A;  3CH2 X;  1NQC A;  1MS6 A;  2VHF A;  3WXF A;  3WXG A;  4DMX A;  3B21 A;  4QRX A;  3KKU A;  3KWB X;  1GMY A;  4OEM A;  4WA6 A;  3PNR A;  2PNS A;  1AYU A;  2YJC A;  4XUI A;  1AIM A;  1CPJ A;  3K9M A;  2JQF R;  3MTV A;  1NB5 A;  3OF8 A;  4PP2 E;  2ACT A;  3KWZ A;  2BDL A;  2JQG R;  2J7Q A;  4CDC B;  4BOP A;  4OEL A;  4OW0 A;  1EWM A;  1YK8 A;  4W4U A;  4KLB A;  4I04 A;  4M0W A;  1VJV A;  2DJF B;  3P5X A;  3TNX A;  3O65 A;  3PT2 A;  1NL6 A;  2AYN A;  1U9V A;  5PAD A;  1NB3 A;  1PXV A;  2DC8 A;  2YJ8 A;  3PBH A;  3E9S A;  2FE8 A;  1AEC A;  3BWK A;  2R9N A;  3KSE A;  1SP4 B;  2E02 A;  2DC9 A;  3NHE A;  4BPV A;  2H7J A;  2XU1 A;  2R9F A;  2JRI A;  3BPM A;  3H8B A;  3MP2 A;  4P16 A;  4MI7 A;  2E03 A;  4MZS A;  2FUD A;  4W5C A;  5CVM A;  3KFQ A;  3I3T A;  4BOZ A;  2DZZ A;  3F5V A;  2AVW A;  2WBF X;  2PRE A;  1KHP A;  3O1G A;  5J94 A;  4PT5 A;  3MJ5 A;  4X6H A;  4D8I A;  2F7D A;  1YVB A;  1STF E;  3PDF A;  4DMY A;  4FK5 A;  1M6D A;  4OVZ A;  1ITO A;  2Z84 A;  4IUM A;  2AU1 A;  5JA7 A;  4D8B A;  2HWK A;  4QH6 A;  1CTE A;  1GLO A;  1MEM A;  3MTN A;  4YYR A;  1IWD A;  3BBA A;  3RVW A;  4CZW A;  1PPN A;  1Y4H A;  2XU3 A;  2ARY A;  2C0Y A;  2DC6 A;  3C0R A;  4I07 A;  1ZCM A;  2NQA A;  4BS5 A;  3S3Q A;  1ME3 A;  1DF0 A;  2Y6E A;  1F2C A;  2FYE A;  1HUC B;  3WXE A;  1KHQ A;  2J7Q C;  3QT4 A;  2NQD B;  1ICF A;  3BB7 A;  4N4Z A;  2Y5B A;  2DCD A;  3CH3 X;  1BP4 A;  1VSN A;  4K7C A;  4YVA A;  4YV8 A;  1SNK A;  5KO3 A;  3OF9 A;  1K3B B;  4X6J A;  3PHU A;  3MHS A;  1TU6 A;  2OP3 A;  1BY8 A;  1GEC E;  4A5U A;  5EZS A;  3C9E A;  2AS8 A;  3N3K A;  2G6D A;  3QJ3 A;  4YYQ A;  2GHU A;  3V6C A;  1ATK A;  4R3D A;  1TLO A;  5CHV A;  2BTW B;  2PBH A;  1YK7 A;  1CVZ A;  2XU5 A;  5EF4 A;  4YYS A;  1O0E A;  4N8W A;  3RVV A;  1FH0 A;  1CSB B;  3H8C A;  2G8E A;  4BOQ A;  1CS8 A;  3TMP A;  2DCA A;  1JQP A;  3V6E A;  3PW3 A;  4FJC A;  2IBI A;  2E00 A;  3W31 A;  3ZNH A;  5CVO B;  3IV2 A;  4X6I A;  5CVN B;  1UKF A;  4MZO A;  2E01 A; 
#chains in the Genus database with same CATH homology
 4G54 A;  3DF0 A;  2R9M A;  1YT7 A;  2HHN A;  3OVZ A;  7PCK A;  2PAD A;  2DCB A;  1PBH A;  1Y08 A;  2G7Y A;  1GCB A;  1THE A;  3USV A;  4P6G A;  2FRQ A;  4QRG A;  1W4T A;  1AYW A;  3N3G A;  1XKG A;  2ATO A;  4Q8G A;  3MOR A;  1EWL A;  4CDE B;  2BDZ A;  1U9W A;  3CBK A;  1QOL A;  5JH3 A;  4I05 A;  3LXS A;  3CBJ A;  4W5B A;  3H89 A;  1POP A;  2R9O A;  3H7D A;  3M99 A;  1CV8 A;  1EWP A;  3U8E A;  1KFX L;  2VFB A;  1NLJ A;  1MHW A;  2R6N A;  3LFY A;  3P5U A;  1PPD A;  2NQI A;  4AXL A;  4XR7 A;  3S3R A;  1F2A A;  2FT2 A;  4AXM A;  1NPZ A;  3OVX A;  1MIR A;  4P6E A;  1KXR A;  2AYO A;  2AIM A;  3IHP A;  1PE6 A;  1CB5 A;  1PCI A;  3IMA A;  1YAL A;  2GFO A;  4BS6 A;  4QRV A;  3RVX A;  4N79 A;  3H6S A;  4ZUX U;  1CJL A;  9PAP A;  3P5W A;  3BC3 A;  4QBB A;  1AU3 A;  1QXP A;  5F02 A;  4BSQ A;  1F29 A;  1AU0 A;  1PPO A;  5FPW A;  3AI8 A;  2P86 A;  1PAD A;  3KX1 A;  1A6R A;  5CHT A;  1AU2 A;  2DC7 A;  3ZUA A;  1X9Y A;  3HD3 A;  4YYU A;  1QMY A;  3P5V A;  3GCB A;  2DJG B;  1ZIV A;  1DEU A;  1S4V A;  2DZY A;  1U5I A;  1BGO A;  1MEG A;  1U9Q X;  2FRA A;  2O6X A;  2R9C A;  2P0R A;  1KFU L;  4BGF A;  3K24 A;  2FO5 A;  3KW9 A;  4NV8 A;  6PAD A;  5A24 A;  8PCH A;  2YJB A;  4YYV A;  4FIP A;  3I06 A;  4CDF B;  1PIP A;  3N4C A;  2B1M A;  2HD5 A;  3B79 A;  1EF7 A;  1TL9 A;  4RY2 A;  4PP1 A;  2OZ2 A;  3BOW A;  3K8U A;  1MDW A;  3E1Z B;  2HH5 A;  2G8J A;  1ME4 A;  2OUL A;  2CIO A;  4Q8H A;  1BQI A;  2IPP B;  1QDQ A;  2YJ9 A;  3BPF A;  4PI3 A;  1EWO A;  4PAD A;  3IUT A;  5EGW A;  1Q6K A;  1CQD A;  3IOQ A;  4CDD B;  3ERV A;  3F75 A;  3HWN A;  1AYV A;  3BCN A;  3MHH A;  2B1N A;  3QSD A;  2XU4 A;  1U9X A;  1AU4 A;  2VHS A;  1F2B A;  2DCC A;  4BQV A;  2AUX A;  4MSX A;  4HWY A;  2AUZ A;  2FTD A;  2BSZ A;  3IEJ A;  4YYW A;  2FQ9 A;  3HHI A;  4C5P A;  2NQG A;  3O0U A;  3OIS A;  1PPP A;  2YJ2 A;  2CB5 A;  3HHA A;  2P7U A;  2F1G A;  1GX3 A;  2HXZ A;  3D6S A;  5K16 A;  3CH2 X;  1NQC A;  1MS6 A;  2VHF A;  3WXF A;  3WXG A;  4DMX A;  4QRX A;  3KKU A;  3KWB X;  1GMY A;  4OEM A;  4WA6 A;  3PNR A;  2PNS A;  4B55 A;  1AYU A;  2YJC A;  4XUI A;  1AIM A;  1CPJ A;  3K9M A;  2JQF R;  1NB5 A;  3OF8 A;  4PP2 E;  2ACT A;  3KWZ A;  2BDL A;  2JQG R;  4CDC B;  4OEL A;  1EWM A;  1YK8 A;  4W4U A;  4KLB A;  4I04 A;  1VJV A;  2DJF B;  3P5X A;  3TNX A;  1NL6 A;  2AYN A;  1U9V A;  5PAD A;  1NB3 A;  1PXV A;  2DC8 A;  2YJ8 A;  3PBH A;  1AEC A;  3BWK A;  2R9N A;  3KSE A;  1SP4 B;  2E02 A;  2DC9 A;  3NHE A;  1W5R A;  4BPV A;  2H7J A;  2XU1 A;  2R9F A;  3BPM A;  3H8B A;  2E03 A;  4MZS A;  2FUD A;  4W5C A;  5CVM A;  3KFQ A;  3I3T A;  2DZZ A;  3F5V A;  2AVW A;  2WBF X;  2PRE A;  1KHP A;  3O1G A;  5J94 A;  4GUZ A;  4X6H A;  2F7D A;  1E2T A;  1YVB A;  1STF E;  3PDF A;  4DMY A;  4FK5 A;  1M6D A;  1ITO A;  2AU1 A;  5JA7 A;  4QH6 A;  1CTE A;  1GLO A;  1MEM A;  3MTN A;  4YYR A;  1IWD A;  3LTW A;  1W6F A;  3RVW A;  4CZW A;  1PPN A;  1Y4H A;  2XU3 A;  2ARY A;  2C0Y A;  2DC6 A;  4I07 A;  1ZCM A;  2NQA A;  4BS5 A;  3S3Q A;  1ME3 A;  1DF0 A;  2Y6E A;  1F2C A;  2FYE A;  1HUC B;  3WXE A;  1KHQ A;  4NV7 A;  3QT4 A;  3D9W A;  2NQD B;  1ICF A;  4N4Z A;  2Y5B A;  2DCD A;  3CH3 X;  1BP4 A;  1VSN A;  4K7C A;  4YVA A;  4YV8 A;  1SNK A;  3OF9 A;  1K3B B;  4X6J A;  2VFC A;  3MHS A;  1TU6 A;  2OP3 A;  1BY8 A;  1GEC E;  3C9E A;  2AS8 A;  3N3K A;  2G6D A;  3QJ3 A;  4YYQ A;  2GHU A;  3V6C A;  1ATK A;  1TLO A;  5CHV A;  2PBH A;  1YK7 A;  1CVZ A;  2XU5 A;  5EF4 A;  4YYS A;  1O0E A;  4N8W A;  3RVV A;  1FH0 A;  1CSB B;  3H8C A;  2G8E A;  1CS8 A;  2DCA A;  1JQP A;  3V6E A;  3PW3 A;  4FJC A;  2IBI A;  2E00 A;  5CVO B;  3IV2 A;  4X6I A;  5CVN B;  4MZO A;  2E01 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...