4CDCB

Human dpp1 in complex with (2s)-2-amino-n-((1s)-1-cyano-2-(4- phenylphenyl)ethyl)butanamide
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
162
structure length
162
Chain Sequence
b'HLPTSWDWRNVHGINFVSPVRNQASCGSCYSFASMGMLEARIRILTNNSQTPILSPQEVVSCSQYAQGCEGGFPYLIAGKYAQDFGLVEEACFPYTGTDSPCKMKEDCFRYYSSEYHYVGGFYGGCNEALMKLELVHHGPMAVAFEVYDDFLHYKKGIYHHT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DIPEPTIDYL PEPTIDASE 1 EXCLUSION DOMAIN CHAIN
publication title Cathepsin C Inhibitors: Property Optimization and Identification of a Clinical Candidate.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 43
structure length 162
sequence length 162
chains with identical sequence E, H, K
ec nomenclature ec 3.4.14.1: Dipeptidyl-peptidase I.
pdb deposition date 2013-10-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 4cdcB01
1CB5A 3MHHA 1Q6KA 3QSDA 1CS8A 3N3GA 3IMAA 1U5IA 2YJ8A 3OVXA 1PPDA 2H7JA 2NQGA 4XUIA 1MIRA 2E02A 4OELA 3HHIA 4XR7A 1S4VA 4QRGA 2G8JA 1VJVA 1CPJA 2AS8A 2XU5A 4YYQA 4AXLA 1YT7A 2IPPB 2PREA 4YYSA 3DF0A 5F02A 5J94A 3NHEA 2FRAA 2FTDA 3K8UA 2AU1A 1X9YA 2DC9A 1AIMA 3H89A 1AU0A 3C9EA 1QOLA 2F1GA 2ATOA 3PNRA 1KFXL 2YJCA 3P5UA 4DMXA 2XU3A 4I05A 2HH5A 4Q8HA 3KW9A 3D6SA 1EWMA 4CDEB 4AXMA 2BDLA 1POPA 1CJLA 3H7DA 3F5VA 3BPFA 3H8CA 4Q8GA 1QMYA 1F29A 5FPWA 1IWDA 2CIOA 2FYEA 1GLOA 1ATKA 4FJCA 4PI3A 2P7UA 2DC7A 2R9CA 1KHPA 2AUZA 4X6IA 1TLOA 4CDFB 3MHSA 1SNKA 1ME4A 3O0UA 3MTNA 4QH6A 1XKGA 2HXZA 1NLJA 1THEA 4YV8A 3I3TA 4CDCB 1TL9A 2DCAA 2R9MA 4MSXA 2P0RA 3PDFA 3M99A 1NL6A 1KFUL 3KSEA 2NQIA 1NB5A 1EWOA 1GMYA 4BSQA 4PP1A 2DJFB 1GCBA 1BP4A 4FK5A 3I06A 1MEMA 3TNXA 2NQDB 1KXRA 2NQAA 2PBHA 4OEMA 1FH0A 1F2AA 2XU4A 1Y4HA 1MS6A 2FT2A 3RVWA 3LFYA 1PCIA 3KX1A 1AU3A 4YYVA 3HHAA 4KLBA 3P5XA 1F2CA 1U9QX 2DZYA 3USVA 3RVVA 3KFQA 3HD3A 4N79A 1PXVA 2P86A 2DCBA 2FUDA 2ACTA 4YYWA 2ARYA 4K7CA 1CSBB 2XU1A 1ITOA 5K16A 3IV2A 3PBHA 4MZSA 3E1ZB 3QT4A 3AI8A 3O1GA 3CBKA 2IBIA 1AYWA 4FIPA 3P5WA 2AVWA 2HHNA 1U9VA 1U9WA 2BDZA 3OF9A 1EWPA 5JA7A 5EF4A 3OF8A 2B1MA 1AYUA 1KHQA 1PPNA 4YYUA 4N8WA 1M6DA 3KWBX 3N4CA 3B79A 2FQ9A 2Y6EA 2G8EA 3IUTA 3RVXA 3H6SA 1O0EA 1PPOA 4QRXA 4PADA 2AIMA 1YVBA 1MHWA 9PAPA 3HWNA 3S3QA 4HWYA 1VSNA 2OZ2A 2AUXA 2GFOA 2FO5A 3WXEA 1ME3A 1A6RA 4X6JA 1BGOA 3CH2X 2DJGB 2DCCA 3IOQA 3WXFA 4BS5A 3MORA 2WBFX 2FRQA 3BOWA 4N4ZA 1YK8A 2R9NA 4YVAA 1ZIVA 2HD5A 2DZZA 1U9XA 5CHTA 1STFE 2YJ9A 2YJBA 1PIPA 5CHVA 3GCBA 5JH3A 4RY2A 4P6EA 2JQGR 2E01A 3OVZA 1BY8A 3K9MA 2GHUA 2AYNA 2G7YA 3QJ3A 1AYVA 3S3RA 6PADA 1NB3A 1DF0A 1QXPA 2JQFR 1NQCA 3IHPA 3F75A 3WXGA 4W4UA 2AYOA 4MZOA 4G54A 3N3KA 1EF7A 1SP4B 1QDQA 2PNSA 2OULA 1TU6A 1Y08A 4ZUXU 1JQPA 1PE6A 2VHSA 4X6HA 4YYRA 4CZWA 3V6CA 1MEGA 4I07A 1YALA 3ZUAA 8PCHA 1CTEA 1PBHA 2DCDA 4BPVA 3P5VA 5CVMA 2G6DA 1AECA 3U8EA 4CDDB 1EWLA 2F7DA 3H8BA 2E00A 3PW3A 1YK7A 4BQVA 4QBBA 4WA6A 5CVNB 2O6XA 1NPZA 2OP3A 3BC3A 5CVOB 3OISA 3K24A 4QRVA 1HUCB 5A24A 1PADA 3BPMA 2B1NA 3CBJA 3LXSA 1CVZA 1F2BA 4BS6A 1BQIA 1AU2A 1ICFA 2R9FA 4W5CA 1MDWA 4PP2E 2R6NA 2C0YA 1CQDA 2E03A 3ERVA 2Y5BA 3BWKA 5PADA 7PCKA 3IEJA 1ZCMA 3CH3X 3KWZA 2CB5A 3V6EA 4DMYA 2PADA 1AU4A 1PPPA 2R9OA 4W5BA 5EGWA 1CV8A 2YJ2A 3KKUA 3BCNA 1GECE 1DEUA 1K3BB 2DC8A 4P6GA 4I04A 2DC6A 2VHFA
chains in the Genus database with same CATH superfamily
1CB5A 4MM3B 2Z84A 3MHHA 1Q6KA 3QSDA 1CS8A 3N3GA 3IMAA 1U5IA 2YJ8A 3OVXA 1PPDA 2H7JA 2NQGA 3TRKA 4XUIA 1MIRA 2E02A 4OELA 3HHIA 4XR7A 1S4VA 4QRGA 2G8JA 2HWKA 3BBAA 1VJVA 1CPJA 2AS8A 2XU5A 4YYQA 4AXLA 1YT7A 2IPPB 2PREA 4YYSA 2BTWB 3DF0A 5F02A 5J94A 3NHEA 2JRIA 2FRAA 2FTDA 3K8UA 2AU1A 1X9YA 2DC9A 1AIMA 3H89A 1AU0A 3C9EA 1QOLA 4MI7A 2F1GA 2ATOA 3PNRA 1KFXL 2YJCA 3P5UA 4DMXA 2XU3A 4I05A 2HH5A 4Q8HA 1PVJA 3KW9A 3D6SA 1EWMA 4CDEB 4AXMA 2BDLA 1POPA 1CJLA 3H7DA 3F5VA 3BPFA 3H8CA 3B21A 4Q8GA 1QMYA 1F29A 5FPWA 1IWDA 2CIOA 3PRMA 2FYEA 1GLOA 1ATKA 4FJCA 4PI3A 2P7UA 2DC7A 2R9CA 1KHPA 2AUZA 2J7QC 4X6IA 1TLOA 4CDFB 3MHSA 1SNKA 1ME4A 3TMPA 4OW0A 3O0UA 3MTNA 4QH6A 1XKGA 2HXZA 1NLJA 1THEA 4YV8A 3I3TA 4CDCB 1TL9A 2DCAA 2R9MA 5JZEA 4MSXA 2P0RA 3PDFA 3M99A 1NL6A 1KFUL 3PRPA 3KSEA 2NQIA 1NB5A 1EWOA 1GMYA 4BSQA 4PP1A 2DJFB 1GCBA 1BP4A 4FK5A 3I06A 4WURA 1MEMA 3TNXA 2NQDB 1KXRA 4P16A 2NQAA 2PBHA 4OEMA 1FH0A 1F2AA 3PHWA 5E6JA 2XU4A 1Y4HA 1MS6A 2FT2A 3RVWA 3LFYA 1PCIA 3KX1A 1AU3A 4YYVA 3HHAA 4KLBA 3P5XA 1F2CA 1U9QX 2DZYA 3USVA 3RVVA 3KFQA 3HD3A 2UZJA 3OQCA 1PXVA 4N79A 4RNAA 2P86A 2DCBA 4BOZA 2FUDA 2ACTA 4YYWA 4BOUA 3O65A 2ARYA 4K7CA 1CSBB 2XU1A 4D8EA 1ITOA 5K16A 3IV2A 3PBHA 4MZSA 3E1ZB 2DOSA 4IP3A 3QT4A 3AI8A 3O1GA 3CBKA 2J7QA 1UKFA 2IBIA 1AYWA 4FIPA 3P5WA 4XZXA 2AVWA 2HHNA 3PT2A 1U9VA 1U9WA 2BDZA 3OF9A 1EWPA 5JA7A 5EF4A 3OF8A 2B1MA 1AYUA 4GUAA 1KHQA 1PPNA 4YYUA 4N8WA 1M6DA 3KWBX 3N4CA 3B79A 2AGAA 2FQ9A 2Y6EA 4RF1A 2G8EA 3IUTA 3RVXA 3H6SA 1O0EA 4BOSA 2FE8A 1PPOA 4QRXA 4PADA 4M0WA 2AIMA 1DKIA 1YVBA 1MHWA 9PAPA 3RNVA 4BOPA 3HWNA 3S3QA 4RF0A 4HWYA 1VSNA 4REZA 4RKXA 2OZ2A 3IFUA 2AUXA 2GFOA 4IUMA 2FO5A 3WXEA 1ME3A 3ZNHA 1A6RA 4X6JA 1BGOA 3CH2X 2DJGB 2DCCA 3IOQA 4PT5A 3WXFA 4BS5A 3E9SA 3MORA 2WBFX 2FRQA 3BOWA 4N4ZA 1YK8A 2R9NA 4YVAA 1ZIVA 2HD5A 2DZZA 1YZBA 1U9XA 5CHTA 5EZQA 1STFE 2YJ9A 3PSEA 2YJBA 1PIPA 5CHVA 4D8IA 3GCBA 5JH3A 4RY2A 4P6EA 4ZTBA 2JQGR 2E01A 3OVZA 1BY8A 3K9MA 3C0RA 2GHUA 2AYNA 2G7YA 3QJ3A 1AYVA 3S3RA 6PADA 1NB3A 1DF0A 1QXPA 2JQFR 1NQCA 3IHPA 3F75A 4OVZB 3WXGA 4W4UA 2AYOA 4MZOA 4G54A 3W31A 3N3KA 1EF7A 4HXDB 1SP4B 1QDQA 2PNSA 2OULA 3PHXA 1TU6A 1Y08A 4ZUXU 1JQPA 1PE6A 2VHSA 4X6HA 4YYRA 4CZWA 3V6CA 1MEGA 3MTVA 4I07A 4D8BA 1YALA 3ZUAA 8PCHA 1CTEA 1PBHA 2DCDA 4BPVA 3BB7A 3P5VA 5CVMA 2G6DA 1AECA 3PHUA 4R3DA 3MJ5A 3U8EA 2BU3A 4CDDB 1EWLA 2F7DA 3H8BA 2E00A 3PW3A 1YK7A 4BQVA 4QBBA 4WA6A 3W30A 5CVNB 2O6XA 1NPZA 2OP3A 3BC3A 5CVOB 2JTCA 3OISA 3K24A 4QRVA 3MP2A 1HUCB 5A24A 1PADA 3BPMA 2B1NA 3CBJA 3LXSA 5EZSA 1CVZA 1F2BA 4BS6A 1BQIA 1AU2A 1ICFA 2R9FA 4W5CA 1MDWA 4PP2E 2R6NA 2C0YA 1CQDA 2E03A 3ERVA 2Y5BA 3BWKA 5PADA 7PCKA 3IEJA 1ZCMA 3CH3X 3KWZA 2CB5A 3V6EA 4DMYA 3BY4A 2PADA 1AU4A 4BOQA 1PPPA 2R9OA 5KO3A 4W5BA 5EGWA 1CV8A 2YJ2A 3KKUA 3BCNA 1GECE 1DEUA 1K3BB 2DC8A 4OVZA 4P6GA 2BTWA 4I04A 2DC6A 4A5UA 2VHFA
chains in the Genus database with same CATH topology
1CB5A 3MHHA 1Q6KA 3QSDA 1CS8A 3N3GA 3IMAA 1U5IA 2YJ8A 3OVXA 1PPDA 2H7JA 2NQGA 4XUIA 1MIRA 1W4TA 2E02A 4BGFA 4OELA 3HHIA 4XR7A 1S4VA 4QRGA 2G8JA 1W6FA 1E2TA 1VJVA 1CPJA 2AS8A 2XU5A 4YYQA 4AXLA 1YT7A 2IPPB 2PREA 4YYSA 3DF0A 5F02A 5J94A 3NHEA 2FRAA 2FTDA 3K8UA 2AU1A 1X9YA 2DC9A 1AIMA 3H89A 1AU0A 3C9EA 1QOLA 2F1GA 2ATOA 3PNRA 1KFXL 2YJCA 3P5UA 4DMXA 2XU3A 4I05A 2HH5A 4Q8HA 3KW9A 3D6SA 1EWMA 4CDEB 4AXMA 2BDLA 1POPA 1CJLA 3H7DA 3F5VA 3BPFA 3H8CA 4Q8GA 1QMYA 1F29A 5FPWA 1IWDA 2CIOA 2FYEA 1GLOA 1ATKA 4FJCA 4PI3A 2P7UA 2DC7A 2R9CA 1KHPA 2AUZA 4X6IA 1TLOA 4CDFB 3MHSA 1SNKA 1ME4A 3O0UA 3MTNA 4QH6A 1XKGA 2HXZA 1NLJA 1THEA 4YV8A 3I3TA 4CDCB 1TL9A 2DCAA 2R9MA 4MSXA 2P0RA 3PDFA 3M99A 1NL6A 1KFUL 3KSEA 2NQIA 1NB5A 1EWOA 1GMYA 4BSQA 4PP1A 2DJFB 1GCBA 1BP4A 4FK5A 3I06A 4B55A 1MEMA 3TNXA 2NQDB 1KXRA 2NQAA 2PBHA 4GUZA 4OEMA 1FH0A 1F2AA 2XU4A 1Y4HA 1MS6A 2FT2A 3RVWA 3LFYA 4C5PA 1PCIA 3KX1A 1AU3A 4YYVA 3HHAA 4KLBA 3P5XA 1F2CA 1U9QX 2DZYA 3USVA 3RVVA 3KFQA 3HD3A 4N79A 1PXVA 2P86A 2DCBA 2FUDA 2ACTA 4YYWA 2ARYA 4K7CA 1CSBB 2XU1A 1ITOA 5K16A 3IV2A 3PBHA 4MZSA 3E1ZB 3QT4A 3AI8A 3O1GA 3CBKA 2IBIA 1AYWA 4FIPA 3P5WA 3LTWA 2AVWA 2HHNA 1U9VA 1U9WA 2BDZA 3OF9A 2VFCA 1EWPA 5JA7A 5EF4A 3OF8A 2B1MA 1AYUA 1KHQA 1PPNA 4YYUA 4N8WA 1M6DA 3KWBX 3N4CA 4NV8A 3B79A 2FQ9A 2Y6EA 2G8EA 3IUTA 3RVXA 3H6SA 1O0EA 1PPOA 4QRXA 4PADA 2AIMA 2BSZA 1YVBA 1MHWA 9PAPA 3HWNA 3S3QA 4HWYA 1VSNA 2OZ2A 2AUXA 2GFOA 2FO5A 3WXEA 1ME3A 1A6RA 4X6JA 1BGOA 3CH2X 2DJGB 2DCCA 3IOQA 3WXFA 4BS5A 3MORA 2WBFX 2FRQA 3BOWA 4N4ZA 1YK8A 2R9NA 1W5RA 4YVAA 1ZIVA 2HD5A 2DZZA 1U9XA 5CHTA 1STFE 2YJ9A 2YJBA 1PIPA 5CHVA 3GCBA 5JH3A 4RY2A 4P6EA 2JQGR 2E01A 3OVZA 1BY8A 3K9MA 2GHUA 2AYNA 2G7YA 3QJ3A 1AYVA 3S3RA 6PADA 1NB3A 1DF0A 1QXPA 2JQFR 1GX3A 1NQCA 3IHPA 3F75A 3WXGA 4W4UA 2AYOA 4MZOA 4G54A 3N3KA 1EF7A 1SP4B 1QDQA 2PNSA 2OULA 1TU6A 1Y08A 4ZUXU 1JQPA 1PE6A 2VHSA 4X6HA 4YYRA 4CZWA 3V6CA 1MEGA 4I07A 4NV7A 1YALA 3ZUAA 8PCHA 1CTEA 1PBHA 2DCDA 4BPVA 3D9WA 3P5VA 5CVMA 2G6DA 1AECA 3U8EA 4CDDB 1EWLA 2F7DA 3H8BA 2E00A 3PW3A 1YK7A 4BQVA 4QBBA 4WA6A 5CVNB 2O6XA 1NPZA 2OP3A 3BC3A 5CVOB 3OISA 3K24A 4QRVA 1HUCB 5A24A 1PADA 3BPMA 2B1NA 3CBJA 3LXSA 1CVZA 1F2BA 4BS6A 1BQIA 1AU2A 1ICFA 2R9FA 4W5CA 1MDWA 4PP2E 2R6NA 2C0YA 1CQDA 2E03A 3ERVA 2Y5BA 3BWKA 5PADA 7PCKA 3IEJA 1ZCMA 3CH3X 3KWZA 2CB5A 3V6EA 4DMYA 2PADA 1AU4A 1PPPA 2R9OA 4W5BA 5EGWA 1CV8A 2VFBA 2YJ2A 3KKUA 3BCNA 1GECE 1DEUA 1K3BB 2DC8A 4P6GA 4I04A 2DC6A 2VHFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CB5 A;  3MHH A;  1Q6K A;  3QSD A;  1CS8 A;  3N3G A;  3IMA A;  1U5I A;  2YJ8 A;  3OVX A;  1PPD A;  2H7J A;  2NQG A;  4XUI A;  1MIR A;  2E02 A;  4OEL A;  3HHI A;  4XR7 A;  1S4V A;  4QRG A;  2G8J A;  1VJV A;  1CPJ A;  2AS8 A;  2XU5 A;  4YYQ A;  4AXL A;  1YT7 A;  2IPP B;  2PRE A;  4YYS A;  3DF0 A;  5F02 A;  5J94 A;  3NHE A;  2FRA A;  2FTD A;  3K8U A;  2AU1 A;  1X9Y A;  2DC9 A;  1AIM A;  3H89 A;  1AU0 A;  3C9E A;  1QOL A;  2F1G A;  2ATO A;  3PNR A;  1KFX L;  2YJC A;  3P5U A;  4DMX A;  2XU3 A;  4I05 A;  2HH5 A;  4Q8H A;  3KW9 A;  3D6S A;  1EWM A;  4CDE B;  4AXM A;  2BDL A;  1POP A;  1CJL A;  3H7D A;  3F5V A;  3BPF A;  3H8C A;  4Q8G A;  1QMY A;  1F29 A;  5FPW A;  1IWD A;  2CIO A;  2FYE A;  1GLO A;  1ATK A;  4FJC A;  4PI3 A;  2P7U A;  2DC7 A;  2R9C A;  1KHP A;  2AUZ A;  4X6I A;  1TLO A;  4CDF B;  3MHS A;  1SNK A;  1ME4 A;  3O0U A;  3MTN A;  4QH6 A;  1XKG A;  2HXZ A;  1NLJ A;  1THE A;  4YV8 A;  3I3T A;  4CDC B;  1TL9 A;  2DCA A;  2R9M A;  4MSX A;  2P0R A;  3PDF A;  3M99 A;  1NL6 A;  1KFU L;  3KSE A;  2NQI A;  1NB5 A;  1EWO A;  1GMY A;  4BSQ A;  4PP1 A;  2DJF B;  1GCB A;  1BP4 A;  4FK5 A;  3I06 A;  1MEM A;  3TNX A;  2NQD B;  1KXR A;  2NQA A;  2PBH A;  4OEM A;  1FH0 A;  1F2A A;  2XU4 A;  1Y4H A;  1MS6 A;  2FT2 A;  3RVW A;  3LFY A;  1PCI A;  3KX1 A;  1AU3 A;  4YYV A;  3HHA A;  4KLB A;  3P5X A;  1F2C A;  1U9Q X;  2DZY A;  3USV A;  3RVV A;  3KFQ A;  3HD3 A;  4N79 A;  1PXV A;  2P86 A;  2DCB A;  2FUD A;  2ACT A;  4YYW A;  2ARY A;  4K7C A;  1CSB B;  2XU1 A;  1ITO A;  5K16 A;  3IV2 A;  3PBH A;  4MZS A;  3E1Z B;  3QT4 A;  3AI8 A;  3O1G A;  3CBK A;  2IBI A;  1AYW A;  4FIP A;  3P5W A;  2AVW A;  2HHN A;  1U9V A;  1U9W A;  2BDZ A;  3OF9 A;  1EWP A;  5JA7 A;  5EF4 A;  3OF8 A;  2B1M A;  1AYU A;  1KHQ A;  1PPN A;  4YYU A;  4N8W A;  1M6D A;  3KWB X;  3N4C A;  3B79 A;  2FQ9 A;  2Y6E A;  2G8E A;  3IUT A;  3RVX A;  3H6S A;  1O0E A;  1PPO A;  4QRX A;  4PAD A;  2AIM A;  1YVB A;  1MHW A;  9PAP A;  3HWN A;  3S3Q A;  4HWY A;  1VSN A;  2OZ2 A;  2AUX A;  2GFO A;  2FO5 A;  3WXE A;  1ME3 A;  1A6R A;  4X6J A;  1BGO A;  3CH2 X;  2DJG B;  2DCC A;  3IOQ A;  3WXF A;  4BS5 A;  3MOR A;  2WBF X;  2FRQ A;  3BOW A;  4N4Z A;  1YK8 A;  2R9N A;  4YVA A;  1ZIV A;  2HD5 A;  2DZZ A;  1U9X A;  5CHT A;  1STF E;  2YJ9 A;  2YJB A;  1PIP A;  5CHV A;  3GCB A;  5JH3 A;  4RY2 A;  4P6E A;  2JQG R;  2E01 A;  3OVZ A;  1BY8 A;  3K9M A;  2GHU A;  2AYN A;  2G7Y A;  3QJ3 A;  1AYV A;  3S3R A;  6PAD A;  1NB3 A;  1DF0 A;  1QXP A;  2JQF R;  1NQC A;  3IHP A;  3F75 A;  3WXG A;  4W4U A;  2AYO A;  4MZO A;  4G54 A;  3N3K A;  1EF7 A;  1SP4 B;  1QDQ A;  2PNS A;  2OUL A;  1TU6 A;  1Y08 A;  4ZUX U;  1JQP A;  1PE6 A;  2VHS A;  4X6H A;  4YYR A;  4CZW A;  3V6C A;  1MEG A;  4I07 A;  1YAL A;  3ZUA A;  8PCH A;  1CTE A;  1PBH A;  2DCD A;  4BPV A;  3P5V A;  5CVM A;  2G6D A;  1AEC A;  3U8E A;  4CDD B;  1EWL A;  2F7D A;  3H8B A;  2E00 A;  3PW3 A;  1YK7 A;  4BQV A;  4QBB A;  4WA6 A;  5CVN B;  2O6X A;  1NPZ A;  2OP3 A;  3BC3 A;  5CVO B;  3OIS A;  3K24 A;  4QRV A;  1HUC B;  5A24 A;  1PAD A;  3BPM A;  2B1N A;  3CBJ A;  3LXS A;  1CVZ A;  1F2B A;  4BS6 A;  1BQI A;  1AU2 A;  1ICF A;  2R9F A;  4W5C A;  1MDW A;  4PP2 E;  2R6N A;  2C0Y A;  1CQD A;  2E03 A;  3ERV A;  2Y5B A;  3BWK A;  5PAD A;  7PCK A;  3IEJ A;  1ZCM A;  3CH3 X;  3KWZ A;  2CB5 A;  3V6E A;  4DMY A;  2PAD A;  1AU4 A;  1PPP A;  2R9O A;  4W5B A;  5EGW A;  1CV8 A;  2YJ2 A;  3KKU A;  3BCN A;  1GEC E;  1DEU A;  1K3B B;  2DC8 A;  4P6G A;  4I04 A;  2DC6 A;  2VHF A; 
#chains in the Genus database with same CATH topology
 1CB5 A;  4MM3 B;  2Z84 A;  3MHH A;  1Q6K A;  3QSD A;  1CS8 A;  3N3G A;  3IMA A;  1U5I A;  2YJ8 A;  3OVX A;  1PPD A;  2H7J A;  2NQG A;  3TRK A;  4XUI A;  1MIR A;  2E02 A;  4OEL A;  3HHI A;  4XR7 A;  1S4V A;  4QRG A;  2G8J A;  2HWK A;  3BBA A;  1VJV A;  1CPJ A;  2AS8 A;  2XU5 A;  4YYQ A;  4AXL A;  1YT7 A;  2IPP B;  2PRE A;  4YYS A;  2BTW B;  3DF0 A;  5F02 A;  5J94 A;  3NHE A;  2JRI A;  2FRA A;  2FTD A;  3K8U A;  2AU1 A;  1X9Y A;  2DC9 A;  1AIM A;  3H89 A;  1AU0 A;  3C9E A;  1QOL A;  4MI7 A;  2F1G A;  2ATO A;  3PNR A;  1KFX L;  2YJC A;  3P5U A;  4DMX A;  2XU3 A;  4I05 A;  2HH5 A;  4Q8H A;  1PVJ A;  3KW9 A;  3D6S A;  1EWM A;  4CDE B;  4AXM A;  2BDL A;  1POP A;  1CJL A;  3H7D A;  3F5V A;  3BPF A;  3H8C A;  3B21 A;  4Q8G A;  1QMY A;  1F29 A;  5FPW A;  1IWD A;  2CIO A;  3PRM A;  2FYE A;  1GLO A;  1ATK A;  4FJC A;  4PI3 A;  2P7U A;  2DC7 A;  2R9C A;  1KHP A;  2AUZ A;  2J7Q C;  4X6I A;  1TLO A;  4CDF B;  3MHS A;  1SNK A;  1ME4 A;  3TMP A;  4OW0 A;  3O0U A;  3MTN A;  4QH6 A;  1XKG A;  2HXZ A;  1NLJ A;  1THE A;  4YV8 A;  3I3T A;  4CDC B;  1TL9 A;  2DCA A;  2R9M A;  5JZE A;  4MSX A;  2P0R A;  3PDF A;  3M99 A;  1NL6 A;  1KFU L;  3PRP A;  3KSE A;  2NQI A;  1NB5 A;  1EWO A;  1GMY A;  4BSQ A;  4PP1 A;  2DJF B;  1GCB A;  1BP4 A;  4FK5 A;  3I06 A;  4WUR A;  1MEM A;  3TNX A;  2NQD B;  1KXR A;  4P16 A;  2NQA A;  2PBH A;  4OEM A;  1FH0 A;  1F2A A;  3PHW A;  5E6J A;  2XU4 A;  1Y4H A;  1MS6 A;  2FT2 A;  3RVW A;  3LFY A;  1PCI A;  3KX1 A;  1AU3 A;  4YYV A;  3HHA A;  4KLB A;  3P5X A;  1F2C A;  1U9Q X;  2DZY A;  3USV A;  3RVV A;  3KFQ A;  3HD3 A;  2UZJ A;  3OQC A;  1PXV A;  4N79 A;  4RNA A;  2P86 A;  2DCB A;  4BOZ A;  2FUD A;  2ACT A;  4YYW A;  4BOU A;  3O65 A;  2ARY A;  4K7C A;  1CSB B;  2XU1 A;  4D8E A;  1ITO A;  5K16 A;  3IV2 A;  3PBH A;  4MZS A;  3E1Z B;  2DOS A;  4IP3 A;  3QT4 A;  3AI8 A;  3O1G A;  3CBK A;  2J7Q A;  1UKF A;  2IBI A;  1AYW A;  4FIP A;  3P5W A;  4XZX A;  2AVW A;  2HHN A;  3PT2 A;  1U9V A;  1U9W A;  2BDZ A;  3OF9 A;  1EWP A;  5JA7 A;  5EF4 A;  3OF8 A;  2B1M A;  1AYU A;  4GUA A;  1KHQ A;  1PPN A;  4YYU A;  4N8W A;  1M6D A;  3KWB X;  3N4C A;  3B79 A;  2AGA A;  2FQ9 A;  2Y6E A;  4RF1 A;  2G8E A;  3IUT A;  3RVX A;  3H6S A;  1O0E A;  4BOS A;  2FE8 A;  1PPO A;  4QRX A;  4PAD A;  4M0W A;  2AIM A;  1DKI A;  1YVB A;  1MHW A;  9PAP A;  3RNV A;  4BOP A;  3HWN A;  3S3Q A;  4RF0 A;  4HWY A;  1VSN A;  4REZ A;  4RKX A;  2OZ2 A;  3IFU A;  2AUX A;  2GFO A;  4IUM A;  2FO5 A;  3WXE A;  1ME3 A;  3ZNH A;  1A6R A;  4X6J A;  1BGO A;  3CH2 X;  2DJG B;  2DCC A;  3IOQ A;  4PT5 A;  3WXF A;  4BS5 A;  3E9S A;  3MOR A;  2WBF X;  2FRQ A;  3BOW A;  4N4Z A;  1YK8 A;  2R9N A;  4YVA A;  1ZIV A;  2HD5 A;  2DZZ A;  1YZB A;  1U9X A;  5CHT A;  5EZQ A;  1STF E;  2YJ9 A;  3PSE A;  2YJB A;  1PIP A;  5CHV A;  4D8I A;  3GCB A;  5JH3 A;  4RY2 A;  4P6E A;  4ZTB A;  2JQG R;  2E01 A;  3OVZ A;  1BY8 A;  3K9M A;  3C0R A;  2GHU A;  2AYN A;  2G7Y A;  3QJ3 A;  1AYV A;  3S3R A;  6PAD A;  1NB3 A;  1DF0 A;  1QXP A;  2JQF R;  1NQC A;  3IHP A;  3F75 A;  4OVZ B;  3WXG A;  4W4U A;  2AYO A;  4MZO A;  4G54 A;  3W31 A;  3N3K A;  1EF7 A;  4HXD B;  1SP4 B;  1QDQ A;  2PNS A;  2OUL A;  3PHX A;  1TU6 A;  1Y08 A;  4ZUX U;  1JQP A;  1PE6 A;  2VHS A;  4X6H A;  4YYR A;  4CZW A;  3V6C A;  1MEG A;  3MTV A;  4I07 A;  4D8B A;  1YAL A;  3ZUA A;  8PCH A;  1CTE A;  1PBH A;  2DCD A;  4BPV A;  3BB7 A;  3P5V A;  5CVM A;  2G6D A;  1AEC A;  3PHU A;  4R3D A;  3MJ5 A;  3U8E A;  2BU3 A;  4CDD B;  1EWL A;  2F7D A;  3H8B A;  2E00 A;  3PW3 A;  1YK7 A;  4BQV A;  4QBB A;  4WA6 A;  3W30 A;  5CVN B;  2O6X A;  1NPZ A;  2OP3 A;  3BC3 A;  5CVO B;  2JTC A;  3OIS A;  3K24 A;  4QRV A;  3MP2 A;  1HUC B;  5A24 A;  1PAD A;  3BPM A;  2B1N A;  3CBJ A;  3LXS A;  5EZS A;  1CVZ A;  1F2B A;  4BS6 A;  1BQI A;  1AU2 A;  1ICF A;  2R9F A;  4W5C A;  1MDW A;  4PP2 E;  2R6N A;  2C0Y A;  1CQD A;  2E03 A;  3ERV A;  2Y5B A;  3BWK A;  5PAD A;  7PCK A;  3IEJ A;  1ZCM A;  3CH3 X;  3KWZ A;  2CB5 A;  3V6E A;  4DMY A;  3BY4 A;  2PAD A;  1AU4 A;  4BOQ A;  1PPP A;  2R9O A;  5KO3 A;  4W5B A;  5EGW A;  1CV8 A;  2YJ2 A;  3KKU A;  3BCN A;  1GEC E;  1DEU A;  1K3B B;  2DC8 A;  4OVZ A;  4P6G A;  2BTW A;  4I04 A;  2DC6 A;  4A5U A;  2VHF A; 
#chains in the Genus database with same CATH homology
 1CB5 A;  3MHH A;  1Q6K A;  3QSD A;  1CS8 A;  3N3G A;  3IMA A;  1U5I A;  2YJ8 A;  3OVX A;  1PPD A;  2H7J A;  2NQG A;  4XUI A;  1MIR A;  1W4T A;  2E02 A;  4BGF A;  4OEL A;  3HHI A;  4XR7 A;  1S4V A;  4QRG A;  2G8J A;  1W6F A;  1E2T A;  1VJV A;  1CPJ A;  2AS8 A;  2XU5 A;  4YYQ A;  4AXL A;  1YT7 A;  2IPP B;  2PRE A;  4YYS A;  3DF0 A;  5F02 A;  5J94 A;  3NHE A;  2FRA A;  2FTD A;  3K8U A;  2AU1 A;  1X9Y A;  2DC9 A;  1AIM A;  3H89 A;  1AU0 A;  3C9E A;  1QOL A;  2F1G A;  2ATO A;  3PNR A;  1KFX L;  2YJC A;  3P5U A;  4DMX A;  2XU3 A;  4I05 A;  2HH5 A;  4Q8H A;  3KW9 A;  3D6S A;  1EWM A;  4CDE B;  4AXM A;  2BDL A;  1POP A;  1CJL A;  3H7D A;  3F5V A;  3BPF A;  3H8C A;  4Q8G A;  1QMY A;  1F29 A;  5FPW A;  1IWD A;  2CIO A;  2FYE A;  1GLO A;  1ATK A;  4FJC A;  4PI3 A;  2P7U A;  2DC7 A;  2R9C A;  1KHP A;  2AUZ A;  4X6I A;  1TLO A;  4CDF B;  3MHS A;  1SNK A;  1ME4 A;  3O0U A;  3MTN A;  4QH6 A;  1XKG A;  2HXZ A;  1NLJ A;  1THE A;  4YV8 A;  3I3T A;  4CDC B;  1TL9 A;  2DCA A;  2R9M A;  4MSX A;  2P0R A;  3PDF A;  3M99 A;  1NL6 A;  1KFU L;  3KSE A;  2NQI A;  1NB5 A;  1EWO A;  1GMY A;  4BSQ A;  4PP1 A;  2DJF B;  1GCB A;  1BP4 A;  4FK5 A;  3I06 A;  4B55 A;  1MEM A;  3TNX A;  2NQD B;  1KXR A;  2NQA A;  2PBH A;  4GUZ A;  4OEM A;  1FH0 A;  1F2A A;  2XU4 A;  1Y4H A;  1MS6 A;  2FT2 A;  3RVW A;  3LFY A;  4C5P A;  1PCI A;  3KX1 A;  1AU3 A;  4YYV A;  3HHA A;  4KLB A;  3P5X A;  1F2C A;  1U9Q X;  2DZY A;  3USV A;  3RVV A;  3KFQ A;  3HD3 A;  4N79 A;  1PXV A;  2P86 A;  2DCB A;  2FUD A;  2ACT A;  4YYW A;  2ARY A;  4K7C A;  1CSB B;  2XU1 A;  1ITO A;  5K16 A;  3IV2 A;  3PBH A;  4MZS A;  3E1Z B;  3QT4 A;  3AI8 A;  3O1G A;  3CBK A;  2IBI A;  1AYW A;  4FIP A;  3P5W A;  3LTW A;  2AVW A;  2HHN A;  1U9V A;  1U9W A;  2BDZ A;  3OF9 A;  2VFC A;  1EWP A;  5JA7 A;  5EF4 A;  3OF8 A;  2B1M A;  1AYU A;  1KHQ A;  1PPN A;  4YYU A;  4N8W A;  1M6D A;  3KWB X;  3N4C A;  4NV8 A;  3B79 A;  2FQ9 A;  2Y6E A;  2G8E A;  3IUT A;  3RVX A;  3H6S A;  1O0E A;  1PPO A;  4QRX A;  4PAD A;  2AIM A;  2BSZ A;  1YVB A;  1MHW A;  9PAP A;  3HWN A;  3S3Q A;  4HWY A;  1VSN A;  2OZ2 A;  2AUX A;  2GFO A;  2FO5 A;  3WXE A;  1ME3 A;  1A6R A;  4X6J A;  1BGO A;  3CH2 X;  2DJG B;  2DCC A;  3IOQ A;  3WXF A;  4BS5 A;  3MOR A;  2WBF X;  2FRQ A;  3BOW A;  4N4Z A;  1YK8 A;  2R9N A;  1W5R A;  4YVA A;  1ZIV A;  2HD5 A;  2DZZ A;  1U9X A;  5CHT A;  1STF E;  2YJ9 A;  2YJB A;  1PIP A;  5CHV A;  3GCB A;  5JH3 A;  4RY2 A;  4P6E A;  2JQG R;  2E01 A;  3OVZ A;  1BY8 A;  3K9M A;  2GHU A;  2AYN A;  2G7Y A;  3QJ3 A;  1AYV A;  3S3R A;  6PAD A;  1NB3 A;  1DF0 A;  1QXP A;  2JQF R;  1GX3 A;  1NQC A;  3IHP A;  3F75 A;  3WXG A;  4W4U A;  2AYO A;  4MZO A;  4G54 A;  3N3K A;  1EF7 A;  1SP4 B;  1QDQ A;  2PNS A;  2OUL A;  1TU6 A;  1Y08 A;  4ZUX U;  1JQP A;  1PE6 A;  2VHS A;  4X6H A;  4YYR A;  4CZW A;  3V6C A;  1MEG A;  4I07 A;  4NV7 A;  1YAL A;  3ZUA A;  8PCH A;  1CTE A;  1PBH A;  2DCD A;  4BPV A;  3D9W A;  3P5V A;  5CVM A;  2G6D A;  1AEC A;  3U8E A;  4CDD B;  1EWL A;  2F7D A;  3H8B A;  2E00 A;  3PW3 A;  1YK7 A;  4BQV A;  4QBB A;  4WA6 A;  5CVN B;  2O6X A;  1NPZ A;  2OP3 A;  3BC3 A;  5CVO B;  3OIS A;  3K24 A;  4QRV A;  1HUC B;  5A24 A;  1PAD A;  3BPM A;  2B1N A;  3CBJ A;  3LXS A;  1CVZ A;  1F2B A;  4BS6 A;  1BQI A;  1AU2 A;  1ICF A;  2R9F A;  4W5C A;  1MDW A;  4PP2 E;  2R6N A;  2C0Y A;  1CQD A;  2E03 A;  3ERV A;  2Y5B A;  3BWK A;  5PAD A;  7PCK A;  3IEJ A;  1ZCM A;  3CH3 X;  3KWZ A;  2CB5 A;  3V6E A;  4DMY A;  2PAD A;  1AU4 A;  1PPP A;  2R9O A;  4W5B A;  5EGW A;  1CV8 A;  2VFB A;  2YJ2 A;  3KKU A;  3BCN A;  1GEC E;  1DEU A;  1K3B B;  2DC8 A;  4P6G A;  4I04 A;  2DC6 A;  2VHF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...