4CDCB

Human dpp1 in complex with (2s)-2-amino-n-((1s)-1-cyano-2-(4- phenylphenyl)ethyl)butanamide
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
162
structure length
162
Chain Sequence
HLPTSWDWRNVHGINFVSPVRNQASCGSCYSFASMGMLEARIRILTNNSQTPILSPQEVVSCSQYAQGCEGGFPYLIAGKYAQDFGLVEEACFPYTGTDSPCKMKEDCFRYYSSEYHYVGGFYGGCNEALMKLELVHHGPMAVAFEVYDDFLHYKKGIYHHT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DIPEPTIDYL PEPTIDASE 1 EXCLUSION DOMAIN CHAIN
publication title Cathepsin C Inhibitors: Property Optimization and Identification of a Clinical Candidate.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 43
structure length 162
sequence length 162
chains with identical sequence E, H, K
ec nomenclature ec 3.4.14.1: Dipeptidyl-peptidase I.
pdb deposition date 2013-10-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 4cdcB01
3OF8A 4FK5A 2AU1A 2NQIA 3OVXA 1VSNA 3K24A 5PADA 2HD5A 3PNRA 5K16A 4CDFB 3QSDA 2DC9A 1AU4A 2ARYA 3H7DA 3N3GA 4DMYA 1BQIA 4PADA 3H6SA 1Q6KA 2ACTA 1SNKA 2OULA 1CQDA 1EWOA 1CV8A 4QRXA 1GCBA 2DC7A 3V6CA 4W5BA 4BS5A 2DZYA 3IEJA 1AU2A 1PADA 4YYSA 2OZ2A 1TLOA 4X6HA 1AECA 2G6DA 2P86A 1KFUL 2VHFA 3IUTA 1CTEA 1TL9A 1AIMA 1QMYA 1F29A 3RVXA 2R6NA 2B1NA 2OP3A 2CIOA 1CPJA 3BPFA 1BY8A 2FRAA 1AYVA 3N3KA 4YVAA 1YK7A 2JQFR 3S3QA 3N4CA 4OELA 1CSBB 5CVNB 3RVVA 2AS8A 3I3TA 3KSEA 1PE6A 1IWDA 1VJVA 2PADA 4W5CA 1YK8A 2R9OA 1CVZA 1PXVA 3M99A 1FH0A 2E02A 3BC3A 8PCHA 3BPMA 1ME4A 7PCKA 4QRVA 4PP2E 1EWMA 4QBBA 2DZZA 3KX1A 2G7YA 1Y08A 4I04A 1YT7A 2H7JA 2AVWA 2R9NA 3WXEA 4BPVA 4G54A 4YYQA 2DJFB 3HHAA 2DCBA 1MDWA 2B1MA 2DCAA 2ATOA 1JQPA 3O0UA 3CBKA 3MHHA 4W4UA 4CDDB 4YYUA 4FJCA 4PP1A 1O0EA 2AUXA 1GMYA 2F1GA 4FIPA 1NB5A 2XU3A 2E00A 1F2BA 1DEUA 1THEA 2E01A 4HWYA 4YYWA 3BOWA 2XU4A 4AXLA 4X6JA 1PBHA 4PI3A 5FPWA 3MHSA 4QH6A 4P6EA 1M6DA 2R9FA 1KHPA 1QXPA 3ERVA 4P6GA 2JQGR 2YJCA 4XUIA 3C9EA 1XKGA 1U9WA 3GCBA 2GHUA 1EWLA 1DF0A 3DF0A 2AYOA 1U5IA 3P5UA 1A6RA 2FRQA 3WXFA 3MORA 2XU1A 4K7CA 1PCIA 2AYNA 2PNSA 3HWNA 2Y6EA 1YVBA 3E1ZB 1KFXL 4CZWA 1GECE 5J94A 1ICFA 1CJLA 4YV8A 2NQGA 1MEGA 1YALA 4CDEB 4MSXA 3TNXA 1K3BB 3CBJA 9PAPA 6PADA 1MIRA 1POPA 2AIMA 2PREA 2AUZA 1KHQA 4BS6A 3IV2A 5JH3A 1S4VA 5JA7A 2R9CA 1GLOA 1EF7A 3WXGA 1MS6A 3V6EA 2CB5A 1Y4HA 2E03A 4WA6A 2C0YA 4X6IA 1ATKA 2DC6A 1F2CA 3IMAA 1U9QX 3PDFA 1AU0A 2YJBA 4I07A 2FQ9A 4QRGA 2Y5BA 2YJ2A 4I05A 3KWZA 3MTNA 2FO5A 2DCCA 2G8JA 2BDLA 2FUDA 3BWKA 2BDZA 3QJ3A 2F7DA 1HUCB 3F75A 2DCDA 2R9MA 2NQDB 2HH5A 5CVOB 4YYVA 5EGWA 1CS8A 3KWBX 4DMXA 1NQCA 1NL6A 4CDCB 1ZIVA 2VHSA 2P0RA 4KLBA 3KFQA 4N79A 4N8WA 3QT4A 3KW9A 3PBHA 2DC8A 1AYWA 5EF4A 2YJ8A 2NQAA 3F5VA 5CHTA 4MZOA 3P5VA 1NB3A 2P7UA 4YYRA 2HXZA 3H8CA 3OISA 2GFOA 3AI8A 5F02A 3IOQA 3S3RA 3H89A 3U8EA 3P5WA 1NPZA 3K8UA 4N4ZA 2G8EA 1U9XA 2HHNA 3BCNA 2WBFX 1TU6A 2DJGB 1AU3A 1MHWA 1STFE 1PPNA 4MZSA 3LXSA 2YJ9A 1PIPA 4AXMA 3B79A 3H8BA 2FT2A 4Q8GA 1ITOA 1U9VA 1PPDA 1ME3A 1PPPA 1MEMA 4RY2A 2O6XA 1AYUA 3ZUAA 2FYEA 3USVA 3IHPA 2XU5A 3RVWA 3K9MA 1QDQA 1X9YA 4ZUXU 1QOLA 3KKUA 3LFYA 2FTDA 3O1GA 5CVMA 3I06A 1BP4A 3HHIA 3OVZA 1NLJA 1BGOA 2IBIA 3CH3X 4XR7A 1CB5A 2PBHA 3P5XA 3CH2X 2IPPB 4OEMA 1F2AA 4BQVA 3OF9A 5CHVA 1PPOA 5A24A 3NHEA 3D6SA 4Q8HA 1ZCMA 3PW3A 3HD3A 4BSQA 1EWPA 1KXRA 1SP4B
chains in the Genus database with same CATH superfamily
3OF8A 4FK5A 2AU1A 2NQIA 3OVXA 1VSNA 4RF1A 3K24A 5PADA 2HD5A 2AGAA 3PNRA 5K16A 4CDFB 3QSDA 2DC9A 1AU4A 2ARYA 3H7DA 3N3GA 4DMYA 1BQIA 4PADA 3H6SA 1Q6KA 4OVZA 5JZEA 2ACTA 2DOSA 1SNKA 2OULA 1CQDA 1EWOA 1CV8A 4QRXA 1GCBA 2DC7A 3V6CA 4W5BA 4BS5A 2DZYA 3IEJA 1AU2A 5KO3A 1PADA 4YYSA 2OZ2A 1TLOA 3PHXA 4M0WA 3W31A 2BTWB 4X6HA 5EZSA 1AECA 2G6DA 2P86A 1KFUL 2VHFA 3IUTA 1CTEA 1TL9A 1AIMA 1QMYA 1F29A 3RVXA 2R6NA 2B1NA 2OP3A 2CIOA 1CPJA 3BPFA 1BY8A 2FRAA 1AYVA 3N3KA 4YVAA 1YK7A 2JQFR 3S3QA 3N4CA 4OELA 1CSBB 5CVNB 3RVVA 2AS8A 3PT2A 3I3TA 3KSEA 1PE6A 3PRMA 1IWDA 1VJVA 2PADA 4W5CA 1YK8A 2R9OA 1CVZA 1PXVA 3M99A 1FH0A 2HWKA 2E02A 3BC3A 4D8BA 4BOQA 3TMPA 8PCHA 3BPMA 1ME4A 7PCKA 4QRVA 4RKXA 2BTWA 4PP2E 1EWMA 5EZQA 4QBBA 2DZZA 3KX1A 2G7YA 1Y08A 4I04A 3BY4A 3ZNHA 1YT7A 2H7JA 2AVWA 2R9NA 3B21A 3WXEA 4BPVA 4G54A 4YYQA 2DJFB 3HHAA 2DCBA 1MDWA 2B1MA 2DCAA 2ATOA 1JQPA 3O0UA 3CBKA 3MHHA 4W4UA 4R3DA 4CDDB 4YYUA 4OW0A 4FJCA 4PP1A 1O0EA 2AUXA 1GMYA 2F1GA 4FIPA 1NB5A 2XU3A 2E00A 1F2BA 1DEUA 1THEA 2E01A 4HWYA 4YYWA 3BOWA 2XU4A 4MM3B 4AXLA 4X6JA 1PBHA 4PI3A 5FPWA 3MHSA 3OQCA 4QH6A 4P6EA 1M6DA 1UKFA 2R9FA 4BOUA 1KHPA 4ZTBA 1QXPA 3ERVA 4P6GA 1YZBA 2JQGR 2YJCA 4REZA 4XUIA 3C9EA 1XKGA 1U9WA 3GCBA 3TRKA 4BOPA 2GHUA 1EWLA 1DF0A 3DF0A 2AYOA 1U5IA 3P5UA 3MP2A 1A6RA 2FRQA 3WXFA 3MORA 2XU1A 3PRPA 4K7CA 1PCIA 2AYNA 2PNSA 4IUMA 4P16A 3HWNA 2Y6EA 1YVBA 3E1ZB 1KFXL 4HXDB 4CZWA 1GECE 5J94A 1ICFA 1CJLA 4YV8A 2NQGA 1MEGA 1YALA 3MTVA 4CDEB 4MSXA 3TNXA 1K3BB 3CBJA 4PT5A 9PAPA 2FE8A 6PADA 1MIRA 1POPA 4XZXA 2AIMA 2PREA 2AUZA 1KHQA 4BS6A 3IV2A 5JH3A 1S4VA 5JA7A 1DKIA 2R9CA 1GLOA 1EF7A 3WXGA 1MS6A 3V6EA 2CB5A 1Y4HA 2E03A 3PSEA 4WA6A 2C0YA 4BOZA 4X6IA 1ATKA 2DC6A 1F2CA 3IMAA 1U9QX 3PDFA 1AU0A 2YJBA 4A5UA 3O65A 3PHWA 4I07A 2FQ9A 4QRGA 2Y5BA 2YJ2A 4I05A 3KWZA 3MTNA 2FO5A 2DCCA 2G8JA 2BDLA 2FUDA 3BWKA 2BDZA 3QJ3A 2UZJA 2F7DA 5E6JA 1HUCB 3F75A 2DCDA 2Z84A 2R9MA 3RNVA 2NQDB 2HH5A 5CVOB 4YYVA 5EGWA 1CS8A 3KWBX 4DMXA 1NQCA 1NL6A 4D8IA 4CDCB 1ZIVA 2VHSA 2P0RA 4KLBA 3KFQA 4N79A 4N8WA 3QT4A 3KW9A 3PBHA 2DC8A 1AYWA 5EF4A 2YJ8A 2NQAA 3F5VA 5CHTA 4MZOA 3P5VA 1NB3A 2P7UA 4YYRA 2HXZA 3H8CA 3OISA 2GFOA 3AI8A 5F02A 3IOQA 3S3RA 3H89A 3U8EA 3P5WA 1NPZA 2JRIA 3BB7A 4WURA 3K8UA 4N4ZA 4GUAA 2G8EA 3IFUA 1U9XA 2HHNA 3BCNA 2WBFX 1TU6A 3BBAA 2DJGB 1AU3A 4IP3A 1MHWA 2BU3A 1STFE 1PPNA 3MJ5A 4MZSA 3LXSA 2YJ9A 1PIPA 4AXMA 3B79A 3H8BA 2FT2A 4Q8GA 1ITOA 1U9VA 1PPDA 1ME3A 1PPPA 4MI7A 1MEMA 4BOSA 4RY2A 2O6XA 4D8EA 4RF0A 2J7QC 1AYUA 3ZUAA 2JTCA 2FYEA 3USVA 3IHPA 2XU5A 1PVJA 3RVWA 3K9MA 1QDQA 1X9YA 4ZUXU 1QOLA 3KKUA 3LFYA 2FTDA 3O1GA 5CVMA 3I06A 1BP4A 3HHIA 3PHUA 4OVZB 3OVZA 3W30A 1NLJA 1BGOA 2IBIA 3CH3X 4XR7A 1CB5A 2PBHA 3C0RA 3P5XA 4RNAA 3CH2X 2IPPB 4OEMA 1F2AA 4BQVA 3OF9A 5CHVA 1PPOA 5A24A 3NHEA 3D6SA 4Q8HA 1ZCMA 3PW3A 2J7QA 3HD3A 4BSQA 1EWPA 3E9SA 1KXRA 1SP4B
chains in the Genus database with same CATH topology
3OF8A 4FK5A 2AU1A 2NQIA 3OVXA 1VSNA 3K24A 5PADA 4GUZA 2HD5A 3PNRA 5K16A 4CDFB 3QSDA 2DC9A 1AU4A 2ARYA 3H7DA 3N3GA 4DMYA 1BQIA 4PADA 3H6SA 1Q6KA 4NV7A 2ACTA 1SNKA 2OULA 1CQDA 1EWOA 1CV8A 4QRXA 1GCBA 2DC7A 3V6CA 4W5BA 4BS5A 2DZYA 3IEJA 1AU2A 1PADA 4YYSA 2OZ2A 1TLOA 4X6HA 1AECA 2G6DA 2P86A 1KFUL 2VHFA 3IUTA 1CTEA 1TL9A 1AIMA 1QMYA 1F29A 3RVXA 2R6NA 2B1NA 2OP3A 2CIOA 4C5PA 4B55A 1CPJA 3BPFA 1BY8A 2FRAA 1AYVA 3N3KA 4YVAA 1YK7A 2JQFR 3S3QA 3N4CA 4OELA 1CSBB 5CVNB 3RVVA 2AS8A 3I3TA 3KSEA 1PE6A 1IWDA 1VJVA 2PADA 4W5CA 1YK8A 2R9OA 1CVZA 1PXVA 3M99A 1FH0A 2E02A 3BC3A 8PCHA 3BPMA 1ME4A 7PCKA 4QRVA 4PP2E 1EWMA 4QBBA 2DZZA 3KX1A 2G7YA 1Y08A 4BGFA 4I04A 1YT7A 2H7JA 2AVWA 2R9NA 3WXEA 4BPVA 4G54A 4YYQA 2DJFB 3HHAA 2DCBA 2VFCA 1E2TA 1MDWA 2B1MA 2DCAA 2ATOA 1JQPA 3O0UA 3CBKA 3MHHA 4W4UA 4CDDB 4YYUA 4FJCA 4PP1A 1O0EA 2AUXA 1GMYA 2F1GA 4FIPA 1NB5A 2XU3A 2E00A 1F2BA 1DEUA 1THEA 2E01A 4HWYA 4YYWA 3BOWA 2XU4A 4AXLA 4X6JA 1PBHA 4PI3A 5FPWA 3MHSA 4QH6A 4P6EA 1M6DA 2R9FA 1KHPA 1QXPA 3ERVA 4P6GA 2JQGR 2YJCA 4XUIA 3C9EA 1XKGA 1U9WA 3GCBA 2GHUA 1EWLA 1DF0A 3DF0A 2AYOA 1U5IA 3P5UA 1A6RA 2FRQA 3WXFA 3MORA 2XU1A 4K7CA 1PCIA 2AYNA 2PNSA 3HWNA 2Y6EA 1YVBA 3E1ZB 1KFXL 4CZWA 1GECE 1GX3A 5J94A 1ICFA 1CJLA 4YV8A 2NQGA 1MEGA 1YALA 4CDEB 4MSXA 3TNXA 1K3BB 3CBJA 9PAPA 6PADA 1MIRA 1POPA 2AIMA 2PREA 2AUZA 1KHQA 4BS6A 3IV2A 5JH3A 1S4VA 5JA7A 2R9CA 1GLOA 1EF7A 3WXGA 1MS6A 3V6EA 1W6FA 2CB5A 1Y4HA 2E03A 4WA6A 2C0YA 4X6IA 1ATKA 2DC6A 1F2CA 3IMAA 1U9QX 3PDFA 1AU0A 2YJBA 4I07A 2FQ9A 4QRGA 2Y5BA 2YJ2A 4I05A 3KWZA 3MTNA 2FO5A 2DCCA 2G8JA 2BDLA 2FUDA 3BWKA 2BDZA 3QJ3A 2F7DA 1HUCB 3F75A 2DCDA 1W4TA 2R9MA 2NQDB 2HH5A 5CVOB 4YYVA 5EGWA 1CS8A 3KWBX 4DMXA 1NQCA 1NL6A 4CDCB 1ZIVA 2VHSA 2P0RA 4KLBA 3KFQA 4N79A 2VFBA 4N8WA 3QT4A 3KW9A 3PBHA 2DC8A 1AYWA 5EF4A 2YJ8A 2NQAA 3F5VA 5CHTA 4MZOA 3P5VA 1NB3A 2P7UA 4YYRA 2HXZA 3H8CA 3OISA 2GFOA 3AI8A 5F02A 3IOQA 3S3RA 3H89A 3U8EA 3P5WA 1NPZA 3K8UA 4N4ZA 2G8EA 1U9XA 2HHNA 3BCNA 1W5RA 2WBFX 1TU6A 2DJGB 1AU3A 1MHWA 1STFE 1PPNA 4MZSA 3LXSA 2YJ9A 1PIPA 4AXMA 3B79A 3H8BA 2FT2A 4Q8GA 1ITOA 1U9VA 1PPDA 1ME3A 1PPPA 1MEMA 4RY2A 2O6XA 1AYUA 3ZUAA 2FYEA 3USVA 3IHPA 2XU5A 3RVWA 4NV8A 3K9MA 1QDQA 1X9YA 4ZUXU 1QOLA 3KKUA 3LFYA 2FTDA 3LTWA 3O1GA 5CVMA 2BSZA 3I06A 1BP4A 3HHIA 3OVZA 1NLJA 1BGOA 2IBIA 3CH3X 4XR7A 1CB5A 2PBHA 3P5XA 3CH2X 2IPPB 3D9WA 4OEMA 1F2AA 4BQVA 3OF9A 5CHVA 1PPOA 5A24A 3NHEA 3D6SA 4Q8HA 1ZCMA 3PW3A 3HD3A 4BSQA 1EWPA 1KXRA 1SP4B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OF8 A;  4FK5 A;  2AU1 A;  2NQI A;  3OVX A;  1VSN A;  3K24 A;  5PAD A;  2HD5 A;  3PNR A;  5K16 A;  4CDF B;  3QSD A;  2DC9 A;  1AU4 A;  2ARY A;  3H7D A;  3N3G A;  4DMY A;  1BQI A;  4PAD A;  3H6S A;  1Q6K A;  2ACT A;  1SNK A;  2OUL A;  1CQD A;  1EWO A;  1CV8 A;  4QRX A;  1GCB A;  2DC7 A;  3V6C A;  4W5B A;  4BS5 A;  2DZY A;  3IEJ A;  1AU2 A;  1PAD A;  4YYS A;  2OZ2 A;  1TLO A;  4X6H A;  1AEC A;  2G6D A;  2P86 A;  1KFU L;  2VHF A;  3IUT A;  1CTE A;  1TL9 A;  1AIM A;  1QMY A;  1F29 A;  3RVX A;  2R6N A;  2B1N A;  2OP3 A;  2CIO A;  1CPJ A;  3BPF A;  1BY8 A;  2FRA A;  1AYV A;  3N3K A;  4YVA A;  1YK7 A;  2JQF R;  3S3Q A;  3N4C A;  4OEL A;  1CSB B;  5CVN B;  3RVV A;  2AS8 A;  3I3T A;  3KSE A;  1PE6 A;  1IWD A;  1VJV A;  2PAD A;  4W5C A;  1YK8 A;  2R9O A;  1CVZ A;  1PXV A;  3M99 A;  1FH0 A;  2E02 A;  3BC3 A;  8PCH A;  3BPM A;  1ME4 A;  7PCK A;  4QRV A;  4PP2 E;  1EWM A;  4QBB A;  2DZZ A;  3KX1 A;  2G7Y A;  1Y08 A;  4I04 A;  1YT7 A;  2H7J A;  2AVW A;  2R9N A;  3WXE A;  4BPV A;  4G54 A;  4YYQ A;  2DJF B;  3HHA A;  2DCB A;  1MDW A;  2B1M A;  2DCA A;  2ATO A;  1JQP A;  3O0U A;  3CBK A;  3MHH A;  4W4U A;  4CDD B;  4YYU A;  4FJC A;  4PP1 A;  1O0E A;  2AUX A;  1GMY A;  2F1G A;  4FIP A;  1NB5 A;  2XU3 A;  2E00 A;  1F2B A;  1DEU A;  1THE A;  2E01 A;  4HWY A;  4YYW A;  3BOW A;  2XU4 A;  4AXL A;  4X6J A;  1PBH A;  4PI3 A;  5FPW A;  3MHS A;  4QH6 A;  4P6E A;  1M6D A;  2R9F A;  1KHP A;  1QXP A;  3ERV A;  4P6G A;  2JQG R;  2YJC A;  4XUI A;  3C9E A;  1XKG A;  1U9W A;  3GCB A;  2GHU A;  1EWL A;  1DF0 A;  3DF0 A;  2AYO A;  1U5I A;  3P5U A;  1A6R A;  2FRQ A;  3WXF A;  3MOR A;  2XU1 A;  4K7C A;  1PCI A;  2AYN A;  2PNS A;  3HWN A;  2Y6E A;  1YVB A;  3E1Z B;  1KFX L;  4CZW A;  1GEC E;  5J94 A;  1ICF A;  1CJL A;  4YV8 A;  2NQG A;  1MEG A;  1YAL A;  4CDE B;  4MSX A;  3TNX A;  1K3B B;  3CBJ A;  9PAP A;  6PAD A;  1MIR A;  1POP A;  2AIM A;  2PRE A;  2AUZ A;  1KHQ A;  4BS6 A;  3IV2 A;  5JH3 A;  1S4V A;  5JA7 A;  2R9C A;  1GLO A;  1EF7 A;  3WXG A;  1MS6 A;  3V6E A;  2CB5 A;  1Y4H A;  2E03 A;  4WA6 A;  2C0Y A;  4X6I A;  1ATK A;  2DC6 A;  1F2C A;  3IMA A;  1U9Q X;  3PDF A;  1AU0 A;  2YJB A;  4I07 A;  2FQ9 A;  4QRG A;  2Y5B A;  2YJ2 A;  4I05 A;  3KWZ A;  3MTN A;  2FO5 A;  2DCC A;  2G8J A;  2BDL A;  2FUD A;  3BWK A;  2BDZ A;  3QJ3 A;  2F7D A;  1HUC B;  3F75 A;  2DCD A;  2R9M A;  2NQD B;  2HH5 A;  5CVO B;  4YYV A;  5EGW A;  1CS8 A;  3KWB X;  4DMX A;  1NQC A;  1NL6 A;  4CDC B;  1ZIV A;  2VHS A;  2P0R A;  4KLB A;  3KFQ A;  4N79 A;  4N8W A;  3QT4 A;  3KW9 A;  3PBH A;  2DC8 A;  1AYW A;  5EF4 A;  2YJ8 A;  2NQA A;  3F5V A;  5CHT A;  4MZO A;  3P5V A;  1NB3 A;  2P7U A;  4YYR A;  2HXZ A;  3H8C A;  3OIS A;  2GFO A;  3AI8 A;  5F02 A;  3IOQ A;  3S3R A;  3H89 A;  3U8E A;  3P5W A;  1NPZ A;  3K8U A;  4N4Z A;  2G8E A;  1U9X A;  2HHN A;  3BCN A;  2WBF X;  1TU6 A;  2DJG B;  1AU3 A;  1MHW A;  1STF E;  1PPN A;  4MZS A;  3LXS A;  2YJ9 A;  1PIP A;  4AXM A;  3B79 A;  3H8B A;  2FT2 A;  4Q8G A;  1ITO A;  1U9V A;  1PPD A;  1ME3 A;  1PPP A;  1MEM A;  4RY2 A;  2O6X A;  1AYU A;  3ZUA A;  2FYE A;  3USV A;  3IHP A;  2XU5 A;  3RVW A;  3K9M A;  1QDQ A;  1X9Y A;  4ZUX U;  1QOL A;  3KKU A;  3LFY A;  2FTD A;  3O1G A;  5CVM A;  3I06 A;  1BP4 A;  3HHI A;  3OVZ A;  1NLJ A;  1BGO A;  2IBI A;  3CH3 X;  4XR7 A;  1CB5 A;  2PBH A;  3P5X A;  3CH2 X;  2IPP B;  4OEM A;  1F2A A;  4BQV A;  3OF9 A;  5CHV A;  1PPO A;  5A24 A;  3NHE A;  3D6S A;  4Q8H A;  1ZCM A;  3PW3 A;  3HD3 A;  4BSQ A;  1EWP A;  1KXR A;  1SP4 B; 
#chains in the Genus database with same CATH topology
 3OF8 A;  4FK5 A;  2AU1 A;  2NQI A;  3OVX A;  1VSN A;  4RF1 A;  3K24 A;  5PAD A;  2HD5 A;  2AGA A;  3PNR A;  5K16 A;  4CDF B;  3QSD A;  2DC9 A;  1AU4 A;  2ARY A;  3H7D A;  3N3G A;  4DMY A;  1BQI A;  4PAD A;  3H6S A;  1Q6K A;  4OVZ A;  5JZE A;  2ACT A;  2DOS A;  1SNK A;  2OUL A;  1CQD A;  1EWO A;  1CV8 A;  4QRX A;  1GCB A;  2DC7 A;  3V6C A;  4W5B A;  4BS5 A;  2DZY A;  3IEJ A;  1AU2 A;  5KO3 A;  1PAD A;  4YYS A;  2OZ2 A;  1TLO A;  3PHX A;  4M0W A;  3W31 A;  2BTW B;  4X6H A;  5EZS A;  1AEC A;  2G6D A;  2P86 A;  1KFU L;  2VHF A;  3IUT A;  1CTE A;  1TL9 A;  1AIM A;  1QMY A;  1F29 A;  3RVX A;  2R6N A;  2B1N A;  2OP3 A;  2CIO A;  1CPJ A;  3BPF A;  1BY8 A;  2FRA A;  1AYV A;  3N3K A;  4YVA A;  1YK7 A;  2JQF R;  3S3Q A;  3N4C A;  4OEL A;  1CSB B;  5CVN B;  3RVV A;  2AS8 A;  3PT2 A;  3I3T A;  3KSE A;  1PE6 A;  3PRM A;  1IWD A;  1VJV A;  2PAD A;  4W5C A;  1YK8 A;  2R9O A;  1CVZ A;  1PXV A;  3M99 A;  1FH0 A;  2HWK A;  2E02 A;  3BC3 A;  4D8B A;  4BOQ A;  3TMP A;  8PCH A;  3BPM A;  1ME4 A;  7PCK A;  4QRV A;  4RKX A;  2BTW A;  4PP2 E;  1EWM A;  5EZQ A;  4QBB A;  2DZZ A;  3KX1 A;  2G7Y A;  1Y08 A;  4I04 A;  3BY4 A;  3ZNH A;  1YT7 A;  2H7J A;  2AVW A;  2R9N A;  3B21 A;  3WXE A;  4BPV A;  4G54 A;  4YYQ A;  2DJF B;  3HHA A;  2DCB A;  1MDW A;  2B1M A;  2DCA A;  2ATO A;  1JQP A;  3O0U A;  3CBK A;  3MHH A;  4W4U A;  4R3D A;  4CDD B;  4YYU A;  4OW0 A;  4FJC A;  4PP1 A;  1O0E A;  2AUX A;  1GMY A;  2F1G A;  4FIP A;  1NB5 A;  2XU3 A;  2E00 A;  1F2B A;  1DEU A;  1THE A;  2E01 A;  4HWY A;  4YYW A;  3BOW A;  2XU4 A;  4MM3 B;  4AXL A;  4X6J A;  1PBH A;  4PI3 A;  5FPW A;  3MHS A;  3OQC A;  4QH6 A;  4P6E A;  1M6D A;  1UKF A;  2R9F A;  4BOU A;  1KHP A;  4ZTB A;  1QXP A;  3ERV A;  4P6G A;  1YZB A;  2JQG R;  2YJC A;  4REZ A;  4XUI A;  3C9E A;  1XKG A;  1U9W A;  3GCB A;  3TRK A;  4BOP A;  2GHU A;  1EWL A;  1DF0 A;  3DF0 A;  2AYO A;  1U5I A;  3P5U A;  3MP2 A;  1A6R A;  2FRQ A;  3WXF A;  3MOR A;  2XU1 A;  3PRP A;  4K7C A;  1PCI A;  2AYN A;  2PNS A;  4IUM A;  4P16 A;  3HWN A;  2Y6E A;  1YVB A;  3E1Z B;  1KFX L;  4HXD B;  4CZW A;  1GEC E;  5J94 A;  1ICF A;  1CJL A;  4YV8 A;  2NQG A;  1MEG A;  1YAL A;  3MTV A;  4CDE B;  4MSX A;  3TNX A;  1K3B B;  3CBJ A;  4PT5 A;  9PAP A;  2FE8 A;  6PAD A;  1MIR A;  1POP A;  4XZX A;  2AIM A;  2PRE A;  2AUZ A;  1KHQ A;  4BS6 A;  3IV2 A;  5JH3 A;  1S4V A;  5JA7 A;  1DKI A;  2R9C A;  1GLO A;  1EF7 A;  3WXG A;  1MS6 A;  3V6E A;  2CB5 A;  1Y4H A;  2E03 A;  3PSE A;  4WA6 A;  2C0Y A;  4BOZ A;  4X6I A;  1ATK A;  2DC6 A;  1F2C A;  3IMA A;  1U9Q X;  3PDF A;  1AU0 A;  2YJB A;  4A5U A;  3O65 A;  3PHW A;  4I07 A;  2FQ9 A;  4QRG A;  2Y5B A;  2YJ2 A;  4I05 A;  3KWZ A;  3MTN A;  2FO5 A;  2DCC A;  2G8J A;  2BDL A;  2FUD A;  3BWK A;  2BDZ A;  3QJ3 A;  2UZJ A;  2F7D A;  5E6J A;  1HUC B;  3F75 A;  2DCD A;  2Z84 A;  2R9M A;  3RNV A;  2NQD B;  2HH5 A;  5CVO B;  4YYV A;  5EGW A;  1CS8 A;  3KWB X;  4DMX A;  1NQC A;  1NL6 A;  4D8I A;  4CDC B;  1ZIV A;  2VHS A;  2P0R A;  4KLB A;  3KFQ A;  4N79 A;  4N8W A;  3QT4 A;  3KW9 A;  3PBH A;  2DC8 A;  1AYW A;  5EF4 A;  2YJ8 A;  2NQA A;  3F5V A;  5CHT A;  4MZO A;  3P5V A;  1NB3 A;  2P7U A;  4YYR A;  2HXZ A;  3H8C A;  3OIS A;  2GFO A;  3AI8 A;  5F02 A;  3IOQ A;  3S3R A;  3H89 A;  3U8E A;  3P5W A;  1NPZ A;  2JRI A;  3BB7 A;  4WUR A;  3K8U A;  4N4Z A;  4GUA A;  2G8E A;  3IFU A;  1U9X A;  2HHN A;  3BCN A;  2WBF X;  1TU6 A;  3BBA A;  2DJG B;  1AU3 A;  4IP3 A;  1MHW A;  2BU3 A;  1STF E;  1PPN A;  3MJ5 A;  4MZS A;  3LXS A;  2YJ9 A;  1PIP A;  4AXM A;  3B79 A;  3H8B A;  2FT2 A;  4Q8G A;  1ITO A;  1U9V A;  1PPD A;  1ME3 A;  1PPP A;  4MI7 A;  1MEM A;  4BOS A;  4RY2 A;  2O6X A;  4D8E A;  4RF0 A;  2J7Q C;  1AYU A;  3ZUA A;  2JTC A;  2FYE A;  3USV A;  3IHP A;  2XU5 A;  1PVJ A;  3RVW A;  3K9M A;  1QDQ A;  1X9Y A;  4ZUX U;  1QOL A;  3KKU A;  3LFY A;  2FTD A;  3O1G A;  5CVM A;  3I06 A;  1BP4 A;  3HHI A;  3PHU A;  4OVZ B;  3OVZ A;  3W30 A;  1NLJ A;  1BGO A;  2IBI A;  3CH3 X;  4XR7 A;  1CB5 A;  2PBH A;  3C0R A;  3P5X A;  4RNA A;  3CH2 X;  2IPP B;  4OEM A;  1F2A A;  4BQV A;  3OF9 A;  5CHV A;  1PPO A;  5A24 A;  3NHE A;  3D6S A;  4Q8H A;  1ZCM A;  3PW3 A;  2J7Q A;  3HD3 A;  4BSQ A;  1EWP A;  3E9S A;  1KXR A;  1SP4 B; 
#chains in the Genus database with same CATH homology
 3OF8 A;  4FK5 A;  2AU1 A;  2NQI A;  3OVX A;  1VSN A;  3K24 A;  5PAD A;  4GUZ A;  2HD5 A;  3PNR A;  5K16 A;  4CDF B;  3QSD A;  2DC9 A;  1AU4 A;  2ARY A;  3H7D A;  3N3G A;  4DMY A;  1BQI A;  4PAD A;  3H6S A;  1Q6K A;  4NV7 A;  2ACT A;  1SNK A;  2OUL A;  1CQD A;  1EWO A;  1CV8 A;  4QRX A;  1GCB A;  2DC7 A;  3V6C A;  4W5B A;  4BS5 A;  2DZY A;  3IEJ A;  1AU2 A;  1PAD A;  4YYS A;  2OZ2 A;  1TLO A;  4X6H A;  1AEC A;  2G6D A;  2P86 A;  1KFU L;  2VHF A;  3IUT A;  1CTE A;  1TL9 A;  1AIM A;  1QMY A;  1F29 A;  3RVX A;  2R6N A;  2B1N A;  2OP3 A;  2CIO A;  4C5P A;  4B55 A;  1CPJ A;  3BPF A;  1BY8 A;  2FRA A;  1AYV A;  3N3K A;  4YVA A;  1YK7 A;  2JQF R;  3S3Q A;  3N4C A;  4OEL A;  1CSB B;  5CVN B;  3RVV A;  2AS8 A;  3I3T A;  3KSE A;  1PE6 A;  1IWD A;  1VJV A;  2PAD A;  4W5C A;  1YK8 A;  2R9O A;  1CVZ A;  1PXV A;  3M99 A;  1FH0 A;  2E02 A;  3BC3 A;  8PCH A;  3BPM A;  1ME4 A;  7PCK A;  4QRV A;  4PP2 E;  1EWM A;  4QBB A;  2DZZ A;  3KX1 A;  2G7Y A;  1Y08 A;  4BGF A;  4I04 A;  1YT7 A;  2H7J A;  2AVW A;  2R9N A;  3WXE A;  4BPV A;  4G54 A;  4YYQ A;  2DJF B;  3HHA A;  2DCB A;  2VFC A;  1E2T A;  1MDW A;  2B1M A;  2DCA A;  2ATO A;  1JQP A;  3O0U A;  3CBK A;  3MHH A;  4W4U A;  4CDD B;  4YYU A;  4FJC A;  4PP1 A;  1O0E A;  2AUX A;  1GMY A;  2F1G A;  4FIP A;  1NB5 A;  2XU3 A;  2E00 A;  1F2B A;  1DEU A;  1THE A;  2E01 A;  4HWY A;  4YYW A;  3BOW A;  2XU4 A;  4AXL A;  4X6J A;  1PBH A;  4PI3 A;  5FPW A;  3MHS A;  4QH6 A;  4P6E A;  1M6D A;  2R9F A;  1KHP A;  1QXP A;  3ERV A;  4P6G A;  2JQG R;  2YJC A;  4XUI A;  3C9E A;  1XKG A;  1U9W A;  3GCB A;  2GHU A;  1EWL A;  1DF0 A;  3DF0 A;  2AYO A;  1U5I A;  3P5U A;  1A6R A;  2FRQ A;  3WXF A;  3MOR A;  2XU1 A;  4K7C A;  1PCI A;  2AYN A;  2PNS A;  3HWN A;  2Y6E A;  1YVB A;  3E1Z B;  1KFX L;  4CZW A;  1GEC E;  1GX3 A;  5J94 A;  1ICF A;  1CJL A;  4YV8 A;  2NQG A;  1MEG A;  1YAL A;  4CDE B;  4MSX A;  3TNX A;  1K3B B;  3CBJ A;  9PAP A;  6PAD A;  1MIR A;  1POP A;  2AIM A;  2PRE A;  2AUZ A;  1KHQ A;  4BS6 A;  3IV2 A;  5JH3 A;  1S4V A;  5JA7 A;  2R9C A;  1GLO A;  1EF7 A;  3WXG A;  1MS6 A;  3V6E A;  1W6F A;  2CB5 A;  1Y4H A;  2E03 A;  4WA6 A;  2C0Y A;  4X6I A;  1ATK A;  2DC6 A;  1F2C A;  3IMA A;  1U9Q X;  3PDF A;  1AU0 A;  2YJB A;  4I07 A;  2FQ9 A;  4QRG A;  2Y5B A;  2YJ2 A;  4I05 A;  3KWZ A;  3MTN A;  2FO5 A;  2DCC A;  2G8J A;  2BDL A;  2FUD A;  3BWK A;  2BDZ A;  3QJ3 A;  2F7D A;  1HUC B;  3F75 A;  2DCD A;  1W4T A;  2R9M A;  2NQD B;  2HH5 A;  5CVO B;  4YYV A;  5EGW A;  1CS8 A;  3KWB X;  4DMX A;  1NQC A;  1NL6 A;  4CDC B;  1ZIV A;  2VHS A;  2P0R A;  4KLB A;  3KFQ A;  4N79 A;  2VFB A;  4N8W A;  3QT4 A;  3KW9 A;  3PBH A;  2DC8 A;  1AYW A;  5EF4 A;  2YJ8 A;  2NQA A;  3F5V A;  5CHT A;  4MZO A;  3P5V A;  1NB3 A;  2P7U A;  4YYR A;  2HXZ A;  3H8C A;  3OIS A;  2GFO A;  3AI8 A;  5F02 A;  3IOQ A;  3S3R A;  3H89 A;  3U8E A;  3P5W A;  1NPZ A;  3K8U A;  4N4Z A;  2G8E A;  1U9X A;  2HHN A;  3BCN A;  1W5R A;  2WBF X;  1TU6 A;  2DJG B;  1AU3 A;  1MHW A;  1STF E;  1PPN A;  4MZS A;  3LXS A;  2YJ9 A;  1PIP A;  4AXM A;  3B79 A;  3H8B A;  2FT2 A;  4Q8G A;  1ITO A;  1U9V A;  1PPD A;  1ME3 A;  1PPP A;  1MEM A;  4RY2 A;  2O6X A;  1AYU A;  3ZUA A;  2FYE A;  3USV A;  3IHP A;  2XU5 A;  3RVW A;  4NV8 A;  3K9M A;  1QDQ A;  1X9Y A;  4ZUX U;  1QOL A;  3KKU A;  3LFY A;  2FTD A;  3LTW A;  3O1G A;  5CVM A;  2BSZ A;  3I06 A;  1BP4 A;  3HHI A;  3OVZ A;  1NLJ A;  1BGO A;  2IBI A;  3CH3 X;  4XR7 A;  1CB5 A;  2PBH A;  3P5X A;  3CH2 X;  2IPP B;  3D9W A;  4OEM A;  1F2A A;  4BQV A;  3OF9 A;  5CHV A;  1PPO A;  5A24 A;  3NHE A;  3D6S A;  4Q8H A;  1ZCM A;  3PW3 A;  3HD3 A;  4BSQ A;  1EWP A;  1KXR A;  1SP4 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...