4CDCB

Human dpp1 in complex with (2s)-2-amino-n-((1s)-1-cyano-2-(4- phenylphenyl)ethyl)butanamide
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
162
structure length
162
Chain Sequence
HLPTSWDWRNVHGINFVSPVRNQASCGSCYSFASMGMLEARIRILTNNSQTPILSPQEVVSCSQYAQGCEGGFPYLIAGKYAQDFGLVEEACFPYTGTDSPCKMKEDCFRYYSSEYHYVGGFYGGCNEALMKLELVHHGPMAVAFEVYDDFLHYKKGIYHHT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Cathepsin C Inhibitors: Property Optimization and Identification of a Clinical Candidate.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords DIPEPTIDYL PEPTIDASE 1 EXCLUSION DOMAIN CHAIN
total genus 43
structure length 162
sequence length 162
chains with identical sequence E, H, K
ec nomenclature ec 3.4.14.1: Dipeptidyl-peptidase I.
pdb deposition date 2013-10-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 4cdcB01
3BCNA 3HWNA 3KKUA 3BPMA 1AYUA 1POPA 3HD3A 1IWDA 1KHQA 1KXRA 2R9CA 2R6NA 4CDCB 1QXPA 3AI8A 1NLJA 1CSBB 2ATOA 1QOLA 2Y5BA 1THEA 1TLOA 2YJ9A 2YJ8A 2PNSA 1MHWA 4PP1A 1ZCMA 5F02A 1BP4A 3MHSA 3K8UA 2CIOA 4YYUA 3N3KA 1BQIA 3V6EA 5FPWA 4XUIA 2B1NA 2DCCA 3KWZA 1PPPA 1YK8A 2YJ2A 3QJ3A 4BS5A 4AXLA 4MZOA 3F75A 2ARYA 4AXMA 4MZSA 1M6DA 4YYWA 3P5VA 2H7JA 2FRAA 2AVWA 3I06A 2VHSA 2DC8A 1AIMA 1U9XA 3NHEA 3K24A 1CQDA 2DCBA 1TU6A 4N79A 4ZUXU 2F1GA 1Q6KA 2CB5A 1F2CA 2DZZA 2HHNA 3KFQA 4QH6A 1PXVA 4DMXA 1F2AA 3H89A 3WXFA 1JQPA 4OEMA 4YV8A 3QSDA 2YJBA 3OVZA 2E01A 2PREA 1Y4HA 1STFE 3MTNA 1K3BB 3TNXA 2NQDB 3QT4A 3CH3X 2G8EA 4BQVA 4I07A 4CDEB 3OISA 3S3QA 4X6HA 2ACTA 1AU2A 2AYNA 1CVZA 3PBHA 2G6DA 1GCBA 1KFUL 3U8EA 1PBHA 5CVMA 2B1MA 1PPDA 1SNKA 4XR7A 3KW9A 1U9WA 3H6SA 1CPJA 1AYWA 2BDZA 1EWMA 3BC3A 5A24A 4I05A 8PCHA 4PI3A 3LFYA 4CZWA 1FH0A 1S4VA 2AUXA 3IUTA 3MORA 2XU3A 4P6EA 1KFXL 1U9QX 1VJVA 2NQIA 5CHVA 2FYEA 1BGOA 2PADA 3K9MA 2AYOA 4N4ZA 3P5UA 4I04A 3I3TA 1AU3A 3HHAA 2P0RA 1NQCA 2R9OA 2C0YA 3IHPA 3O0UA 1MDWA 1GLOA 5CVNB 4YVAA 2AUZA 4YYRA 4QBBA 3V6CA 1X9YA 2HH5A 2FT2A 4Q8GA 4FJCA 1EWLA 1PIPA 3USVA 4Q8HA 2JQFR 1PPOA 2AS8A 3E1ZB 1YT7A 4DMYA 7PCKA 1HUCB 1NB5A 2IPPB 1F29A 3RVXA 3ZUAA 3OVXA 1PCIA 3IEJA 4W4UA 3OF9A 3P5WA 3WXEA 2JQGR 2XU4A 1GMYA 2DC6A 3B79A 5EGWA 1CB5A 4RY2A 1ATKA 3BWKA 3M99A 4HWYA 2GHUA 4FK5A 1Y08A 1PPNA 1ME4A 1AU4A 3ERVA 1KHPA 5K16A 2BDLA 2DC7A 2WBFX 1NPZA 4PADA 3P5XA 1MIRA 4P6GA 3IV2A 2OULA 3IMAA 1TL9A 2R9NA 3H8BA 1CV8A 4QRXA 4YYVA 4PP2E 2Y6EA 1NL6A 6PADA 1U5IA 4N8WA 3RVWA 1YK7A 3S3RA 5EF4A 3CH2X 5JA7A 4BPVA 2DJFB 3IOQA 4QRGA 1PADA 2FO5A 4BSQA 2DCAA 1YALA 3RVVA 2HD5A 2DCDA 3LXSA 1ME3A 4W5CA 1EF7A 1QDQA 1PE6A 1DEUA 3PNRA 2E03A 1NB3A 4QRVA 4MSXA 4CDFB 3DF0A 3KSEA 4FIPA 1GECE 2NQGA 1U9VA 1AU0A 3F5VA 4X6JA 4BS6A 2DJGB 2FTDA 2FRQA 3CBJA 2XU1A 2DZYA 2FUDA 2R9FA 2F7DA 2AU1A 2OP3A 3GCBA 4W5BA 2XU5A 2DC9A 3BPFA 2E02A 1MS6A 3H8CA 3PW3A 4CDDB 4X6IA 1ITOA 2P86A 4K7CA 1VSNA 5CVOB 1A6RA 3PDFA 5J94A 3KWBX 2P7UA 1MEGA 1QMYA 1XKGA 5JH3A 1CTEA 3MHHA 1O0EA 1ICFA 1AECA 1CS8A 1EWOA 1BY8A 2R9MA 2AIMA 3HHIA 2FQ9A 1MEMA 2IBIA 3CBKA 2HXZA 5CHTA 3OF8A 3WXGA 2OZ2A 3N4CA 3BOWA 2E00A 2NQAA 3H7DA 1YVBA 2GFOA 2G8JA 1F2BA 2PBHA 4OELA 1EWPA 5PADA 2G7YA 3KX1A 3D6SA 3C9EA 2O6XA 2YJCA 4YYQA 4WA6A 1ZIVA 1CJLA 1SP4B 4G54A 4KLBA 1AYVA 3N3GA 2VHFA 3O1GA 1DF0A 4YYSA 9PAPA
chains in the Genus database with same CATH superfamily
3BCNA 3HWNA 3KKUA 3BPMA 1AYUA 1POPA 3HD3A 1IWDA 1KHQA 3TMPA 1KXRA 2R9CA 2R6NA 3PRMA 2J7QC 4CDCB 1QXPA 3AI8A 1NLJA 1CSBB 2ATOA 1QOLA 2Y5BA 1THEA 1TLOA 2JRIA 2YJ9A 2YJ8A 2PNSA 4OW0A 2Z84A 1MHWA 4PP1A 4REZA 2AGAA 3BB7A 1ZCMA 5F02A 1BP4A 3MHSA 3K8UA 2CIOA 4YYUA 3N3KA 1BQIA 3V6EA 5FPWA 4XUIA 2B1NA 2DCCA 4RNAA 3KWZA 1PPPA 1YK8A 2YJ2A 3QJ3A 4BS5A 4AXLA 4MI7A 4D8EA 4MZOA 3F75A 2ARYA 4AXMA 4MZSA 1M6DA 4YYWA 3P5VA 2H7JA 2FRAA 2AVWA 3I06A 2VHSA 2DC8A 1AIMA 1U9XA 3NHEA 3K24A 2FE8A 1CQDA 2DCBA 1TU6A 4N79A 4ZUXU 4BOZA 2F1GA 1Q6KA 2CB5A 1F2CA 2DZZA 2HHNA 3KFQA 4QH6A 1PXVA 4DMXA 1F2AA 3H89A 3WXFA 3PHWA 1JQPA 4OEMA 4YV8A 3C0RA 3QSDA 2YJBA 3OVZA 2E01A 2PREA 1Y4HA 3W30A 1STFE 3MTNA 1K3BB 3TNXA 2NQDB 3QT4A 4HXDB 3CH3X 2G8EA 4BQVA 4I07A 4CDEB 3OISA 3S3QA 4X6HA 4P16A 2ACTA 1AU2A 2AYNA 1CVZA 3PBHA 4IUMA 4R3DA 2G6DA 1GCBA 1KFUL 3U8EA 1PBHA 5CVMA 2B1MA 1PPDA 3MJ5A 1SNKA 4XR7A 3KW9A 1U9WA 3H6SA 1CPJA 2UZJA 1AYWA 2BDZA 3IFUA 1EWMA 3BC3A 5A24A 4I05A 8PCHA 4PI3A 3LFYA 4CZWA 1FH0A 1S4VA 2AUXA 3IUTA 3MORA 2XU3A 4P6EA 1KFXL 1U9QX 1VJVA 2NQIA 5CHVA 2FYEA 1BGOA 2PADA 3K9MA 4OVZA 2AYOA 4N4ZA 4GUAA 4PT5A 3P5UA 1DKIA 4I04A 3I3TA 1AU3A 4WURA 3HHAA 2P0RA 1NQCA 2R9OA 2C0YA 4BOPA 3IHPA 3O0UA 5EZQA 1MDWA 1GLOA 5CVNB 4YVAA 2AUZA 4YYRA 1X9YA 4QBBA 3V6CA 2HH5A 2FT2A 4Q8GA 4FJCA 1EWLA 2BTWA 1PIPA 1UKFA 4ZTBA 3USVA 4Q8HA 2JQFR 1PPOA 2AS8A 3E1ZB 1YT7A 4DMYA 7PCKA 1HUCB 3PHUA 1PVJA 1NB5A 2IPPB 1F29A 3RVXA 3ZUAA 3OVXA 1PCIA 3W31A 1YZBA 3IEJA 4W4UA 3OF9A 3P5WA 4A5UA 3WXEA 2JQGR 2XU4A 5KO3A 1GMYA 2DC6A 3B79A 5EGWA 4BOQA 1CB5A 3BBAA 4RY2A 4XZXA 1ATKA 4D8BA 3BWKA 3M99A 4HWYA 2GHUA 4FK5A 1Y08A 1PPNA 3OQCA 1ME4A 1AU4A 3ERVA 1KHPA 5K16A 2BDLA 2DC7A 2WBFX 1NPZA 4PADA 3P5XA 1MIRA 4P6GA 3IV2A 2OULA 3IMAA 2JTCA 1TL9A 2R9NA 3H8BA 1CV8A 4QRXA 4YYVA 4PP2E 2BU3A 2Y6EA 1NL6A 6PADA 1U5IA 4N8WA 3PRPA 3RVWA 1YK7A 3S3RA 5EF4A 3CH2X 5JA7A 5EZSA 4BPVA 3MTVA 2DJFB 3IOQA 4QRGA 1PADA 2FO5A 4BSQA 2DCAA 1YALA 3RVVA 3O65A 4D8IA 3PHXA 2HD5A 2DCDA 3PT2A 3LXSA 1ME3A 4BOUA 4W5CA 1EF7A 1QDQA 1PE6A 1DEUA 3PNRA 2E03A 1NB3A 4QRVA 4MSXA 4CDFB 5JZEA 3DF0A 3KSEA 4FIPA 1GECE 3E9SA 2NQGA 1U9VA 3B21A 1AU0A 3F5VA 4X6JA 4BS6A 2DJGB 2FTDA 2DOSA 2FRQA 3CBJA 2XU1A 4RKXA 2DZYA 2FUDA 2R9FA 2F7DA 2AU1A 4M0WA 2OP3A 3BY4A 3GCBA 2J7QA 4W5BA 2BTWB 3ZNHA 2XU5A 2DC9A 3BPFA 4RF1A 2E02A 1MS6A 3H8CA 3PW3A 4CDDB 4X6IA 1ITOA 2P86A 4K7CA 1VSNA 5CVOB 3RNVA 1A6RA 3PDFA 5J94A 3KWBX 2P7UA 1MEGA 1QMYA 1XKGA 5JH3A 1CTEA 3MHHA 1O0EA 1ICFA 4OVZB 5E6JA 1AECA 1CS8A 1EWOA 1BY8A 2R9MA 2AIMA 3HHIA 2FQ9A 1MEMA 2IBIA 3CBKA 2HXZA 2HWKA 5CHTA 3OF8A 4MM3B 3WXGA 4RF0A 2OZ2A 3N4CA 3BOWA 2E00A 2NQAA 3H7DA 1YVBA 3PSEA 2GFOA 3MP2A 4BOSA 3TRKA 2G8JA 1F2BA 2PBHA 4OELA 1EWPA 5PADA 2G7YA 3KX1A 3D6SA 4IP3A 3C9EA 2O6XA 2YJCA 4YYQA 4WA6A 1ZIVA 1CJLA 1SP4B 4G54A 4KLBA 1AYVA 3N3GA 2VHFA 3O1GA 1DF0A 4YYSA 9PAPA
chains in the Genus database with same CATH topology
3BCNA 3HWNA 4BGFA 3KKUA 3BPMA 1AYUA 1POPA 3HD3A 1IWDA 1KHQA 1KXRA 2R9CA 2R6NA 4CDCB 1QXPA 3AI8A 1NLJA 1CSBB 2ATOA 1QOLA 2Y5BA 1THEA 1TLOA 2YJ9A 2YJ8A 2PNSA 1MHWA 3D9WA 4PP1A 1ZCMA 5F02A 1BP4A 3MHSA 3K8UA 2CIOA 4YYUA 3N3KA 1BQIA 3V6EA 5FPWA 4XUIA 2B1NA 2DCCA 3KWZA 1PPPA 1YK8A 2YJ2A 3QJ3A 4BS5A 4AXLA 4MZOA 3F75A 2ARYA 4AXMA 4MZSA 1M6DA 4YYWA 3P5VA 2H7JA 2FRAA 2AVWA 3I06A 2VHSA 2DC8A 1AIMA 1U9XA 3NHEA 3K24A 1CQDA 2DCBA 1TU6A 4N79A 4ZUXU 2F1GA 1Q6KA 2CB5A 1F2CA 2DZZA 2HHNA 3KFQA 4QH6A 1PXVA 4DMXA 1F2AA 3H89A 3WXFA 1JQPA 4OEMA 4YV8A 3QSDA 2YJBA 3OVZA 2E01A 2PREA 1Y4HA 1STFE 3MTNA 1K3BB 3TNXA 1W6FA 2NQDB 3QT4A 3CH3X 2G8EA 4BQVA 4I07A 4CDEB 3OISA 3S3QA 4X6HA 2ACTA 1AU2A 2AYNA 1CVZA 3PBHA 4NV7A 2G6DA 1GCBA 1KFUL 3U8EA 1PBHA 5CVMA 2B1MA 1PPDA 2VFBA 1SNKA 4XR7A 3KW9A 1U9WA 3H6SA 1CPJA 1AYWA 2BDZA 1EWMA 3BC3A 5A24A 4I05A 8PCHA 4PI3A 3LFYA 4CZWA 1FH0A 1S4VA 2AUXA 3IUTA 3MORA 2XU3A 4P6EA 1KFXL 1U9QX 1VJVA 2NQIA 5CHVA 2FYEA 1BGOA 2PADA 3K9MA 2AYOA 4N4ZA 3P5UA 4I04A 3I3TA 1AU3A 3HHAA 2P0RA 1NQCA 2R9OA 2C0YA 3IHPA 3O0UA 1MDWA 1GLOA 5CVNB 4YVAA 2AUZA 4YYRA 4QBBA 1X9YA 3V6CA 2HH5A 2FT2A 4Q8GA 4FJCA 1EWLA 1PIPA 3USVA 4Q8HA 2JQFR 2VFCA 1PPOA 2AS8A 1GX3A 3E1ZB 1YT7A 4DMYA 7PCKA 1HUCB 1NB5A 2IPPB 1F29A 3RVXA 3ZUAA 3OVXA 1PCIA 3IEJA 4W4UA 3OF9A 3P5WA 3WXEA 2JQGR 2XU4A 1GMYA 2DC6A 3B79A 5EGWA 1CB5A 4RY2A 1ATKA 3BWKA 3M99A 4HWYA 2GHUA 4FK5A 1Y08A 1PPNA 1ME4A 1AU4A 3ERVA 1KHPA 5K16A 2BDLA 2DC7A 2WBFX 1NPZA 4PADA 3P5XA 1MIRA 3LTWA 4P6GA 3IV2A 2OULA 3IMAA 1TL9A 2R9NA 3H8BA 1CV8A 4QRXA 4YYVA 4PP2E 1W4TA 2Y6EA 1NL6A 6PADA 1U5IA 4N8WA 3RVWA 4C5PA 1YK7A 3S3RA 5EF4A 3CH2X 5JA7A 4BPVA 2DJFB 3IOQA 4QRGA 1PADA 2FO5A 4BSQA 2DCAA 1YALA 3RVVA 2HD5A 2DCDA 3LXSA 1ME3A 4W5CA 1EF7A 1QDQA 1PE6A 1DEUA 3PNRA 2E03A 1NB3A 2BSZA 4QRVA 4MSXA 4CDFB 3DF0A 3KSEA 4FIPA 1GECE 2NQGA 1U9VA 1AU0A 3F5VA 4X6JA 4BS6A 2DJGB 2FTDA 2FRQA 3CBJA 2XU1A 2DZYA 2FUDA 4NV8A 2R9FA 2F7DA 2AU1A 2OP3A 3GCBA 4W5BA 2XU5A 2DC9A 3BPFA 2E02A 1MS6A 3H8CA 3PW3A 4CDDB 4X6IA 1ITOA 2P86A 4B55A 4K7CA 1VSNA 5CVOB 1A6RA 3PDFA 5J94A 3KWBX 2P7UA 1MEGA 1QMYA 1XKGA 5JH3A 1CTEA 3MHHA 1O0EA 1ICFA 1AECA 1CS8A 1EWOA 1BY8A 2R9MA 2AIMA 3HHIA 2FQ9A 1MEMA 2IBIA 3CBKA 2HXZA 5CHTA 1W5RA 3OF8A 3WXGA 2OZ2A 3N4CA 3BOWA 2E00A 2NQAA 3H7DA 1YVBA 2GFOA 1E2TA 2G8JA 1F2BA 2PBHA 4OELA 1EWPA 5PADA 2G7YA 3KX1A 3D6SA 3C9EA 2O6XA 2YJCA 4YYQA 4WA6A 1ZIVA 1CJLA 1SP4B 4G54A 4KLBA 1AYVA 4GUZA 3N3GA 2VHFA 3O1GA 1DF0A 4YYSA 9PAPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BCN A;  3HWN A;  3KKU A;  3BPM A;  1AYU A;  1POP A;  3HD3 A;  1IWD A;  1KHQ A;  1KXR A;  2R9C A;  2R6N A;  4CDC B;  1QXP A;  3AI8 A;  1NLJ A;  1CSB B;  2ATO A;  1QOL A;  2Y5B A;  1THE A;  1TLO A;  2YJ9 A;  2YJ8 A;  2PNS A;  1MHW A;  4PP1 A;  1ZCM A;  5F02 A;  1BP4 A;  3MHS A;  3K8U A;  2CIO A;  4YYU A;  3N3K A;  1BQI A;  3V6E A;  5FPW A;  4XUI A;  2B1N A;  2DCC A;  3KWZ A;  1PPP A;  1YK8 A;  2YJ2 A;  3QJ3 A;  4BS5 A;  4AXL A;  4MZO A;  3F75 A;  2ARY A;  4AXM A;  4MZS A;  1M6D A;  4YYW A;  3P5V A;  2H7J A;  2FRA A;  2AVW A;  3I06 A;  2VHS A;  2DC8 A;  1AIM A;  1U9X A;  3NHE A;  3K24 A;  1CQD A;  2DCB A;  1TU6 A;  4N79 A;  4ZUX U;  2F1G A;  1Q6K A;  2CB5 A;  1F2C A;  2DZZ A;  2HHN A;  3KFQ A;  4QH6 A;  1PXV A;  4DMX A;  1F2A A;  3H89 A;  3WXF A;  1JQP A;  4OEM A;  4YV8 A;  3QSD A;  2YJB A;  3OVZ A;  2E01 A;  2PRE A;  1Y4H A;  1STF E;  3MTN A;  1K3B B;  3TNX A;  2NQD B;  3QT4 A;  3CH3 X;  2G8E A;  4BQV A;  4I07 A;  4CDE B;  3OIS A;  3S3Q A;  4X6H A;  2ACT A;  1AU2 A;  2AYN A;  1CVZ A;  3PBH A;  2G6D A;  1GCB A;  1KFU L;  3U8E A;  1PBH A;  5CVM A;  2B1M A;  1PPD A;  1SNK A;  4XR7 A;  3KW9 A;  1U9W A;  3H6S A;  1CPJ A;  1AYW A;  2BDZ A;  1EWM A;  3BC3 A;  5A24 A;  4I05 A;  8PCH A;  4PI3 A;  3LFY A;  4CZW A;  1FH0 A;  1S4V A;  2AUX A;  3IUT A;  3MOR A;  2XU3 A;  4P6E A;  1KFX L;  1U9Q X;  1VJV A;  2NQI A;  5CHV A;  2FYE A;  1BGO A;  2PAD A;  3K9M A;  2AYO A;  4N4Z A;  3P5U A;  4I04 A;  3I3T A;  1AU3 A;  3HHA A;  2P0R A;  1NQC A;  2R9O A;  2C0Y A;  3IHP A;  3O0U A;  1MDW A;  1GLO A;  5CVN B;  4YVA A;  2AUZ A;  4YYR A;  4QBB A;  3V6C A;  1X9Y A;  2HH5 A;  2FT2 A;  4Q8G A;  4FJC A;  1EWL A;  1PIP A;  3USV A;  4Q8H A;  2JQF R;  1PPO A;  2AS8 A;  3E1Z B;  1YT7 A;  4DMY A;  7PCK A;  1HUC B;  1NB5 A;  2IPP B;  1F29 A;  3RVX A;  3ZUA A;  3OVX A;  1PCI A;  3IEJ A;  4W4U A;  3OF9 A;  3P5W A;  3WXE A;  2JQG R;  2XU4 A;  1GMY A;  2DC6 A;  3B79 A;  5EGW A;  1CB5 A;  4RY2 A;  1ATK A;  3BWK A;  3M99 A;  4HWY A;  2GHU A;  4FK5 A;  1Y08 A;  1PPN A;  1ME4 A;  1AU4 A;  3ERV A;  1KHP A;  5K16 A;  2BDL A;  2DC7 A;  2WBF X;  1NPZ A;  4PAD A;  3P5X A;  1MIR A;  4P6G A;  3IV2 A;  2OUL A;  3IMA A;  1TL9 A;  2R9N A;  3H8B A;  1CV8 A;  4QRX A;  4YYV A;  4PP2 E;  2Y6E A;  1NL6 A;  6PAD A;  1U5I A;  4N8W A;  3RVW A;  1YK7 A;  3S3R A;  5EF4 A;  3CH2 X;  5JA7 A;  4BPV A;  2DJF B;  3IOQ A;  4QRG A;  1PAD A;  2FO5 A;  4BSQ A;  2DCA A;  1YAL A;  3RVV A;  2HD5 A;  2DCD A;  3LXS A;  1ME3 A;  4W5C A;  1EF7 A;  1QDQ A;  1PE6 A;  1DEU A;  3PNR A;  2E03 A;  1NB3 A;  4QRV A;  4MSX A;  4CDF B;  3DF0 A;  3KSE A;  4FIP A;  1GEC E;  2NQG A;  1U9V A;  1AU0 A;  3F5V A;  4X6J A;  4BS6 A;  2DJG B;  2FTD A;  2FRQ A;  3CBJ A;  2XU1 A;  2DZY A;  2FUD A;  2R9F A;  2F7D A;  2AU1 A;  2OP3 A;  3GCB A;  4W5B A;  2XU5 A;  2DC9 A;  3BPF A;  2E02 A;  1MS6 A;  3H8C A;  3PW3 A;  4CDD B;  4X6I A;  1ITO A;  2P86 A;  4K7C A;  1VSN A;  5CVO B;  1A6R A;  3PDF A;  5J94 A;  3KWB X;  2P7U A;  1MEG A;  1QMY A;  1XKG A;  5JH3 A;  1CTE A;  3MHH A;  1O0E A;  1ICF A;  1AEC A;  1CS8 A;  1EWO A;  1BY8 A;  2R9M A;  2AIM A;  3HHI A;  2FQ9 A;  1MEM A;  2IBI A;  3CBK A;  2HXZ A;  5CHT A;  3OF8 A;  3WXG A;  2OZ2 A;  3N4C A;  3BOW A;  2E00 A;  2NQA A;  3H7D A;  1YVB A;  2GFO A;  2G8J A;  1F2B A;  2PBH A;  4OEL A;  1EWP A;  5PAD A;  2G7Y A;  3KX1 A;  3D6S A;  3C9E A;  2O6X A;  2YJC A;  4YYQ A;  4WA6 A;  1ZIV A;  1CJL A;  1SP4 B;  4G54 A;  4KLB A;  1AYV A;  3N3G A;  2VHF A;  3O1G A;  1DF0 A;  4YYS A;  9PAP A; 
#chains in the Genus database with same CATH topology
 3BCN A;  3HWN A;  3KKU A;  3BPM A;  1AYU A;  1POP A;  3HD3 A;  1IWD A;  1KHQ A;  3TMP A;  1KXR A;  2R9C A;  2R6N A;  3PRM A;  2J7Q C;  4CDC B;  1QXP A;  3AI8 A;  1NLJ A;  1CSB B;  2ATO A;  1QOL A;  2Y5B A;  1THE A;  1TLO A;  2JRI A;  2YJ9 A;  2YJ8 A;  2PNS A;  4OW0 A;  2Z84 A;  1MHW A;  4PP1 A;  4REZ A;  2AGA A;  3BB7 A;  1ZCM A;  5F02 A;  1BP4 A;  3MHS A;  3K8U A;  2CIO A;  4YYU A;  3N3K A;  1BQI A;  3V6E A;  5FPW A;  4XUI A;  2B1N A;  2DCC A;  4RNA A;  3KWZ A;  1PPP A;  1YK8 A;  2YJ2 A;  3QJ3 A;  4BS5 A;  4AXL A;  4MI7 A;  4D8E A;  4MZO A;  3F75 A;  2ARY A;  4AXM A;  4MZS A;  1M6D A;  4YYW A;  3P5V A;  2H7J A;  2FRA A;  2AVW A;  3I06 A;  2VHS A;  2DC8 A;  1AIM A;  1U9X A;  3NHE A;  3K24 A;  2FE8 A;  1CQD A;  2DCB A;  1TU6 A;  4N79 A;  4ZUX U;  4BOZ A;  2F1G A;  1Q6K A;  2CB5 A;  1F2C A;  2DZZ A;  2HHN A;  3KFQ A;  4QH6 A;  1PXV A;  4DMX A;  1F2A A;  3H89 A;  3WXF A;  3PHW A;  1JQP A;  4OEM A;  4YV8 A;  3C0R A;  3QSD A;  2YJB A;  3OVZ A;  2E01 A;  2PRE A;  1Y4H A;  3W30 A;  1STF E;  3MTN A;  1K3B B;  3TNX A;  2NQD B;  3QT4 A;  4HXD B;  3CH3 X;  2G8E A;  4BQV A;  4I07 A;  4CDE B;  3OIS A;  3S3Q A;  4X6H A;  4P16 A;  2ACT A;  1AU2 A;  2AYN A;  1CVZ A;  3PBH A;  4IUM A;  4R3D A;  2G6D A;  1GCB A;  1KFU L;  3U8E A;  1PBH A;  5CVM A;  2B1M A;  1PPD A;  3MJ5 A;  1SNK A;  4XR7 A;  3KW9 A;  1U9W A;  3H6S A;  1CPJ A;  2UZJ A;  1AYW A;  2BDZ A;  3IFU A;  1EWM A;  3BC3 A;  5A24 A;  4I05 A;  8PCH A;  4PI3 A;  3LFY A;  4CZW A;  1FH0 A;  1S4V A;  2AUX A;  3IUT A;  3MOR A;  2XU3 A;  4P6E A;  1KFX L;  1U9Q X;  1VJV A;  2NQI A;  5CHV A;  2FYE A;  1BGO A;  2PAD A;  3K9M A;  4OVZ A;  2AYO A;  4N4Z A;  4GUA A;  4PT5 A;  3P5U A;  1DKI A;  4I04 A;  3I3T A;  1AU3 A;  4WUR A;  3HHA A;  2P0R A;  1NQC A;  2R9O A;  2C0Y A;  4BOP A;  3IHP A;  3O0U A;  5EZQ A;  1MDW A;  1GLO A;  5CVN B;  4YVA A;  2AUZ A;  4YYR A;  1X9Y A;  4QBB A;  3V6C A;  2HH5 A;  2FT2 A;  4Q8G A;  4FJC A;  1EWL A;  2BTW A;  1PIP A;  1UKF A;  4ZTB A;  3USV A;  4Q8H A;  2JQF R;  1PPO A;  2AS8 A;  3E1Z B;  1YT7 A;  4DMY A;  7PCK A;  1HUC B;  3PHU A;  1PVJ A;  1NB5 A;  2IPP B;  1F29 A;  3RVX A;  3ZUA A;  3OVX A;  1PCI A;  3W31 A;  1YZB A;  3IEJ A;  4W4U A;  3OF9 A;  3P5W A;  4A5U A;  3WXE A;  2JQG R;  2XU4 A;  5KO3 A;  1GMY A;  2DC6 A;  3B79 A;  5EGW A;  4BOQ A;  1CB5 A;  3BBA A;  4RY2 A;  4XZX A;  1ATK A;  4D8B A;  3BWK A;  3M99 A;  4HWY A;  2GHU A;  4FK5 A;  1Y08 A;  1PPN A;  3OQC A;  1ME4 A;  1AU4 A;  3ERV A;  1KHP A;  5K16 A;  2BDL A;  2DC7 A;  2WBF X;  1NPZ A;  4PAD A;  3P5X A;  1MIR A;  4P6G A;  3IV2 A;  2OUL A;  3IMA A;  2JTC A;  1TL9 A;  2R9N A;  3H8B A;  1CV8 A;  4QRX A;  4YYV A;  4PP2 E;  2BU3 A;  2Y6E A;  1NL6 A;  6PAD A;  1U5I A;  4N8W A;  3PRP A;  3RVW A;  1YK7 A;  3S3R A;  5EF4 A;  3CH2 X;  5JA7 A;  5EZS A;  4BPV A;  3MTV A;  2DJF B;  3IOQ A;  4QRG A;  1PAD A;  2FO5 A;  4BSQ A;  2DCA A;  1YAL A;  3RVV A;  3O65 A;  4D8I A;  3PHX A;  2HD5 A;  2DCD A;  3PT2 A;  3LXS A;  1ME3 A;  4BOU A;  4W5C A;  1EF7 A;  1QDQ A;  1PE6 A;  1DEU A;  3PNR A;  2E03 A;  1NB3 A;  4QRV A;  4MSX A;  4CDF B;  5JZE A;  3DF0 A;  3KSE A;  4FIP A;  1GEC E;  3E9S A;  2NQG A;  1U9V A;  3B21 A;  1AU0 A;  3F5V A;  4X6J A;  4BS6 A;  2DJG B;  2FTD A;  2DOS A;  2FRQ A;  3CBJ A;  2XU1 A;  4RKX A;  2DZY A;  2FUD A;  2R9F A;  2F7D A;  2AU1 A;  4M0W A;  2OP3 A;  3BY4 A;  3GCB A;  2J7Q A;  4W5B A;  2BTW B;  3ZNH A;  2XU5 A;  2DC9 A;  3BPF A;  4RF1 A;  2E02 A;  1MS6 A;  3H8C A;  3PW3 A;  4CDD B;  4X6I A;  1ITO A;  2P86 A;  4K7C A;  1VSN A;  5CVO B;  3RNV A;  1A6R A;  3PDF A;  5J94 A;  3KWB X;  2P7U A;  1MEG A;  1QMY A;  1XKG A;  5JH3 A;  1CTE A;  3MHH A;  1O0E A;  1ICF A;  4OVZ B;  5E6J A;  1AEC A;  1CS8 A;  1EWO A;  1BY8 A;  2R9M A;  2AIM A;  3HHI A;  2FQ9 A;  1MEM A;  2IBI A;  3CBK A;  2HXZ A;  2HWK A;  5CHT A;  3OF8 A;  4MM3 B;  3WXG A;  4RF0 A;  2OZ2 A;  3N4C A;  3BOW A;  2E00 A;  2NQA A;  3H7D A;  1YVB A;  3PSE A;  2GFO A;  3MP2 A;  4BOS A;  3TRK A;  2G8J A;  1F2B A;  2PBH A;  4OEL A;  1EWP A;  5PAD A;  2G7Y A;  3KX1 A;  3D6S A;  4IP3 A;  3C9E A;  2O6X A;  2YJC A;  4YYQ A;  4WA6 A;  1ZIV A;  1CJL A;  1SP4 B;  4G54 A;  4KLB A;  1AYV A;  3N3G A;  2VHF A;  3O1G A;  1DF0 A;  4YYS A;  9PAP A; 
#chains in the Genus database with same CATH homology
 3BCN A;  3HWN A;  4BGF A;  3KKU A;  3BPM A;  1AYU A;  1POP A;  3HD3 A;  1IWD A;  1KHQ A;  1KXR A;  2R9C A;  2R6N A;  4CDC B;  1QXP A;  3AI8 A;  1NLJ A;  1CSB B;  2ATO A;  1QOL A;  2Y5B A;  1THE A;  1TLO A;  2YJ9 A;  2YJ8 A;  2PNS A;  1MHW A;  3D9W A;  4PP1 A;  1ZCM A;  5F02 A;  1BP4 A;  3MHS A;  3K8U A;  2CIO A;  4YYU A;  3N3K A;  1BQI A;  3V6E A;  5FPW A;  4XUI A;  2B1N A;  2DCC A;  3KWZ A;  1PPP A;  1YK8 A;  2YJ2 A;  3QJ3 A;  4BS5 A;  4AXL A;  4MZO A;  3F75 A;  2ARY A;  4AXM A;  4MZS A;  1M6D A;  4YYW A;  3P5V A;  2H7J A;  2FRA A;  2AVW A;  3I06 A;  2VHS A;  2DC8 A;  1AIM A;  1U9X A;  3NHE A;  3K24 A;  1CQD A;  2DCB A;  1TU6 A;  4N79 A;  4ZUX U;  2F1G A;  1Q6K A;  2CB5 A;  1F2C A;  2DZZ A;  2HHN A;  3KFQ A;  4QH6 A;  1PXV A;  4DMX A;  1F2A A;  3H89 A;  3WXF A;  1JQP A;  4OEM A;  4YV8 A;  3QSD A;  2YJB A;  3OVZ A;  2E01 A;  2PRE A;  1Y4H A;  1STF E;  3MTN A;  1K3B B;  3TNX A;  1W6F A;  2NQD B;  3QT4 A;  3CH3 X;  2G8E A;  4BQV A;  4I07 A;  4CDE B;  3OIS A;  3S3Q A;  4X6H A;  2ACT A;  1AU2 A;  2AYN A;  1CVZ A;  3PBH A;  4NV7 A;  2G6D A;  1GCB A;  1KFU L;  3U8E A;  1PBH A;  5CVM A;  2B1M A;  1PPD A;  2VFB A;  1SNK A;  4XR7 A;  3KW9 A;  1U9W A;  3H6S A;  1CPJ A;  1AYW A;  2BDZ A;  1EWM A;  3BC3 A;  5A24 A;  4I05 A;  8PCH A;  4PI3 A;  3LFY A;  4CZW A;  1FH0 A;  1S4V A;  2AUX A;  3IUT A;  3MOR A;  2XU3 A;  4P6E A;  1KFX L;  1U9Q X;  1VJV A;  2NQI A;  5CHV A;  2FYE A;  1BGO A;  2PAD A;  3K9M A;  2AYO A;  4N4Z A;  3P5U A;  4I04 A;  3I3T A;  1AU3 A;  3HHA A;  2P0R A;  1NQC A;  2R9O A;  2C0Y A;  3IHP A;  3O0U A;  1MDW A;  1GLO A;  5CVN B;  4YVA A;  2AUZ A;  4YYR A;  4QBB A;  1X9Y A;  3V6C A;  2HH5 A;  2FT2 A;  4Q8G A;  4FJC A;  1EWL A;  1PIP A;  3USV A;  4Q8H A;  2JQF R;  2VFC A;  1PPO A;  2AS8 A;  1GX3 A;  3E1Z B;  1YT7 A;  4DMY A;  7PCK A;  1HUC B;  1NB5 A;  2IPP B;  1F29 A;  3RVX A;  3ZUA A;  3OVX A;  1PCI A;  3IEJ A;  4W4U A;  3OF9 A;  3P5W A;  3WXE A;  2JQG R;  2XU4 A;  1GMY A;  2DC6 A;  3B79 A;  5EGW A;  1CB5 A;  4RY2 A;  1ATK A;  3BWK A;  3M99 A;  4HWY A;  2GHU A;  4FK5 A;  1Y08 A;  1PPN A;  1ME4 A;  1AU4 A;  3ERV A;  1KHP A;  5K16 A;  2BDL A;  2DC7 A;  2WBF X;  1NPZ A;  4PAD A;  3P5X A;  1MIR A;  3LTW A;  4P6G A;  3IV2 A;  2OUL A;  3IMA A;  1TL9 A;  2R9N A;  3H8B A;  1CV8 A;  4QRX A;  4YYV A;  4PP2 E;  1W4T A;  2Y6E A;  1NL6 A;  6PAD A;  1U5I A;  4N8W A;  3RVW A;  4C5P A;  1YK7 A;  3S3R A;  5EF4 A;  3CH2 X;  5JA7 A;  4BPV A;  2DJF B;  3IOQ A;  4QRG A;  1PAD A;  2FO5 A;  4BSQ A;  2DCA A;  1YAL A;  3RVV A;  2HD5 A;  2DCD A;  3LXS A;  1ME3 A;  4W5C A;  1EF7 A;  1QDQ A;  1PE6 A;  1DEU A;  3PNR A;  2E03 A;  1NB3 A;  2BSZ A;  4QRV A;  4MSX A;  4CDF B;  3DF0 A;  3KSE A;  4FIP A;  1GEC E;  2NQG A;  1U9V A;  1AU0 A;  3F5V A;  4X6J A;  4BS6 A;  2DJG B;  2FTD A;  2FRQ A;  3CBJ A;  2XU1 A;  2DZY A;  2FUD A;  4NV8 A;  2R9F A;  2F7D A;  2AU1 A;  2OP3 A;  3GCB A;  4W5B A;  2XU5 A;  2DC9 A;  3BPF A;  2E02 A;  1MS6 A;  3H8C A;  3PW3 A;  4CDD B;  4X6I A;  1ITO A;  2P86 A;  4B55 A;  4K7C A;  1VSN A;  5CVO B;  1A6R A;  3PDF A;  5J94 A;  3KWB X;  2P7U A;  1MEG A;  1QMY A;  1XKG A;  5JH3 A;  1CTE A;  3MHH A;  1O0E A;  1ICF A;  1AEC A;  1CS8 A;  1EWO A;  1BY8 A;  2R9M A;  2AIM A;  3HHI A;  2FQ9 A;  1MEM A;  2IBI A;  3CBK A;  2HXZ A;  5CHT A;  1W5R A;  3OF8 A;  3WXG A;  2OZ2 A;  3N4C A;  3BOW A;  2E00 A;  2NQA A;  3H7D A;  1YVB A;  2GFO A;  1E2T A;  2G8J A;  1F2B A;  2PBH A;  4OEL A;  1EWP A;  5PAD A;  2G7Y A;  3KX1 A;  3D6S A;  3C9E A;  2O6X A;  2YJC A;  4YYQ A;  4WA6 A;  1ZIV A;  1CJL A;  1SP4 B;  4G54 A;  4KLB A;  1AYV A;  4GUZ A;  3N3G A;  2VHF A;  3O1G A;  1DF0 A;  4YYS A;  9PAP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...