2HXZA

Crystal structure of cathepsin s in complex with a nonpeptidic inhibitor (hexagonal spacegroup)
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
217
structure length
217
Chain Sequence
LPDSVDWREKGCVTEVKYQGSCGACWAFSAVGALEAQLKLKTGKLVSLSAQNLVDCSTEKYGNKGCNGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYDSKYRAATCSKYTELPYGREDVLKEAVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSWGHNFGEEGYIRMARNKGNHCGIASFPSYPEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Cathepsin S
publication title Identification of selective, nonpeptidic nitrile inhibitors of cathepsin s using the substrate activity screening method.
pubmed doi rcsb
source organism Homo sapiens
total genus 73
structure length 217
sequence length 217
chains with identical sequence B, C
ec nomenclature ec 3.4.22.27: Cathepsin S.
pdb deposition date 2006-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2hxzA00
1BY8A 2IBIA 4CDCB 3KKUA 3P5UA 2R9FA 3S3RA 1BP4A 2E01A 5FPWA 5J94A 2G8EA 1M6DA 1YALA 2VHSA 3P5WA 1KXRA 2FRAA 3H6SA 5K16A 2DC8A 4YVAA 1F2CA 1YK7A 8PCHA 3KSEA 3KWZA 2DCCA 1PXVA 2YJBA 2PBHA 5CHVA 4PI3A 1QDQA 1NL6A 3LFYA 2FUDA 3H8BA 1AYUA 2DCBA 4FJCA 1Y4HA 3HHAA 2DJFB 3H8CA 1FH0A 1GECE 1GCBA 4CDDB 5JA7A 1EWPA 1IWDA 1QMYA 1PADA 2C0YA 2B1NA 2YJ8A 1AU4A 2Y5BA 3USVA 4YYRA 3OF8A 2PREA 4QBBA 4X6JA 3I06A 2DC7A 1MDWA 2R9MA 3RVWA 2P7UA 1CV8A 3S3QA 1QOLA 1ATKA 2FRQA 3NHEA 2ATOA 2AYOA 3AI8A 2AUZA 4G54A 3KW9A 3LXSA 3CH3X 1KHPA 4DMXA 3MTNA 4BS5A 4CDFB 1MIRA 3OISA 2FYEA 4YV8A 2H7JA 4DMYA 1EWLA 1KHQA 2PADA 2P86A 1SNKA 5CVMA 3IV2A 1EWMA 2DZYA 3K9MA 3MHHA 3TNXA 4MSXA 2DC9A 1SP4B 2XU5A 1YT7A 3B79A 3PDFA 4P6EA 2JQGR 2BDZA 1MEGA 1Q6KA 1NPZA 4N8WA 4MZSA 3D6SA 2R6NA 1U9QX 3V6EA 2HD5A 2AS8A 4AXMA 1YVBA 2FQ9A 1X9YA 4X6HA 2YJCA 3IMAA 4OEMA 2G6DA 4YYUA 1TL9A 2P0RA 4BS6A 3HD3A 3QT4A 1POPA 1AYVA 3IUTA 3OF9A 3WXEA 2XU3A 2HXZA 4X6IA 4BSQA 1JQPA 2OULA 3O1GA 1CS8A 3MHSA 3ZUAA 3BPFA 5A24A 2NQGA 1O0EA 2AUXA 1KFUL 5PADA 4YYSA 4I05A 1NQCA 1AIMA 1A6RA 4WA6A 3WXGA 3N4CA 1F2AA 1HUCB 1TLOA 1PPNA 3BPMA 5CHTA 1AU2A 2G8JA 3H7DA 4PP2E 1K3BB 2Y6EA 2XU1A 3HWNA 1GMYA 3C9EA 2CB5A 5CVOB 2DC6A 4MZOA 2AYNA 3HHIA 1F2BA 1BQIA 1GLOA 3P5VA 1PPPA 1CJLA 3F75A 1PCIA 2AIMA 4QH6A 2CIOA 3QSDA 2PNSA 3N3KA 2WBFX 1PE6A 4FIPA 2F7DA 3QJ3A 4BPVA 2GHUA 4BQVA 1YK8A 1U5IA 1AECA 3IHPA 4YYVA 1VSNA 1AYWA 1PPDA 2DJGB 3I3TA 4PP1A 4N79A 3CBJA 2BDLA 4CDEB 3PBHA 4FK5A 4W5BA 3V6CA 3H89A 4W5CA 4XR7A 3BOWA 2E03A 4K7CA 1KFXL 2JQFR 1EWOA 1AU3A 2ARYA 2VHFA 3GCBA 2IPPB 3CBKA 5EGWA 1NB3A 5F02A 1MHWA 1CVZA 3P5XA 4RY2A 3BC3A 1MS6A 1U9XA 1XKGA 1VJVA 3WXFA 1CSBB 4QRVA 2YJ9A 2DCDA 1CPJA 1NB5A 9PAPA 2E02A 1ZIVA 5JH3A 1ITOA 3N3GA 3RVVA 1ME3A 2G7YA 2YJ2A 2OP3A 1U9WA 1ICFA 1PBHA 1CB5A 1PIPA 4YYWA 2B1MA 4I07A 3PW3A 2E00A 2R9OA 3BCNA 3DF0A 1CQDA 3OVXA 3E1ZB 4QRXA 2NQIA 1TU6A 1MEMA 4CZWA 4KLBA 4Q8HA 2XU4A 3KX1A 4PADA 1DEUA 4XUIA 2HHNA 1BGOA 2AU1A 1S4VA 7PCKA 3PNRA 2NQDB 4I04A 2GFOA 2FT2A 1EF7A 3O0UA 2DCAA 5EF4A 2F1GA 3K24A 3MORA 2OZ2A 3BWKA 4P6GA 1PPOA 4N4ZA 3RVXA 1U9VA 2HH5A 1CTEA 1STFE 3ERVA 4YYQA 4Q8GA 2O6XA 1ME4A 2R9NA 3CH2X 3OVZA 4OELA 4W4UA 4QRGA 5CVNB 1AU0A 3F5VA 2NQAA 1DF0A 2FO5A 4AXLA 1THEA 6PADA 4ZUXU 2AVWA 3IEJA 4HWYA 3IOQA 2FTDA 3U8EA 1NLJA 2R9CA 3K8UA 3M99A 2DZZA 2ACTA 3KFQA 1QXPA 1ZCMA 1F29A 1Y08A 3KWBX
chains in the Genus database with same CATH superfamily
1BY8A 2UZJA 2IBIA 4CDCB 3OQCA 3KKUA 3P5UA 2R9FA 3S3RA 1BP4A 2E01A 5FPWA 5J94A 2G8EA 2FE8A 1M6DA 1YALA 4HXDB 4MM3B 2VHSA 3P5WA 1KXRA 2FRAA 3H6SA 5K16A 2DC8A 4YVAA 1F2CA 3PRPA 1YK7A 8PCHA 3KSEA 3KWZA 2DCCA 4RF0A 1PXVA 2YJBA 2PBHA 5CHVA 4PI3A 1QDQA 1NL6A 3LFYA 2FUDA 3H8BA 1AYUA 4GUAA 3PRMA 4OW0A 2DCBA 4FJCA 3O65A 1Y4HA 3HHAA 4BOZA 4R3DA 2DJFB 3H8CA 1FH0A 1GECE 1GCBA 4CDDB 2HWKA 5JA7A 1EWPA 5KO3A 1IWDA 1QMYA 2J7QC 1PADA 2C0YA 2B1NA 3PT2A 2YJ8A 1AU4A 2Y5BA 3USVA 4YYRA 3OF8A 2PREA 4QBBA 4RNAA 4X6JA 3I06A 4OVZB 2DC7A 1MDWA 2R9MA 3RVWA 2P7UA 1CV8A 3S3QA 1QOLA 4P16A 1ATKA 2FRQA 3NHEA 2ATOA 4XZXA 2AYOA 3AI8A 2AUZA 5JZEA 4G54A 3KW9A 3LXSA 3CH3X 1KHPA 4DMXA 3MTNA 4BS5A 4CDFB 1MIRA 3PHXA 3OISA 2FYEA 4YV8A 2H7JA 4DMYA 1EWLA 1KHQA 2PADA 2P86A 2BTWA 4REZA 1SNKA 5CVMA 3IV2A 4BOPA 1EWMA 2DZYA 3K9MA 3MHHA 3TNXA 4MSXA 2DC9A 1SP4B 2XU5A 1YT7A 3B79A 3PHWA 3PDFA 4P6EA 2JQGR 4D8IA 2BDZA 1MEGA 1Q6KA 3BY4A 1NPZA 4N8WA 4MZSA 3D6SA 2R6NA 1U9QX 3V6EA 2HD5A 3IFUA 2AS8A 4AXMA 1YVBA 2FQ9A 1X9YA 4X6HA 2YJCA 3IMAA 4OEMA 2G6DA 4YYUA 4BOUA 5EZSA 1TL9A 2P0RA 4BS6A 3HD3A 3QT4A 1POPA 3TRKA 4BOSA 1AYVA 3IUTA 3OF9A 2DOSA 3WXEA 2XU3A 2HXZA 4X6IA 4BSQA 1JQPA 2OULA 3O1GA 4D8BA 1CS8A 3MHSA 3ZUAA 3BPFA 3MJ5A 3PSEA 5A24A 3BB7A 2NQGA 1O0EA 2AUXA 1KFUL 5PADA 4YYSA 4I05A 1NQCA 4PT5A 1AIMA 1A6RA 4WA6A 3WXGA 3N4CA 1F2AA 1HUCB 1TLOA 1PPNA 3BPMA 5CHTA 1AU2A 2G8JA 3H7DA 4PP2E 1K3BB 2Y6EA 2XU1A 3HWNA 1GMYA 3C9EA 2CB5A 5CVOB 2DC6A 4MZOA 3PHUA 2AYNA 3HHIA 1F2BA 1BQIA 1GLOA 3B21A 4A5UA 3P5VA 1PPPA 1CJLA 1YZBA 3F75A 1PCIA 2AIMA 4ZTBA 4RKXA 4QH6A 2CIOA 3QSDA 4MI7A 2PNSA 3N3KA 2WBFX 1PE6A 4FIPA 3C0RA 2F7DA 3QJ3A 4BPVA 2GHUA 1PVJA 4BQVA 1YK8A 2BTWB 1U5IA 1AECA 3IHPA 4YYVA 1VSNA 1AYWA 1PPDA 2DJGB 3I3TA 4PP1A 4N79A 3CBJA 3ZNHA 3MTVA 2BDLA 4CDEB 2AGAA 3PBHA 2Z84A 4FK5A 4W5BA 3V6CA 3H89A 4W5CA 4XR7A 3BOWA 2E03A 4K7CA 1KFXL 2JQFR 1EWOA 1AU3A 2ARYA 2VHFA 3E9SA 3GCBA 2IPPB 3CBKA 5EGWA 1NB3A 5F02A 1MHWA 1CVZA 2BU3A 3P5XA 4RY2A 3BBAA 3BC3A 1MS6A 1U9XA 1XKGA 1VJVA 3WXFA 1UKFA 1CSBB 4QRVA 1DKIA 2YJ9A 2DCDA 1CPJA 1NB5A 9PAPA 2E02A 1ZIVA 5JH3A 1ITOA 3N3GA 2J7QA 3RVVA 3RNVA 1ME3A 2G7YA 2YJ2A 3TMPA 2OP3A 3W31A 1U9WA 4D8EA 1ICFA 1PBHA 1CB5A 1PIPA 4YYWA 2B1MA 4I07A 3PW3A 4WURA 2E00A 2R9OA 2JRIA 3BCNA 3DF0A 1CQDA 3OVXA 3E1ZB 4QRXA 2NQIA 1TU6A 1MEMA 4CZWA 4KLBA 4Q8HA 2XU4A 3W30A 3KX1A 4PADA 1DEUA 4XUIA 2HHNA 4M0WA 5E6JA 4OVZA 1BGOA 2AU1A 1S4VA 7PCKA 4RF1A 3PNRA 2NQDB 4I04A 2GFOA 2FT2A 1EF7A 4BOQA 3O0UA 2DCAA 5EF4A 3MP2A 2F1GA 3K24A 3MORA 2OZ2A 3BWKA 4P6GA 1PPOA 4N4ZA 3RVXA 1U9VA 4IUMA 2HH5A 1CTEA 1STFE 3ERVA 4YYQA 4Q8GA 2O6XA 1ME4A 2R9NA 3CH2X 3OVZA 4OELA 4W4UA 4QRGA 5CVNB 1AU0A 4IP3A 3F5VA 5EZQA 2NQAA 1DF0A 2FO5A 4AXLA 1THEA 6PADA 2JTCA 4ZUXU 2AVWA 3IEJA 4HWYA 3IOQA 2FTDA 3U8EA 1NLJA 2R9CA 3K8UA 3M99A 2DZZA 2ACTA 3KFQA 1QXPA 1ZCMA 1F29A 1Y08A 3KWBX
chains in the Genus database with same CATH topology
1BY8A 2IBIA 2BSZA 4CDCB 3KKUA 3P5UA 2R9FA 3S3RA 1BP4A 2E01A 5FPWA 5J94A 2G8EA 1M6DA 1YALA 2VHSA 3P5WA 1KXRA 2FRAA 3H6SA 5K16A 2DC8A 4YVAA 1F2CA 1YK7A 8PCHA 3KSEA 3KWZA 2DCCA 1PXVA 2YJBA 2PBHA 5CHVA 4PI3A 1QDQA 1NL6A 3LFYA 2FUDA 3LTWA 3H8BA 1AYUA 2DCBA 4FJCA 1Y4HA 2VFCA 3HHAA 2DJFB 3H8CA 1FH0A 1GECE 1GCBA 4CDDB 5JA7A 1EWPA 1IWDA 1QMYA 1PADA 2C0YA 2B1NA 2YJ8A 1AU4A 2Y5BA 3USVA 4YYRA 3OF8A 2PREA 4QBBA 4X6JA 4C5PA 4B55A 3I06A 2DC7A 4GUZA 1MDWA 2R9MA 3RVWA 2P7UA 1CV8A 3S3QA 1QOLA 1ATKA 2FRQA 3NHEA 2ATOA 2AYOA 3AI8A 2AUZA 4G54A 3KW9A 3LXSA 3CH3X 1KHPA 4DMXA 3MTNA 4BS5A 4CDFB 1MIRA 3OISA 2FYEA 4YV8A 2H7JA 4DMYA 1EWLA 1KHQA 2PADA 2P86A 1SNKA 5CVMA 3IV2A 1EWMA 2DZYA 3K9MA 4NV8A 3MHHA 3TNXA 4MSXA 2DC9A 1SP4B 2XU5A 1YT7A 3B79A 3PDFA 4P6EA 2JQGR 2BDZA 1MEGA 1Q6KA 2VFBA 1NPZA 4N8WA 4MZSA 3D6SA 2R6NA 1U9QX 3V6EA 2HD5A 2AS8A 4AXMA 1YVBA 2FQ9A 1X9YA 4X6HA 2YJCA 3IMAA 4OEMA 2G6DA 4YYUA 1TL9A 2P0RA 4BS6A 3HD3A 3QT4A 1POPA 1AYVA 1W4TA 3IUTA 3OF9A 3WXEA 2XU3A 2HXZA 4X6IA 4BSQA 1JQPA 2OULA 3O1GA 1CS8A 3MHSA 3ZUAA 3BPFA 5A24A 2NQGA 1O0EA 2AUXA 1KFUL 5PADA 4YYSA 4I05A 1NQCA 1AIMA 1A6RA 4WA6A 3WXGA 3N4CA 1F2AA 1HUCB 1TLOA 1PPNA 3BPMA 5CHTA 1AU2A 2G8JA 3H7DA 4PP2E 1K3BB 2Y6EA 2XU1A 3HWNA 1GMYA 3C9EA 1GX3A 2CB5A 5CVOB 2DC6A 4MZOA 2AYNA 3HHIA 1F2BA 1BQIA 1GLOA 3P5VA 1PPPA 1CJLA 3F75A 1PCIA 2AIMA 4QH6A 2CIOA 3QSDA 1E2TA 2PNSA 3N3KA 2WBFX 1PE6A 4FIPA 2F7DA 3QJ3A 4BPVA 2GHUA 4BQVA 1YK8A 1U5IA 1AECA 3IHPA 4YYVA 1VSNA 1AYWA 1PPDA 2DJGB 3I3TA 4PP1A 4N79A 3CBJA 4NV7A 2BDLA 4CDEB 3PBHA 4FK5A 4W5BA 3V6CA 3H89A 4W5CA 4XR7A 3BOWA 2E03A 4K7CA 1KFXL 2JQFR 1EWOA 1AU3A 2ARYA 2VHFA 3GCBA 2IPPB 3CBKA 5EGWA 1NB3A 5F02A 1MHWA 1CVZA 3P5XA 4RY2A 3BC3A 1MS6A 1U9XA 1XKGA 1VJVA 3WXFA 1CSBB 4QRVA 2YJ9A 2DCDA 1CPJA 1NB5A 9PAPA 2E02A 1ZIVA 5JH3A 1ITOA 3N3GA 3RVVA 1ME3A 2G7YA 2YJ2A 2OP3A 1U9WA 1ICFA 1PBHA 1CB5A 1PIPA 4YYWA 2B1MA 4I07A 3PW3A 2E00A 2R9OA 3BCNA 3DF0A 1CQDA 3OVXA 3E1ZB 4QRXA 2NQIA 1TU6A 1MEMA 4CZWA 4KLBA 4Q8HA 1W5RA 2XU4A 3KX1A 4PADA 1DEUA 4XUIA 2HHNA 1BGOA 2AU1A 1S4VA 7PCKA 3PNRA 2NQDB 4I04A 2GFOA 2FT2A 1EF7A 3O0UA 2DCAA 5EF4A 2F1GA 3K24A 3MORA 2OZ2A 3BWKA 4P6GA 1PPOA 4N4ZA 3RVXA 1U9VA 2HH5A 1CTEA 1STFE 3ERVA 4YYQA 4Q8GA 2O6XA 1ME4A 2R9NA 3CH2X 3OVZA 4OELA 4W4UA 4QRGA 5CVNB 1AU0A 3F5VA 2NQAA 1DF0A 2FO5A 4AXLA 1THEA 6PADA 4ZUXU 2AVWA 3D9WA 3IEJA 4HWYA 3IOQA 2FTDA 3U8EA 1NLJA 2R9CA 3K8UA 3M99A 2DZZA 2ACTA 3KFQA 1QXPA 1W6FA 1ZCMA 1F29A 1Y08A 4BGFA 3KWBX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BY8 A;  2IBI A;  4CDC B;  3KKU A;  3P5U A;  2R9F A;  3S3R A;  1BP4 A;  2E01 A;  5FPW A;  5J94 A;  2G8E A;  1M6D A;  1YAL A;  2VHS A;  3P5W A;  1KXR A;  2FRA A;  3H6S A;  5K16 A;  2DC8 A;  4YVA A;  1F2C A;  1YK7 A;  8PCH A;  3KSE A;  3KWZ A;  2DCC A;  1PXV A;  2YJB A;  2PBH A;  5CHV A;  4PI3 A;  1QDQ A;  1NL6 A;  3LFY A;  2FUD A;  3H8B A;  1AYU A;  2DCB A;  4FJC A;  1Y4H A;  3HHA A;  2DJF B;  3H8C A;  1FH0 A;  1GEC E;  1GCB A;  4CDD B;  5JA7 A;  1EWP A;  1IWD A;  1QMY A;  1PAD A;  2C0Y A;  2B1N A;  2YJ8 A;  1AU4 A;  2Y5B A;  3USV A;  4YYR A;  3OF8 A;  2PRE A;  4QBB A;  4X6J A;  3I06 A;  2DC7 A;  1MDW A;  2R9M A;  3RVW A;  2P7U A;  1CV8 A;  3S3Q A;  1QOL A;  1ATK A;  2FRQ A;  3NHE A;  2ATO A;  2AYO A;  3AI8 A;  2AUZ A;  4G54 A;  3KW9 A;  3LXS A;  3CH3 X;  1KHP A;  4DMX A;  3MTN A;  4BS5 A;  4CDF B;  1MIR A;  3OIS A;  2FYE A;  4YV8 A;  2H7J A;  4DMY A;  1EWL A;  1KHQ A;  2PAD A;  2P86 A;  1SNK A;  5CVM A;  3IV2 A;  1EWM A;  2DZY A;  3K9M A;  3MHH A;  3TNX A;  4MSX A;  2DC9 A;  1SP4 B;  2XU5 A;  1YT7 A;  3B79 A;  3PDF A;  4P6E A;  2JQG R;  2BDZ A;  1MEG A;  1Q6K A;  1NPZ A;  4N8W A;  4MZS A;  3D6S A;  2R6N A;  1U9Q X;  3V6E A;  2HD5 A;  2AS8 A;  4AXM A;  1YVB A;  2FQ9 A;  1X9Y A;  4X6H A;  2YJC A;  3IMA A;  4OEM A;  2G6D A;  4YYU A;  1TL9 A;  2P0R A;  4BS6 A;  3HD3 A;  3QT4 A;  1POP A;  1AYV A;  3IUT A;  3OF9 A;  3WXE A;  2XU3 A;  2HXZ A;  4X6I A;  4BSQ A;  1JQP A;  2OUL A;  3O1G A;  1CS8 A;  3MHS A;  3ZUA A;  3BPF A;  5A24 A;  2NQG A;  1O0E A;  2AUX A;  1KFU L;  5PAD A;  4YYS A;  4I05 A;  1NQC A;  1AIM A;  1A6R A;  4WA6 A;  3WXG A;  3N4C A;  1F2A A;  1HUC B;  1TLO A;  1PPN A;  3BPM A;  5CHT A;  1AU2 A;  2G8J A;  3H7D A;  4PP2 E;  1K3B B;  2Y6E A;  2XU1 A;  3HWN A;  1GMY A;  3C9E A;  2CB5 A;  5CVO B;  2DC6 A;  4MZO A;  2AYN A;  3HHI A;  1F2B A;  1BQI A;  1GLO A;  3P5V A;  1PPP A;  1CJL A;  3F75 A;  1PCI A;  2AIM A;  4QH6 A;  2CIO A;  3QSD A;  2PNS A;  3N3K A;  2WBF X;  1PE6 A;  4FIP A;  2F7D A;  3QJ3 A;  4BPV A;  2GHU A;  4BQV A;  1YK8 A;  1U5I A;  1AEC A;  3IHP A;  4YYV A;  1VSN A;  1AYW A;  1PPD A;  2DJG B;  3I3T A;  4PP1 A;  4N79 A;  3CBJ A;  2BDL A;  4CDE B;  3PBH A;  4FK5 A;  4W5B A;  3V6C A;  3H89 A;  4W5C A;  4XR7 A;  3BOW A;  2E03 A;  4K7C A;  1KFX L;  2JQF R;  1EWO A;  1AU3 A;  2ARY A;  2VHF A;  3GCB A;  2IPP B;  3CBK A;  5EGW A;  1NB3 A;  5F02 A;  1MHW A;  1CVZ A;  3P5X A;  4RY2 A;  3BC3 A;  1MS6 A;  1U9X A;  1XKG A;  1VJV A;  3WXF A;  1CSB B;  4QRV A;  2YJ9 A;  2DCD A;  1CPJ A;  1NB5 A;  9PAP A;  2E02 A;  1ZIV A;  5JH3 A;  1ITO A;  3N3G A;  3RVV A;  1ME3 A;  2G7Y A;  2YJ2 A;  2OP3 A;  1U9W A;  1ICF A;  1PBH A;  1CB5 A;  1PIP A;  4YYW A;  2B1M A;  4I07 A;  3PW3 A;  2E00 A;  2R9O A;  3BCN A;  3DF0 A;  1CQD A;  3OVX A;  3E1Z B;  4QRX A;  2NQI A;  1TU6 A;  1MEM A;  4CZW A;  4KLB A;  4Q8H A;  2XU4 A;  3KX1 A;  4PAD A;  1DEU A;  4XUI A;  2HHN A;  1BGO A;  2AU1 A;  1S4V A;  7PCK A;  3PNR A;  2NQD B;  4I04 A;  2GFO A;  2FT2 A;  1EF7 A;  3O0U A;  2DCA A;  5EF4 A;  2F1G A;  3K24 A;  3MOR A;  2OZ2 A;  3BWK A;  4P6G A;  1PPO A;  4N4Z A;  3RVX A;  1U9V A;  2HH5 A;  1CTE A;  1STF E;  3ERV A;  4YYQ A;  4Q8G A;  2O6X A;  1ME4 A;  2R9N A;  3CH2 X;  3OVZ A;  4OEL A;  4W4U A;  4QRG A;  5CVN B;  1AU0 A;  3F5V A;  2NQA A;  1DF0 A;  2FO5 A;  4AXL A;  1THE A;  6PAD A;  4ZUX U;  2AVW A;  3IEJ A;  4HWY A;  3IOQ A;  2FTD A;  3U8E A;  1NLJ A;  2R9C A;  3K8U A;  3M99 A;  2DZZ A;  2ACT A;  3KFQ A;  1QXP A;  1ZCM A;  1F29 A;  1Y08 A;  3KWB X; 
#chains in the Genus database with same CATH topology
 1BY8 A;  2UZJ A;  2IBI A;  4CDC B;  3OQC A;  3KKU A;  3P5U A;  2R9F A;  3S3R A;  1BP4 A;  2E01 A;  5FPW A;  5J94 A;  2G8E A;  2FE8 A;  1M6D A;  1YAL A;  4HXD B;  4MM3 B;  2VHS A;  3P5W A;  1KXR A;  2FRA A;  3H6S A;  5K16 A;  2DC8 A;  4YVA A;  1F2C A;  3PRP A;  1YK7 A;  8PCH A;  3KSE A;  3KWZ A;  2DCC A;  4RF0 A;  1PXV A;  2YJB A;  2PBH A;  5CHV A;  4PI3 A;  1QDQ A;  1NL6 A;  3LFY A;  2FUD A;  3H8B A;  1AYU A;  4GUA A;  3PRM A;  4OW0 A;  2DCB A;  4FJC A;  3O65 A;  1Y4H A;  3HHA A;  4BOZ A;  4R3D A;  2DJF B;  3H8C A;  1FH0 A;  1GEC E;  1GCB A;  4CDD B;  2HWK A;  5JA7 A;  1EWP A;  5KO3 A;  1IWD A;  1QMY A;  2J7Q C;  1PAD A;  2C0Y A;  2B1N A;  3PT2 A;  2YJ8 A;  1AU4 A;  2Y5B A;  3USV A;  4YYR A;  3OF8 A;  2PRE A;  4QBB A;  4RNA A;  4X6J A;  3I06 A;  4OVZ B;  2DC7 A;  1MDW A;  2R9M A;  3RVW A;  2P7U A;  1CV8 A;  3S3Q A;  1QOL A;  4P16 A;  1ATK A;  2FRQ A;  3NHE A;  2ATO A;  4XZX A;  2AYO A;  3AI8 A;  2AUZ A;  5JZE A;  4G54 A;  3KW9 A;  3LXS A;  3CH3 X;  1KHP A;  4DMX A;  3MTN A;  4BS5 A;  4CDF B;  1MIR A;  3PHX A;  3OIS A;  2FYE A;  4YV8 A;  2H7J A;  4DMY A;  1EWL A;  1KHQ A;  2PAD A;  2P86 A;  2BTW A;  4REZ A;  1SNK A;  5CVM A;  3IV2 A;  4BOP A;  1EWM A;  2DZY A;  3K9M A;  3MHH A;  3TNX A;  4MSX A;  2DC9 A;  1SP4 B;  2XU5 A;  1YT7 A;  3B79 A;  3PHW A;  3PDF A;  4P6E A;  2JQG R;  4D8I A;  2BDZ A;  1MEG A;  1Q6K A;  3BY4 A;  1NPZ A;  4N8W A;  4MZS A;  3D6S A;  2R6N A;  1U9Q X;  3V6E A;  2HD5 A;  3IFU A;  2AS8 A;  4AXM A;  1YVB A;  2FQ9 A;  1X9Y A;  4X6H A;  2YJC A;  3IMA A;  4OEM A;  2G6D A;  4YYU A;  4BOU A;  5EZS A;  1TL9 A;  2P0R A;  4BS6 A;  3HD3 A;  3QT4 A;  1POP A;  3TRK A;  4BOS A;  1AYV A;  3IUT A;  3OF9 A;  2DOS A;  3WXE A;  2XU3 A;  2HXZ A;  4X6I A;  4BSQ A;  1JQP A;  2OUL A;  3O1G A;  4D8B A;  1CS8 A;  3MHS A;  3ZUA A;  3BPF A;  3MJ5 A;  3PSE A;  5A24 A;  3BB7 A;  2NQG A;  1O0E A;  2AUX A;  1KFU L;  5PAD A;  4YYS A;  4I05 A;  1NQC A;  4PT5 A;  1AIM A;  1A6R A;  4WA6 A;  3WXG A;  3N4C A;  1F2A A;  1HUC B;  1TLO A;  1PPN A;  3BPM A;  5CHT A;  1AU2 A;  2G8J A;  3H7D A;  4PP2 E;  1K3B B;  2Y6E A;  2XU1 A;  3HWN A;  1GMY A;  3C9E A;  2CB5 A;  5CVO B;  2DC6 A;  4MZO A;  3PHU A;  2AYN A;  3HHI A;  1F2B A;  1BQI A;  1GLO A;  3B21 A;  4A5U A;  3P5V A;  1PPP A;  1CJL A;  1YZB A;  3F75 A;  1PCI A;  2AIM A;  4ZTB A;  4RKX A;  4QH6 A;  2CIO A;  3QSD A;  4MI7 A;  2PNS A;  3N3K A;  2WBF X;  1PE6 A;  4FIP A;  3C0R A;  2F7D A;  3QJ3 A;  4BPV A;  2GHU A;  1PVJ A;  4BQV A;  1YK8 A;  2BTW B;  1U5I A;  1AEC A;  3IHP A;  4YYV A;  1VSN A;  1AYW A;  1PPD A;  2DJG B;  3I3T A;  4PP1 A;  4N79 A;  3CBJ A;  3ZNH A;  3MTV A;  2BDL A;  4CDE B;  2AGA A;  3PBH A;  2Z84 A;  4FK5 A;  4W5B A;  3V6C A;  3H89 A;  4W5C A;  4XR7 A;  3BOW A;  2E03 A;  4K7C A;  1KFX L;  2JQF R;  1EWO A;  1AU3 A;  2ARY A;  2VHF A;  3E9S A;  3GCB A;  2IPP B;  3CBK A;  5EGW A;  1NB3 A;  5F02 A;  1MHW A;  1CVZ A;  2BU3 A;  3P5X A;  4RY2 A;  3BBA A;  3BC3 A;  1MS6 A;  1U9X A;  1XKG A;  1VJV A;  3WXF A;  1UKF A;  1CSB B;  4QRV A;  1DKI A;  2YJ9 A;  2DCD A;  1CPJ A;  1NB5 A;  9PAP A;  2E02 A;  1ZIV A;  5JH3 A;  1ITO A;  3N3G A;  2J7Q A;  3RVV A;  3RNV A;  1ME3 A;  2G7Y A;  2YJ2 A;  3TMP A;  2OP3 A;  3W31 A;  1U9W A;  4D8E A;  1ICF A;  1PBH A;  1CB5 A;  1PIP A;  4YYW A;  2B1M A;  4I07 A;  3PW3 A;  4WUR A;  2E00 A;  2R9O A;  2JRI A;  3BCN A;  3DF0 A;  1CQD A;  3OVX A;  3E1Z B;  4QRX A;  2NQI A;  1TU6 A;  1MEM A;  4CZW A;  4KLB A;  4Q8H A;  2XU4 A;  3W30 A;  3KX1 A;  4PAD A;  1DEU A;  4XUI A;  2HHN A;  4M0W A;  5E6J A;  4OVZ A;  1BGO A;  2AU1 A;  1S4V A;  7PCK A;  4RF1 A;  3PNR A;  2NQD B;  4I04 A;  2GFO A;  2FT2 A;  1EF7 A;  4BOQ A;  3O0U A;  2DCA A;  5EF4 A;  3MP2 A;  2F1G A;  3K24 A;  3MOR A;  2OZ2 A;  3BWK A;  4P6G A;  1PPO A;  4N4Z A;  3RVX A;  1U9V A;  4IUM A;  2HH5 A;  1CTE A;  1STF E;  3ERV A;  4YYQ A;  4Q8G A;  2O6X A;  1ME4 A;  2R9N A;  3CH2 X;  3OVZ A;  4OEL A;  4W4U A;  4QRG A;  5CVN B;  1AU0 A;  4IP3 A;  3F5V A;  5EZQ A;  2NQA A;  1DF0 A;  2FO5 A;  4AXL A;  1THE A;  6PAD A;  2JTC A;  4ZUX U;  2AVW A;  3IEJ A;  4HWY A;  3IOQ A;  2FTD A;  3U8E A;  1NLJ A;  2R9C A;  3K8U A;  3M99 A;  2DZZ A;  2ACT A;  3KFQ A;  1QXP A;  1ZCM A;  1F29 A;  1Y08 A;  3KWB X; 
#chains in the Genus database with same CATH homology
 1BY8 A;  2IBI A;  2BSZ A;  4CDC B;  3KKU A;  3P5U A;  2R9F A;  3S3R A;  1BP4 A;  2E01 A;  5FPW A;  5J94 A;  2G8E A;  1M6D A;  1YAL A;  2VHS A;  3P5W A;  1KXR A;  2FRA A;  3H6S A;  5K16 A;  2DC8 A;  4YVA A;  1F2C A;  1YK7 A;  8PCH A;  3KSE A;  3KWZ A;  2DCC A;  1PXV A;  2YJB A;  2PBH A;  5CHV A;  4PI3 A;  1QDQ A;  1NL6 A;  3LFY A;  2FUD A;  3LTW A;  3H8B A;  1AYU A;  2DCB A;  4FJC A;  1Y4H A;  2VFC A;  3HHA A;  2DJF B;  3H8C A;  1FH0 A;  1GEC E;  1GCB A;  4CDD B;  5JA7 A;  1EWP A;  1IWD A;  1QMY A;  1PAD A;  2C0Y A;  2B1N A;  2YJ8 A;  1AU4 A;  2Y5B A;  3USV A;  4YYR A;  3OF8 A;  2PRE A;  4QBB A;  4X6J A;  4C5P A;  4B55 A;  3I06 A;  2DC7 A;  4GUZ A;  1MDW A;  2R9M A;  3RVW A;  2P7U A;  1CV8 A;  3S3Q A;  1QOL A;  1ATK A;  2FRQ A;  3NHE A;  2ATO A;  2AYO A;  3AI8 A;  2AUZ A;  4G54 A;  3KW9 A;  3LXS A;  3CH3 X;  1KHP A;  4DMX A;  3MTN A;  4BS5 A;  4CDF B;  1MIR A;  3OIS A;  2FYE A;  4YV8 A;  2H7J A;  4DMY A;  1EWL A;  1KHQ A;  2PAD A;  2P86 A;  1SNK A;  5CVM A;  3IV2 A;  1EWM A;  2DZY A;  3K9M A;  4NV8 A;  3MHH A;  3TNX A;  4MSX A;  2DC9 A;  1SP4 B;  2XU5 A;  1YT7 A;  3B79 A;  3PDF A;  4P6E A;  2JQG R;  2BDZ A;  1MEG A;  1Q6K A;  2VFB A;  1NPZ A;  4N8W A;  4MZS A;  3D6S A;  2R6N A;  1U9Q X;  3V6E A;  2HD5 A;  2AS8 A;  4AXM A;  1YVB A;  2FQ9 A;  1X9Y A;  4X6H A;  2YJC A;  3IMA A;  4OEM A;  2G6D A;  4YYU A;  1TL9 A;  2P0R A;  4BS6 A;  3HD3 A;  3QT4 A;  1POP A;  1AYV A;  1W4T A;  3IUT A;  3OF9 A;  3WXE A;  2XU3 A;  2HXZ A;  4X6I A;  4BSQ A;  1JQP A;  2OUL A;  3O1G A;  1CS8 A;  3MHS A;  3ZUA A;  3BPF A;  5A24 A;  2NQG A;  1O0E A;  2AUX A;  1KFU L;  5PAD A;  4YYS A;  4I05 A;  1NQC A;  1AIM A;  1A6R A;  4WA6 A;  3WXG A;  3N4C A;  1F2A A;  1HUC B;  1TLO A;  1PPN A;  3BPM A;  5CHT A;  1AU2 A;  2G8J A;  3H7D A;  4PP2 E;  1K3B B;  2Y6E A;  2XU1 A;  3HWN A;  1GMY A;  3C9E A;  1GX3 A;  2CB5 A;  5CVO B;  2DC6 A;  4MZO A;  2AYN A;  3HHI A;  1F2B A;  1BQI A;  1GLO A;  3P5V A;  1PPP A;  1CJL A;  3F75 A;  1PCI A;  2AIM A;  4QH6 A;  2CIO A;  3QSD A;  1E2T A;  2PNS A;  3N3K A;  2WBF X;  1PE6 A;  4FIP A;  2F7D A;  3QJ3 A;  4BPV A;  2GHU A;  4BQV A;  1YK8 A;  1U5I A;  1AEC A;  3IHP A;  4YYV A;  1VSN A;  1AYW A;  1PPD A;  2DJG B;  3I3T A;  4PP1 A;  4N79 A;  3CBJ A;  4NV7 A;  2BDL A;  4CDE B;  3PBH A;  4FK5 A;  4W5B A;  3V6C A;  3H89 A;  4W5C A;  4XR7 A;  3BOW A;  2E03 A;  4K7C A;  1KFX L;  2JQF R;  1EWO A;  1AU3 A;  2ARY A;  2VHF A;  3GCB A;  2IPP B;  3CBK A;  5EGW A;  1NB3 A;  5F02 A;  1MHW A;  1CVZ A;  3P5X A;  4RY2 A;  3BC3 A;  1MS6 A;  1U9X A;  1XKG A;  1VJV A;  3WXF A;  1CSB B;  4QRV A;  2YJ9 A;  2DCD A;  1CPJ A;  1NB5 A;  9PAP A;  2E02 A;  1ZIV A;  5JH3 A;  1ITO A;  3N3G A;  3RVV A;  1ME3 A;  2G7Y A;  2YJ2 A;  2OP3 A;  1U9W A;  1ICF A;  1PBH A;  1CB5 A;  1PIP A;  4YYW A;  2B1M A;  4I07 A;  3PW3 A;  2E00 A;  2R9O A;  3BCN A;  3DF0 A;  1CQD A;  3OVX A;  3E1Z B;  4QRX A;  2NQI A;  1TU6 A;  1MEM A;  4CZW A;  4KLB A;  4Q8H A;  1W5R A;  2XU4 A;  3KX1 A;  4PAD A;  1DEU A;  4XUI A;  2HHN A;  1BGO A;  2AU1 A;  1S4V A;  7PCK A;  3PNR A;  2NQD B;  4I04 A;  2GFO A;  2FT2 A;  1EF7 A;  3O0U A;  2DCA A;  5EF4 A;  2F1G A;  3K24 A;  3MOR A;  2OZ2 A;  3BWK A;  4P6G A;  1PPO A;  4N4Z A;  3RVX A;  1U9V A;  2HH5 A;  1CTE A;  1STF E;  3ERV A;  4YYQ A;  4Q8G A;  2O6X A;  1ME4 A;  2R9N A;  3CH2 X;  3OVZ A;  4OEL A;  4W4U A;  4QRG A;  5CVN B;  1AU0 A;  3F5V A;  2NQA A;  1DF0 A;  2FO5 A;  4AXL A;  1THE A;  6PAD A;  4ZUX U;  2AVW A;  3D9W A;  3IEJ A;  4HWY A;  3IOQ A;  2FTD A;  3U8E A;  1NLJ A;  2R9C A;  3K8U A;  3M99 A;  2DZZ A;  2ACT A;  3KFQ A;  1QXP A;  1W6F A;  1ZCM A;  1F29 A;  1Y08 A;  4BGF A;  3KWB X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...