2PBHA

Crystal structure of human procathepsin b at 3.3 angstrom resolution
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
317
structure length
317
Chain Sequence
MRSRPSFHPLSDELVNYVNKRNTTWQAGHNFYNVDMSYLKRLCGTFLGGPKPPQRVMFTEDLKLPASFDAREQWPQCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHTNAHVSVEVSAEDLLTCCGSMCGDGCNGGYPAEAWNFWTRKGLVSGGLYESHVGCRPYSIPPCEHHVNGSRPPCTGEGDTPKCSKICEPGYSPTYKQDKHYGYNSYSVSNSEKDIMAEIYKNGPVEGAFSVYSDFLLYKSGVYQHVTGEMMGGHAIRILGWGVENGTPYWLVANSWNTDWGDNGFFKILRGQDHCGIESEVVAGIPRTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Thiol protease
molecule keywords PROCATHEPSIN B
publication title Crystal structures of human procathepsin B at 3.2 and 3.3 Angstroms resolution reveal an interaction motif between a papain-like cysteine protease and its propeptide.
pubmed doi rcsb
source organism Homo sapiens
total genus 61
structure length 317
sequence length 317
ec nomenclature ec 3.4.22.1: Cathepsin B.
pdb deposition date 1997-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
A PF08127 Propeptide_C1 Peptidase family C1 propeptide
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2pbhA00
8PCHA 3P5UA 2OZ2A 2R9FA 5CVOB 3KSEA 1XKGA 3OISA 3P5XA 2AU1A 4ZUXU 3K8UA 3OF8A 2G8EA 3PW3A 3CH3X 4W5CA 4WA6A 4W4UA 3K24A 1GMYA 2Y5BA 1Q6KA 2DC9A 1AYVA 3N4CA 4X6IA 3O0UA 2AVWA 4K7CA 1AYWA 5CHVA 1QOLA 1F2BA 1TLOA 3KWZA 3MHHA 2OULA 3BPFA 4MSXA 4Q8HA 2G6DA 3GCBA 1THEA 2AUZA 1TU6A 5EGWA 2XU4A 3F5VA 1F29A 5PADA 3V6CA 2DC7A 2JQGR 2FO5A 2AS8A 1KXRA 2HD5A 3NHEA 3IV2A 3PDFA 2H7JA 1U9QX 4OEMA 4YVAA 4PP1A 5F02A 4I05A 3CBJA 2DZZA 1QXPA 5CVNB 4AXMA 1AU4A 3OVZA 2NQAA 2FTDA 2E00A 3B79A 4N4ZA 4MZSA 4DMXA 1NL6A 1ZCMA 3O1GA 4BPVA 4N79A 1MIRA 1AU0A 3MHSA 1NQCA 2E01A 9PAPA 1VJVA 3S3RA 3MTNA 3KKUA 2DC8A 1Y08A 1ME4A 2FYEA 3IUTA 1NPZA 4PI3A 3IOQA 3CBKA 4QRGA 3KWBX 2DCDA 1CPJA 4I07A 4YYVA 3K9MA 2ARYA 2GHUA 3DF0A 1YK8A 2DZYA 3H89A 1YK7A 1PPPA 4G54A 1NB5A 2FQ9A 1TL9A 1U5IA 3QJ3A 1VSNA 3C9EA 1NLJA 4P6GA 1SNKA 4FIPA 4YYRA 1EWOA 1QMYA 3RVXA 1U9VA 4PADA 1CVZA 2P0RA 4BQVA 1PE6A 1O0EA 1CV8A 2R9NA 1YALA 3QSDA 1S4VA 2BDZA 5JA7A 2JQFR 1PPOA 2P7UA 4BSQA 3LXSA 2YJ2A 3HWNA 2CB5A 3N3KA 3IMAA 5CHTA 2G8JA 3RVWA 4X6JA 2ACTA 4X6HA 3HHIA 1HUCB 1A6RA 4KLBA 1EWMA 3LFYA 3H8CA 2FT2A 1U9WA 4FJCA 2NQGA 3ZUAA 2DJGB 4AXLA 1CJLA 2XU5A 3OVXA 1NB3A 2R9CA 2E02A 2FRQA 1CQDA 4RY2A 1PCIA 1CSBB 1MEGA 1KHQA 1MEMA 4QH6A 3P5WA 4CDEB 4QBBA 3IEJA 2AUXA 2HH5A 2FRAA 3D6SA 3PNRA 3V6EA 1GLOA 1AIMA 5J94A 1ICFA 1BQIA 1PPDA 3H8BA 2VHSA 4FK5A 4HWYA 3N3GA 3BWKA 2OP3A 4CDDB 2AYOA 1AYUA 4N8WA 1BY8A 1ME3A 1F2AA 3E1ZB 2O6XA 3HD3A 4OELA 3MORA 2IPPB 1K3BB 4BS6A 3BPMA 1M6DA 5K16A 2C0YA 1KFXL 1PADA 4YYQA 3F75A 2B1NA 2Y6EA 2BDLA 3QT4A 1CB5A 3KX1A 4CZWA 2YJCA 4CDCB 5FPWA 1DEUA 4QRXA 1GECE 1AU2A 2DJFB 1MS6A 3S3QA 1IWDA 2XU1A 4I04A 4BS5A 3U8EA 1PPNA 1JQPA 4MZOA 1PBHA 3I3TA 3H7DA 4Q8GA 1ZIVA 2DCAA 2P86A 3PBHA 4XR7A 2WBFX 4YYWA 2DC6A 1X9YA 2AIMA 5CVMA 3AI8A 2VHFA 4YYUA 1BGOA 1Y4HA 2R9OA 3ERVA 1CTEA 2ATOA 4P6EA 3RVVA 2DCCA 1PXVA 3H6SA 4DMYA 1EWPA 2R9MA 3WXFA 2YJ9A 2HHNA 1FH0A 1ATKA 2PNSA 1F2CA 1GCBA 2F1GA 1AECA 1AU3A 2YJBA 4YV8A 2PREA 2DCBA 3P5VA 1POPA 2XU3A 4XUIA 5EF4A 1MHWA 3BCNA 2E03A 5JH3A 4QRVA 2GFOA 2CIOA 1ITOA 3WXGA 1KHPA 2FUDA 1STFE 3I06A 2IBIA 1PIPA 3OF9A 3KFQA 1BP4A 4PP2E 4CDFB 2R6NA 3BOWA 2F7DA 2NQIA 2B1MA 1SP4B 2NQDB 1KFUL 3IHPA 1EWLA 1YVBA 4YYSA 2HXZA 1QDQA 2PADA 6PADA 4W5BA 1EF7A 3TNXA 2YJ8A 3KW9A 3CH2X 1MDWA 5A24A 3M99A 1DF0A 2PBHA 1YT7A 2G7YA 1CS8A 2AYNA 3USVA 3BC3A 7PCKA 1U9XA 3WXEA 3HHAA
chains in the Genus database with same CATH superfamily
2BU3A 8PCHA 3P5UA 2OZ2A 2R9FA 3MP2A 5CVOB 3KSEA 3O65A 1XKGA 3OISA 3P5XA 2AU1A 4ZUXU 3K8UA 2DOSA 3OF8A 2G8EA 4XZXA 3PW3A 3CH3X 4W5CA 4WA6A 4W4UA 3K24A 3BY4A 1YZBA 1GMYA 2AGAA 2Y5BA 1Q6KA 2DC9A 1AYVA 3N4CA 4X6IA 3O0UA 2AVWA 4K7CA 1AYWA 5CHVA 4RF0A 3PSEA 1QOLA 1F2BA 1TLOA 3KWZA 3MHHA 2OULA 3BPFA 4MSXA 4Q8HA 2G6DA 3GCBA 1THEA 2AUZA 4HXDB 1TU6A 4BOPA 5EGWA 2XU4A 3F5VA 2BTWB 3TMPA 1F29A 5PADA 3V6CA 2DC7A 2JQGR 2FO5A 2AS8A 3W31A 1KXRA 2HD5A 3NHEA 3IV2A 3PDFA 2H7JA 1U9QX 4OEMA 4YVAA 4PP1A 5F02A 4I05A 3CBJA 2DZZA 1QXPA 2JTCA 5CVNB 4AXMA 1AU4A 3OVZA 4GUAA 4IP3A 4REZA 2NQAA 2FTDA 2E00A 3MJ5A 3B79A 4N4ZA 4MZSA 4DMXA 1NL6A 1ZCMA 2Z84A 3O1GA 3IFUA 4BPVA 4N79A 1MIRA 1AU0A 3MHSA 1NQCA 2E01A 9PAPA 1VJVA 3S3RA 3MTNA 3KKUA 2DC8A 1Y08A 4RNAA 4P16A 1ME4A 3C0RA 2FYEA 3IUTA 1NPZA 4PI3A 3IOQA 3CBKA 4QRGA 3PRMA 3KWBX 2DCDA 1CPJA 4I07A 4YYVA 3K9MA 2ARYA 2GHUA 3DF0A 1YK8A 4M0WA 2DZYA 3H89A 1YK7A 1PPPA 4G54A 1NB5A 5EZQA 2FQ9A 1TL9A 1U5IA 4D8IA 3QJ3A 4ZTBA 1VSNA 3C9EA 4BOQA 1NLJA 5KO3A 4P6GA 1SNKA 4FIPA 4YYRA 1EWOA 1QMYA 3RVXA 1U9VA 3W30A 4PADA 1CVZA 2P0RA 4BQVA 1PE6A 1O0EA 4A5UA 1CV8A 2R9NA 1YALA 3QSDA 2J7QC 1S4VA 2BDZA 4PT5A 5JA7A 4OVZA 2JQFR 1PPOA 2P7UA 4BSQA 3LXSA 2YJ2A 3HWNA 2CB5A 3N3KA 3IMAA 5CHTA 2G8JA 3RVWA 4D8BA 4X6JA 2ACTA 3MTVA 4X6HA 3HHIA 1HUCB 1A6RA 4KLBA 1EWMA 3E9SA 3LFYA 3H8CA 4BOSA 3PHWA 2FT2A 1U9WA 2NQGA 4FJCA 3ZUAA 2DJGB 4AXLA 1CJLA 2XU5A 3OVXA 1NB3A 2R9CA 2E02A 2FRQA 1CQDA 4RY2A 1PCIA 4WURA 1CSBB 3PRPA 1MEGA 1KHQA 1MEMA 4QH6A 3P5WA 4R3DA 4RKXA 2UZJA 4CDEB 4QBBA 3IEJA 2AUXA 2HH5A 3PHUA 2FRAA 3D6SA 3PNRA 3V6EA 1GLOA 1AIMA 5J94A 2JRIA 1ICFA 1BQIA 1PPDA 3H8BA 2VHSA 4FK5A 4HWYA 4MI7A 4D8EA 3N3GA 3BWKA 2OP3A 4CDDB 2AYOA 1AYUA 4N8WA 1BY8A 1ME3A 1F2AA 3E1ZB 2O6XA 3HD3A 4OELA 3MORA 2IPPB 1K3BB 4BS6A 3BPMA 1M6DA 5K16A 2C0YA 1KFXL 1PADA 4YYQA 3F75A 2B1NA 2Y6EA 2BDLA 3QT4A 1CB5A 3KX1A 4CZWA 2YJCA 4CDCB 5FPWA 1DEUA 4QRXA 1GECE 1AU2A 4BOZA 2DJFB 1MS6A 3S3QA 1IWDA 2XU1A 3OQCA 4I04A 4BS5A 3U8EA 1PPNA 1JQPA 4MZOA 1PBHA 3I3TA 3H7DA 4OW0A 4Q8GA 3ZNHA 1ZIVA 3BBAA 2DCAA 2P86A 3PBHA 4XR7A 2WBFX 4YYWA 2DC6A 1X9YA 2AIMA 5CVMA 3AI8A 2VHFA 3RNVA 4YYUA 1BGOA 1Y4HA 2R9OA 3ERVA 1CTEA 2ATOA 4P6EA 3RVVA 2DCCA 1PXVA 2HWKA 3BB7A 3H6SA 4DMYA 1EWPA 2R9MA 3WXFA 2YJ9A 4BOUA 2HHNA 5E6JA 1FH0A 1ATKA 2PNSA 1F2CA 1GCBA 2F1GA 1AECA 1AU3A 2YJBA 4YV8A 2PREA 2DCBA 3P5VA 5JZEA 5EZSA 1POPA 2XU3A 1PVJA 4XUIA 5EF4A 1MHWA 3BCNA 2E03A 5JH3A 4RF1A 4QRVA 2GFOA 2CIOA 3B21A 1ITOA 3WXGA 1KHPA 2FUDA 1STFE 1DKIA 3I06A 2J7QA 2IBIA 1PIPA 3OF9A 3KFQA 1BP4A 4PP2E 4CDFB 2R6NA 3BOWA 2F7DA 2NQIA 2B1MA 3TRKA 1SP4B 2NQDB 1KFUL 3IHPA 1EWLA 3PHXA 4IUMA 1YVBA 1UKFA 4YYSA 2HXZA 1QDQA 2PADA 6PADA 2BTWA 4W5BA 1EF7A 4OVZB 3TNXA 2YJ8A 3KW9A 3CH2X 1MDWA 5A24A 3M99A 1DF0A 3PT2A 2PBHA 1YT7A 2G7YA 1CS8A 2AYNA 3USVA 3BC3A 7PCKA 1U9XA 3WXEA 4MM3B 2FE8A 3HHAA
chains in the Genus database with same CATH topology
8PCHA 3P5UA 2OZ2A 2R9FA 5CVOB 3KSEA 1XKGA 3OISA 3P5XA 2AU1A 4ZUXU 3K8UA 3OF8A 2G8EA 3PW3A 1GX3A 3CH3X 4W5CA 4WA6A 4W4UA 3K24A 1GMYA 2Y5BA 1Q6KA 2DC9A 1AYVA 3N4CA 4X6IA 3O0UA 2AVWA 4K7CA 1AYWA 5CHVA 1QOLA 1F2BA 1TLOA 3KWZA 3MHHA 2OULA 3BPFA 4MSXA 4Q8HA 2G6DA 3GCBA 1THEA 2AUZA 1TU6A 5EGWA 2XU4A 4BGFA 2VFCA 3F5VA 3LTWA 1F29A 5PADA 3V6CA 2DC7A 2JQGR 2FO5A 2AS8A 1KXRA 2HD5A 3NHEA 3IV2A 3PDFA 2H7JA 1U9QX 4OEMA 4YVAA 4PP1A 5F02A 4I05A 3CBJA 2DZZA 1QXPA 5CVNB 4AXMA 1AU4A 3OVZA 2NQAA 2FTDA 2E00A 3B79A 4N4ZA 4MZSA 4DMXA 1NL6A 1ZCMA 3O1GA 4BPVA 4N79A 1MIRA 1AU0A 3MHSA 1NQCA 2E01A 9PAPA 1VJVA 3S3RA 3MTNA 3KKUA 2DC8A 1Y08A 1ME4A 2FYEA 3IUTA 1NPZA 4PI3A 3IOQA 3CBKA 4QRGA 3KWBX 2DCDA 1CPJA 4I07A 4YYVA 3K9MA 2ARYA 2GHUA 3DF0A 1YK8A 2DZYA 3H89A 1YK7A 1PPPA 4G54A 1NB5A 2FQ9A 1TL9A 1U5IA 3QJ3A 1VSNA 3C9EA 1NLJA 4P6GA 1SNKA 4FIPA 4YYRA 1EWOA 1QMYA 3RVXA 1U9VA 4PADA 1CVZA 2P0RA 4BQVA 1PE6A 1O0EA 1CV8A 2R9NA 1YALA 3QSDA 1S4VA 2BDZA 5JA7A 2JQFR 1PPOA 2P7UA 4BSQA 3LXSA 2YJ2A 3HWNA 2CB5A 3N3KA 3IMAA 5CHTA 2G8JA 3RVWA 4X6JA 2ACTA 4X6HA 3HHIA 1HUCB 1A6RA 4KLBA 1EWMA 3LFYA 3H8CA 2FT2A 1U9WA 4FJCA 2NQGA 3ZUAA 2DJGB 4AXLA 1CJLA 2XU5A 3OVXA 1NB3A 2R9CA 2E02A 2FRQA 1CQDA 4RY2A 1PCIA 1CSBB 1MEGA 2BSZA 1KHQA 1MEMA 4QH6A 3P5WA 4CDEB 4QBBA 3IEJA 2AUXA 2HH5A 2FRAA 3D6SA 3PNRA 3V6EA 1GLOA 1AIMA 5J94A 1ICFA 1BQIA 1PPDA 3H8BA 2VHSA 4FK5A 4HWYA 4B55A 3N3GA 3BWKA 2OP3A 4CDDB 2AYOA 1AYUA 4N8WA 1BY8A 1ME3A 1F2AA 3E1ZB 2O6XA 3HD3A 4OELA 3MORA 2IPPB 1W6FA 1K3BB 4BS6A 3BPMA 1M6DA 5K16A 2C0YA 1KFXL 1PADA 1W5RA 4YYQA 3F75A 2B1NA 2Y6EA 2BDLA 3QT4A 1CB5A 3KX1A 4CZWA 2YJCA 4CDCB 5FPWA 1DEUA 4QRXA 1GECE 1AU2A 2DJFB 1MS6A 3S3QA 1IWDA 2XU1A 4I04A 4BS5A 3U8EA 1PPNA 1JQPA 4MZOA 1PBHA 3I3TA 3H7DA 4Q8GA 1E2TA 1ZIVA 2DCAA 2P86A 3PBHA 4XR7A 2WBFX 4YYWA 2DC6A 1X9YA 2AIMA 5CVMA 3AI8A 2VHFA 4YYUA 1BGOA 1Y4HA 2R9OA 3D9WA 2VFBA 3ERVA 1CTEA 2ATOA 4P6EA 3RVVA 2DCCA 1PXVA 3H6SA 4DMYA 1EWPA 2R9MA 3WXFA 2YJ9A 2HHNA 1FH0A 1ATKA 2PNSA 1F2CA 1GCBA 2F1GA 1AECA 4NV7A 1AU3A 2YJBA 4YV8A 4NV8A 2PREA 2DCBA 3P5VA 1POPA 2XU3A 4XUIA 5EF4A 1MHWA 4GUZA 3BCNA 2E03A 5JH3A 4QRVA 2GFOA 2CIOA 1ITOA 3WXGA 1KHPA 2FUDA 1W4TA 1STFE 3I06A 2IBIA 1PIPA 3OF9A 3KFQA 1BP4A 4PP2E 4CDFB 2R6NA 3BOWA 2F7DA 2NQIA 2B1MA 1SP4B 2NQDB 1KFUL 3IHPA 1EWLA 1YVBA 4YYSA 2HXZA 1QDQA 2PADA 6PADA 4W5BA 1EF7A 3TNXA 2YJ8A 3KW9A 3CH2X 1MDWA 5A24A 3M99A 1DF0A 2PBHA 1YT7A 2G7YA 1CS8A 2AYNA 3USVA 3BC3A 7PCKA 1U9XA 4C5PA 3WXEA 3HHAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 8PCH A;  3P5U A;  2OZ2 A;  2R9F A;  5CVO B;  3KSE A;  1XKG A;  3OIS A;  3P5X A;  2AU1 A;  4ZUX U;  3K8U A;  3OF8 A;  2G8E A;  3PW3 A;  3CH3 X;  4W5C A;  4WA6 A;  4W4U A;  3K24 A;  1GMY A;  2Y5B A;  1Q6K A;  2DC9 A;  1AYV A;  3N4C A;  4X6I A;  3O0U A;  2AVW A;  4K7C A;  1AYW A;  5CHV A;  1QOL A;  1F2B A;  1TLO A;  3KWZ A;  3MHH A;  2OUL A;  3BPF A;  4MSX A;  4Q8H A;  2G6D A;  3GCB A;  1THE A;  2AUZ A;  1TU6 A;  5EGW A;  2XU4 A;  3F5V A;  1F29 A;  5PAD A;  3V6C A;  2DC7 A;  2JQG R;  2FO5 A;  2AS8 A;  1KXR A;  2HD5 A;  3NHE A;  3IV2 A;  3PDF A;  2H7J A;  1U9Q X;  4OEM A;  4YVA A;  4PP1 A;  5F02 A;  4I05 A;  3CBJ A;  2DZZ A;  1QXP A;  5CVN B;  4AXM A;  1AU4 A;  3OVZ A;  2NQA A;  2FTD A;  2E00 A;  3B79 A;  4N4Z A;  4MZS A;  4DMX A;  1NL6 A;  1ZCM A;  3O1G A;  4BPV A;  4N79 A;  1MIR A;  1AU0 A;  3MHS A;  1NQC A;  2E01 A;  9PAP A;  1VJV A;  3S3R A;  3MTN A;  3KKU A;  2DC8 A;  1Y08 A;  1ME4 A;  2FYE A;  3IUT A;  1NPZ A;  4PI3 A;  3IOQ A;  3CBK A;  4QRG A;  3KWB X;  2DCD A;  1CPJ A;  4I07 A;  4YYV A;  3K9M A;  2ARY A;  2GHU A;  3DF0 A;  1YK8 A;  2DZY A;  3H89 A;  1YK7 A;  1PPP A;  4G54 A;  1NB5 A;  2FQ9 A;  1TL9 A;  1U5I A;  3QJ3 A;  1VSN A;  3C9E A;  1NLJ A;  4P6G A;  1SNK A;  4FIP A;  4YYR A;  1EWO A;  1QMY A;  3RVX A;  1U9V A;  4PAD A;  1CVZ A;  2P0R A;  4BQV A;  1PE6 A;  1O0E A;  1CV8 A;  2R9N A;  1YAL A;  3QSD A;  1S4V A;  2BDZ A;  5JA7 A;  2JQF R;  1PPO A;  2P7U A;  4BSQ A;  3LXS A;  2YJ2 A;  3HWN A;  2CB5 A;  3N3K A;  3IMA A;  5CHT A;  2G8J A;  3RVW A;  4X6J A;  2ACT A;  4X6H A;  3HHI A;  1HUC B;  1A6R A;  4KLB A;  1EWM A;  3LFY A;  3H8C A;  2FT2 A;  1U9W A;  4FJC A;  2NQG A;  3ZUA A;  2DJG B;  4AXL A;  1CJL A;  2XU5 A;  3OVX A;  1NB3 A;  2R9C A;  2E02 A;  2FRQ A;  1CQD A;  4RY2 A;  1PCI A;  1CSB B;  1MEG A;  1KHQ A;  1MEM A;  4QH6 A;  3P5W A;  4CDE B;  4QBB A;  3IEJ A;  2AUX A;  2HH5 A;  2FRA A;  3D6S A;  3PNR A;  3V6E A;  1GLO A;  1AIM A;  5J94 A;  1ICF A;  1BQI A;  1PPD A;  3H8B A;  2VHS A;  4FK5 A;  4HWY A;  3N3G A;  3BWK A;  2OP3 A;  4CDD B;  2AYO A;  1AYU A;  4N8W A;  1BY8 A;  1ME3 A;  1F2A A;  3E1Z B;  2O6X A;  3HD3 A;  4OEL A;  3MOR A;  2IPP B;  1K3B B;  4BS6 A;  3BPM A;  1M6D A;  5K16 A;  2C0Y A;  1KFX L;  1PAD A;  4YYQ A;  3F75 A;  2B1N A;  2Y6E A;  2BDL A;  3QT4 A;  1CB5 A;  3KX1 A;  4CZW A;  2YJC A;  4CDC B;  5FPW A;  1DEU A;  4QRX A;  1GEC E;  1AU2 A;  2DJF B;  1MS6 A;  3S3Q A;  1IWD A;  2XU1 A;  4I04 A;  4BS5 A;  3U8E A;  1PPN A;  1JQP A;  4MZO A;  1PBH A;  3I3T A;  3H7D A;  4Q8G A;  1ZIV A;  2DCA A;  2P86 A;  3PBH A;  4XR7 A;  2WBF X;  4YYW A;  2DC6 A;  1X9Y A;  2AIM A;  5CVM A;  3AI8 A;  2VHF A;  4YYU A;  1BGO A;  1Y4H A;  2R9O A;  3ERV A;  1CTE A;  2ATO A;  4P6E A;  3RVV A;  2DCC A;  1PXV A;  3H6S A;  4DMY A;  1EWP A;  2R9M A;  3WXF A;  2YJ9 A;  2HHN A;  1FH0 A;  1ATK A;  2PNS A;  1F2C A;  1GCB A;  2F1G A;  1AEC A;  1AU3 A;  2YJB A;  4YV8 A;  2PRE A;  2DCB A;  3P5V A;  1POP A;  2XU3 A;  4XUI A;  5EF4 A;  1MHW A;  3BCN A;  2E03 A;  5JH3 A;  4QRV A;  2GFO A;  2CIO A;  1ITO A;  3WXG A;  1KHP A;  2FUD A;  1STF E;  3I06 A;  2IBI A;  1PIP A;  3OF9 A;  3KFQ A;  1BP4 A;  4PP2 E;  4CDF B;  2R6N A;  3BOW A;  2F7D A;  2NQI A;  2B1M A;  1SP4 B;  2NQD B;  1KFU L;  3IHP A;  1EWL A;  1YVB A;  4YYS A;  2HXZ A;  1QDQ A;  2PAD A;  6PAD A;  4W5B A;  1EF7 A;  3TNX A;  2YJ8 A;  3KW9 A;  3CH2 X;  1MDW A;  5A24 A;  3M99 A;  1DF0 A;  2PBH A;  1YT7 A;  2G7Y A;  1CS8 A;  2AYN A;  3USV A;  3BC3 A;  7PCK A;  1U9X A;  3WXE A;  3HHA A; 
#chains in the Genus database with same CATH topology
 2BU3 A;  8PCH A;  3P5U A;  2OZ2 A;  2R9F A;  3MP2 A;  5CVO B;  3KSE A;  3O65 A;  1XKG A;  3OIS A;  3P5X A;  2AU1 A;  4ZUX U;  3K8U A;  2DOS A;  3OF8 A;  2G8E A;  4XZX A;  3PW3 A;  3CH3 X;  4W5C A;  4WA6 A;  4W4U A;  3K24 A;  3BY4 A;  1YZB A;  1GMY A;  2AGA A;  2Y5B A;  1Q6K A;  2DC9 A;  1AYV A;  3N4C A;  4X6I A;  3O0U A;  2AVW A;  4K7C A;  1AYW A;  5CHV A;  4RF0 A;  3PSE A;  1QOL A;  1F2B A;  1TLO A;  3KWZ A;  3MHH A;  2OUL A;  3BPF A;  4MSX A;  4Q8H A;  2G6D A;  3GCB A;  1THE A;  2AUZ A;  4HXD B;  1TU6 A;  4BOP A;  5EGW A;  2XU4 A;  3F5V A;  2BTW B;  3TMP A;  1F29 A;  5PAD A;  3V6C A;  2DC7 A;  2JQG R;  2FO5 A;  2AS8 A;  3W31 A;  1KXR A;  2HD5 A;  3NHE A;  3IV2 A;  3PDF A;  2H7J A;  1U9Q X;  4OEM A;  4YVA A;  4PP1 A;  5F02 A;  4I05 A;  3CBJ A;  2DZZ A;  1QXP A;  2JTC A;  5CVN B;  4AXM A;  1AU4 A;  3OVZ A;  4GUA A;  4IP3 A;  4REZ A;  2NQA A;  2FTD A;  2E00 A;  3MJ5 A;  3B79 A;  4N4Z A;  4MZS A;  4DMX A;  1NL6 A;  1ZCM A;  2Z84 A;  3O1G A;  3IFU A;  4BPV A;  4N79 A;  1MIR A;  1AU0 A;  3MHS A;  1NQC A;  2E01 A;  9PAP A;  1VJV A;  3S3R A;  3MTN A;  3KKU A;  2DC8 A;  1Y08 A;  4RNA A;  4P16 A;  1ME4 A;  3C0R A;  2FYE A;  3IUT A;  1NPZ A;  4PI3 A;  3IOQ A;  3CBK A;  4QRG A;  3PRM A;  3KWB X;  2DCD A;  1CPJ A;  4I07 A;  4YYV A;  3K9M A;  2ARY A;  2GHU A;  3DF0 A;  1YK8 A;  4M0W A;  2DZY A;  3H89 A;  1YK7 A;  1PPP A;  4G54 A;  1NB5 A;  5EZQ A;  2FQ9 A;  1TL9 A;  1U5I A;  4D8I A;  3QJ3 A;  4ZTB A;  1VSN A;  3C9E A;  4BOQ A;  1NLJ A;  5KO3 A;  4P6G A;  1SNK A;  4FIP A;  4YYR A;  1EWO A;  1QMY A;  3RVX A;  1U9V A;  3W30 A;  4PAD A;  1CVZ A;  2P0R A;  4BQV A;  1PE6 A;  1O0E A;  4A5U A;  1CV8 A;  2R9N A;  1YAL A;  3QSD A;  2J7Q C;  1S4V A;  2BDZ A;  4PT5 A;  5JA7 A;  4OVZ A;  2JQF R;  1PPO A;  2P7U A;  4BSQ A;  3LXS A;  2YJ2 A;  3HWN A;  2CB5 A;  3N3K A;  3IMA A;  5CHT A;  2G8J A;  3RVW A;  4D8B A;  4X6J A;  2ACT A;  3MTV A;  4X6H A;  3HHI A;  1HUC B;  1A6R A;  4KLB A;  1EWM A;  3E9S A;  3LFY A;  3H8C A;  4BOS A;  3PHW A;  2FT2 A;  1U9W A;  2NQG A;  4FJC A;  3ZUA A;  2DJG B;  4AXL A;  1CJL A;  2XU5 A;  3OVX A;  1NB3 A;  2R9C A;  2E02 A;  2FRQ A;  1CQD A;  4RY2 A;  1PCI A;  4WUR A;  1CSB B;  3PRP A;  1MEG A;  1KHQ A;  1MEM A;  4QH6 A;  3P5W A;  4R3D A;  4RKX A;  2UZJ A;  4CDE B;  4QBB A;  3IEJ A;  2AUX A;  2HH5 A;  3PHU A;  2FRA A;  3D6S A;  3PNR A;  3V6E A;  1GLO A;  1AIM A;  5J94 A;  2JRI A;  1ICF A;  1BQI A;  1PPD A;  3H8B A;  2VHS A;  4FK5 A;  4HWY A;  4MI7 A;  4D8E A;  3N3G A;  3BWK A;  2OP3 A;  4CDD B;  2AYO A;  1AYU A;  4N8W A;  1BY8 A;  1ME3 A;  1F2A A;  3E1Z B;  2O6X A;  3HD3 A;  4OEL A;  3MOR A;  2IPP B;  1K3B B;  4BS6 A;  3BPM A;  1M6D A;  5K16 A;  2C0Y A;  1KFX L;  1PAD A;  4YYQ A;  3F75 A;  2B1N A;  2Y6E A;  2BDL A;  3QT4 A;  1CB5 A;  3KX1 A;  4CZW A;  2YJC A;  4CDC B;  5FPW A;  1DEU A;  4QRX A;  1GEC E;  1AU2 A;  4BOZ A;  2DJF B;  1MS6 A;  3S3Q A;  1IWD A;  2XU1 A;  3OQC A;  4I04 A;  4BS5 A;  3U8E A;  1PPN A;  1JQP A;  4MZO A;  1PBH A;  3I3T A;  3H7D A;  4OW0 A;  4Q8G A;  3ZNH A;  1ZIV A;  3BBA A;  2DCA A;  2P86 A;  3PBH A;  4XR7 A;  2WBF X;  4YYW A;  2DC6 A;  1X9Y A;  2AIM A;  5CVM A;  3AI8 A;  2VHF A;  3RNV A;  4YYU A;  1BGO A;  1Y4H A;  2R9O A;  3ERV A;  1CTE A;  2ATO A;  4P6E A;  3RVV A;  2DCC A;  1PXV A;  2HWK A;  3BB7 A;  3H6S A;  4DMY A;  1EWP A;  2R9M A;  3WXF A;  2YJ9 A;  4BOU A;  2HHN A;  5E6J A;  1FH0 A;  1ATK A;  2PNS A;  1F2C A;  1GCB A;  2F1G A;  1AEC A;  1AU3 A;  2YJB A;  4YV8 A;  2PRE A;  2DCB A;  3P5V A;  5JZE A;  5EZS A;  1POP A;  2XU3 A;  1PVJ A;  4XUI A;  5EF4 A;  1MHW A;  3BCN A;  2E03 A;  5JH3 A;  4RF1 A;  4QRV A;  2GFO A;  2CIO A;  3B21 A;  1ITO A;  3WXG A;  1KHP A;  2FUD A;  1STF E;  1DKI A;  3I06 A;  2J7Q A;  2IBI A;  1PIP A;  3OF9 A;  3KFQ A;  1BP4 A;  4PP2 E;  4CDF B;  2R6N A;  3BOW A;  2F7D A;  2NQI A;  2B1M A;  3TRK A;  1SP4 B;  2NQD B;  1KFU L;  3IHP A;  1EWL A;  3PHX A;  4IUM A;  1YVB A;  1UKF A;  4YYS A;  2HXZ A;  1QDQ A;  2PAD A;  6PAD A;  2BTW A;  4W5B A;  1EF7 A;  4OVZ B;  3TNX A;  2YJ8 A;  3KW9 A;  3CH2 X;  1MDW A;  5A24 A;  3M99 A;  1DF0 A;  3PT2 A;  2PBH A;  1YT7 A;  2G7Y A;  1CS8 A;  2AYN A;  3USV A;  3BC3 A;  7PCK A;  1U9X A;  3WXE A;  4MM3 B;  2FE8 A;  3HHA A; 
#chains in the Genus database with same CATH homology
 8PCH A;  3P5U A;  2OZ2 A;  2R9F A;  5CVO B;  3KSE A;  1XKG A;  3OIS A;  3P5X A;  2AU1 A;  4ZUX U;  3K8U A;  3OF8 A;  2G8E A;  3PW3 A;  1GX3 A;  3CH3 X;  4W5C A;  4WA6 A;  4W4U A;  3K24 A;  1GMY A;  2Y5B A;  1Q6K A;  2DC9 A;  1AYV A;  3N4C A;  4X6I A;  3O0U A;  2AVW A;  4K7C A;  1AYW A;  5CHV A;  1QOL A;  1F2B A;  1TLO A;  3KWZ A;  3MHH A;  2OUL A;  3BPF A;  4MSX A;  4Q8H A;  2G6D A;  3GCB A;  1THE A;  2AUZ A;  1TU6 A;  5EGW A;  2XU4 A;  4BGF A;  2VFC A;  3F5V A;  3LTW A;  1F29 A;  5PAD A;  3V6C A;  2DC7 A;  2JQG R;  2FO5 A;  2AS8 A;  1KXR A;  2HD5 A;  3NHE A;  3IV2 A;  3PDF A;  2H7J A;  1U9Q X;  4OEM A;  4YVA A;  4PP1 A;  5F02 A;  4I05 A;  3CBJ A;  2DZZ A;  1QXP A;  5CVN B;  4AXM A;  1AU4 A;  3OVZ A;  2NQA A;  2FTD A;  2E00 A;  3B79 A;  4N4Z A;  4MZS A;  4DMX A;  1NL6 A;  1ZCM A;  3O1G A;  4BPV A;  4N79 A;  1MIR A;  1AU0 A;  3MHS A;  1NQC A;  2E01 A;  9PAP A;  1VJV A;  3S3R A;  3MTN A;  3KKU A;  2DC8 A;  1Y08 A;  1ME4 A;  2FYE A;  3IUT A;  1NPZ A;  4PI3 A;  3IOQ A;  3CBK A;  4QRG A;  3KWB X;  2DCD A;  1CPJ A;  4I07 A;  4YYV A;  3K9M A;  2ARY A;  2GHU A;  3DF0 A;  1YK8 A;  2DZY A;  3H89 A;  1YK7 A;  1PPP A;  4G54 A;  1NB5 A;  2FQ9 A;  1TL9 A;  1U5I A;  3QJ3 A;  1VSN A;  3C9E A;  1NLJ A;  4P6G A;  1SNK A;  4FIP A;  4YYR A;  1EWO A;  1QMY A;  3RVX A;  1U9V A;  4PAD A;  1CVZ A;  2P0R A;  4BQV A;  1PE6 A;  1O0E A;  1CV8 A;  2R9N A;  1YAL A;  3QSD A;  1S4V A;  2BDZ A;  5JA7 A;  2JQF R;  1PPO A;  2P7U A;  4BSQ A;  3LXS A;  2YJ2 A;  3HWN A;  2CB5 A;  3N3K A;  3IMA A;  5CHT A;  2G8J A;  3RVW A;  4X6J A;  2ACT A;  4X6H A;  3HHI A;  1HUC B;  1A6R A;  4KLB A;  1EWM A;  3LFY A;  3H8C A;  2FT2 A;  1U9W A;  4FJC A;  2NQG A;  3ZUA A;  2DJG B;  4AXL A;  1CJL A;  2XU5 A;  3OVX A;  1NB3 A;  2R9C A;  2E02 A;  2FRQ A;  1CQD A;  4RY2 A;  1PCI A;  1CSB B;  1MEG A;  2BSZ A;  1KHQ A;  1MEM A;  4QH6 A;  3P5W A;  4CDE B;  4QBB A;  3IEJ A;  2AUX A;  2HH5 A;  2FRA A;  3D6S A;  3PNR A;  3V6E A;  1GLO A;  1AIM A;  5J94 A;  1ICF A;  1BQI A;  1PPD A;  3H8B A;  2VHS A;  4FK5 A;  4HWY A;  4B55 A;  3N3G A;  3BWK A;  2OP3 A;  4CDD B;  2AYO A;  1AYU A;  4N8W A;  1BY8 A;  1ME3 A;  1F2A A;  3E1Z B;  2O6X A;  3HD3 A;  4OEL A;  3MOR A;  2IPP B;  1W6F A;  1K3B B;  4BS6 A;  3BPM A;  1M6D A;  5K16 A;  2C0Y A;  1KFX L;  1PAD A;  1W5R A;  4YYQ A;  3F75 A;  2B1N A;  2Y6E A;  2BDL A;  3QT4 A;  1CB5 A;  3KX1 A;  4CZW A;  2YJC A;  4CDC B;  5FPW A;  1DEU A;  4QRX A;  1GEC E;  1AU2 A;  2DJF B;  1MS6 A;  3S3Q A;  1IWD A;  2XU1 A;  4I04 A;  4BS5 A;  3U8E A;  1PPN A;  1JQP A;  4MZO A;  1PBH A;  3I3T A;  3H7D A;  4Q8G A;  1E2T A;  1ZIV A;  2DCA A;  2P86 A;  3PBH A;  4XR7 A;  2WBF X;  4YYW A;  2DC6 A;  1X9Y A;  2AIM A;  5CVM A;  3AI8 A;  2VHF A;  4YYU A;  1BGO A;  1Y4H A;  2R9O A;  3D9W A;  2VFB A;  3ERV A;  1CTE A;  2ATO A;  4P6E A;  3RVV A;  2DCC A;  1PXV A;  3H6S A;  4DMY A;  1EWP A;  2R9M A;  3WXF A;  2YJ9 A;  2HHN A;  1FH0 A;  1ATK A;  2PNS A;  1F2C A;  1GCB A;  2F1G A;  1AEC A;  4NV7 A;  1AU3 A;  2YJB A;  4YV8 A;  4NV8 A;  2PRE A;  2DCB A;  3P5V A;  1POP A;  2XU3 A;  4XUI A;  5EF4 A;  1MHW A;  4GUZ A;  3BCN A;  2E03 A;  5JH3 A;  4QRV A;  2GFO A;  2CIO A;  1ITO A;  3WXG A;  1KHP A;  2FUD A;  1W4T A;  1STF E;  3I06 A;  2IBI A;  1PIP A;  3OF9 A;  3KFQ A;  1BP4 A;  4PP2 E;  4CDF B;  2R6N A;  3BOW A;  2F7D A;  2NQI A;  2B1M A;  1SP4 B;  2NQD B;  1KFU L;  3IHP A;  1EWL A;  1YVB A;  4YYS A;  2HXZ A;  1QDQ A;  2PAD A;  6PAD A;  4W5B A;  1EF7 A;  3TNX A;  2YJ8 A;  3KW9 A;  3CH2 X;  1MDW A;  5A24 A;  3M99 A;  1DF0 A;  2PBH A;  1YT7 A;  2G7Y A;  1CS8 A;  2AYN A;  3USV A;  3BC3 A;  7PCK A;  1U9X A;  4C5P A;  3WXE A;  3HHA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...