2PBHA

Crystal structure of human procathepsin b at 3.3 angstrom resolution
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
317
structure length
317
Chain Sequence
MRSRPSFHPLSDELVNYVNKRNTTWQAGHNFYNVDMSYLKRLCGTFLGGPKPPQRVMFTEDLKLPASFDAREQWPQCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHTNAHVSVEVSAEDLLTCCGSMCGDGCNGGYPAEAWNFWTRKGLVSGGLYESHVGCRPYSIPPCEHHVNGSRPPCTGEGDTPKCSKICEPGYSPTYKQDKHYGYNSYSVSNSEKDIMAEIYKNGPVEGAFSVYSDFLLYKSGVYQHVTGEMMGGHAIRILGWGVENGTPYWLVANSWNTDWGDNGFFKILRGQDHCGIESEVVAGIPRTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROCATHEPSIN B
publication title Crystal structures of human procathepsin B at 3.2 and 3.3 Angstroms resolution reveal an interaction motif between a papain-like cysteine protease and its propeptide.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Thiol protease
total genus 61
structure length 317
sequence length 317
ec nomenclature ec 3.4.22.1: Cathepsin B.
pdb deposition date 1997-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
A PF08127 Propeptide_C1 Peptidase family C1 propeptide
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2pbhA00
3IEJA 3M99A 4PP1A 1NB5A 4BSQA 2H7JA 1YK8A 4YV8A 1BY8A 1GCBA 3K24A 2DJFB 2C0YA 3CH2X 4YYSA 1CVZA 3QT4A 2B1NA 2P0RA 1MDWA 2OZ2A 4W5BA 2FYEA 2PADA 2VHSA 1EWPA 4X6JA 1Y4HA 3LFYA 4QRGA 3V6EA 1BQIA 2R6NA 1KHQA 1FH0A 2DC8A 3P5VA 5FPWA 5A24A 2FTDA 2PBHA 2WBFX 3KW9A 1DEUA 4YYRA 3PW3A 3HD3A 3PDFA 2VHFA 1F29A 1M6DA 3GCBA 1X9YA 1PPDA 1U5IA 1GMYA 2ARYA 3I3TA 2AUZA 3IMAA 3TNXA 6PADA 3BCNA 4QH6A 4AXMA 3I06A 2XU1A 1PCIA 4ZUXU 1CPJA 3ZUAA 1TU6A 4BS5A 4W4UA 2ATOA 3V6CA 1ZIVA 2CB5A 2JQGR 2DCAA 3KFQA 4PP2E 3U8EA 3PNRA 3WXEA 3NHEA 2E01A 1SP4B 3RVXA 3S3QA 2R9FA 3B79A 3C9EA 2IBIA 2AIMA 4FJCA 5JA7A 3OISA 1VJVA 3H6SA 2PNSA 1KHPA 1AU2A 3LXSA 1ME4A 3DF0A 2NQAA 1CV8A 2NQGA 2OP3A 4FIPA 4WA6A 4XR7A 2XU4A 1AU0A 1KXRA 4MZOA 1TL9A 4FK5A 2R9CA 2Y6EA 1THEA 2F1GA 4CDFB 1QMYA 4KLBA 4X6HA 1DF0A 3IV2A 1F2AA 4QRVA 5CHVA 1O0EA 3BOWA 1MHWA 1AIMA 1POPA 1ME3A 1GECE 1NQCA 1IWDA 2IPPB 5EF4A 3N3GA 1CJLA 1S4VA 4PADA 2DCDA 2HXZA 4W5CA 3QSDA 1QDQA 1CQDA 4Q8HA 3PBHA 4RY2A 2DC7A 3CH3X 1PPOA 1QOLA 3ERVA 1Y08A 2NQDB 4BPVA 4PI3A 1MEGA 3F5VA 4N4ZA 3OVXA 8PCHA 1PXVA 2GFOA 1ICFA 2P86A 3IOQA 4BS6A 3IUTA 1PBHA 3MHHA 4K7CA 2HD5A 1AYWA 3BPMA 4MSXA 4OEMA 7PCKA 4CDCB 4N8WA 2G8EA 3BWKA 2DZYA 3AI8A 1MS6A 2DC9A 1EWOA 4CDDB 3KSEA 2FRAA 1XKGA 4P6GA 2JQFR 3KKUA 2YJBA 1PE6A 3H89A 4Q8GA 2BDZA 4MZSA 2F7DA 2O6XA 3S3RA 2HH5A 2P7UA 2G6DA 1NL6A 2FUDA 5CHTA 3MHSA 3OF8A 2YJ2A 1AYVA 4HWYA 1PPPA 4I07A 3RVVA 3BPFA 2AYOA 4P6EA 2XU3A 5JH3A 4YYQA 1CTEA 1KFUL 1YVBA 1EF7A 3H8BA 1EWMA 4I04A 1F2BA 1QXPA 2DZZA 4QRXA 4CZWA 5PADA 2G8JA 4I05A 2FQ9A 3K8UA 4DMYA 3KWZA 3OVZA 1TLOA 1PIPA 1CB5A 2R9OA 2R9MA 1Q6KA 3O0UA 3O1GA 4DMXA 1A6RA 1MEMA 2GHUA 3OF9A 3N3KA 2FRQA 2PREA 4X6IA 3H8CA 2XU5A 1AU4A 1STFE 3BC3A 1JQPA 1AYUA 1YALA 2YJCA 3IHPA 3CBJA 1K3BB 1BP4A 1KFXL 4CDEB 1ZCMA 1ITOA 1U9XA 1NPZA 3N4CA 1MIRA 1AECA 3KX1A 2AS8A 5CVMA 3KWBX 1EWLA 4XUIA 2B1MA 2DJGB 5J94A 3QJ3A 3F75A 3P5WA 5K16A 2E02A 1VSNA 1F2CA 2FO5A 1PADA 3CBKA 2BDLA 3USVA 3K9MA 3MTNA 5EGWA 2Y5BA 3P5XA 3WXFA 2R9NA 2AUXA 4OELA 2DC6A 2E00A 4YYWA 1U9QX 3H7DA 4BQVA 1YK7A 5CVOB 3HHIA 5F02A 9PAPA 2G7YA 2ACTA 2CIOA 3HWNA 1YT7A 1HUCB 2AVWA 1CSBB 2AYNA 1PPNA 4AXLA 1U9VA 1AU3A 2OULA 4G54A 3WXGA 3MORA 2YJ9A 2AU1A 3RVWA 2E03A 2YJ8A 1BGOA 2HHNA 1GLOA 4YVAA 2FT2A 1ATKA 4YYUA 1U9WA 1NLJA 3D6SA 1SNKA 2DCBA 3P5UA 1NB3A 2DCCA 4QBBA 3HHAA 4N79A 2NQIA 5CVNB 3E1ZB 1CS8A 4YYVA
chains in the Genus database with same CATH superfamily
3IEJA 4BOUA 3M99A 4PP1A 1NB5A 4BSQA 2H7JA 1YK8A 4YV8A 1BY8A 4D8EA 1GCBA 5EZSA 3K24A 2DJFB 2C0YA 3CH2X 4YYSA 1CVZA 1PVJA 3QT4A 2B1NA 2P0RA 1MDWA 2OZ2A 4RF1A 4W5BA 2FYEA 2PADA 2VHSA 1EWPA 4X6JA 1Y4HA 3LFYA 4QRGA 3V6EA 1BQIA 1YZBA 2R6NA 1KHQA 1FH0A 4R3DA 2DC8A 3P5VA 5FPWA 5EZQA 5A24A 2FTDA 4D8IA 2PBHA 2WBFX 3KW9A 1DEUA 3PT2A 4YYRA 3PW3A 3HD3A 3PDFA 2UZJA 2VHFA 1F29A 4MI7A 1M6DA 3GCBA 1X9YA 4BOQA 1PPDA 1U5IA 1GMYA 2ARYA 2HWKA 3I3TA 1UKFA 2AUZA 3IMAA 3PSEA 3TNXA 6PADA 3BCNA 4QH6A 4AXMA 3I06A 2XU1A 1PCIA 4ZUXU 1CPJA 2JRIA 3ZUAA 1TU6A 4BS5A 2AGAA 4W4UA 2ATOA 3V6CA 1ZIVA 2CB5A 2JQGR 2DCAA 3KFQA 4PP2E 3U8EA 4RKXA 3PNRA 3WXEA 3NHEA 2E01A 3PRMA 1SP4B 4ZTBA 3RVXA 3S3QA 2R9FA 3B79A 3C9EA 2BU3A 3PHWA 2IBIA 2AIMA 4FJCA 4OVZA 5JA7A 3BY4A 3OISA 1VJVA 3H6SA 2PNSA 1KHPA 1AU2A 3LXSA 1ME4A 4RF0A 4HXDB 3DF0A 2NQAA 1CV8A 2NQGA 2OP3A 4FIPA 4XZXA 4WA6A 4XR7A 2XU4A 1AU0A 1KXRA 4MZOA 1TL9A 4FK5A 2R9CA 3OQCA 3W31A 2Y6EA 3PHXA 1THEA 3BBAA 2F1GA 4CDFB 1QMYA 4KLBA 4X6HA 1DF0A 3IV2A 3MJ5A 1F2AA 4QRVA 5CHVA 3TRKA 1O0EA 3BOWA 1MHWA 1AIMA 1POPA 1ME3A 1GECE 2JTCA 1NQCA 1IWDA 2IPPB 5EF4A 3N3GA 1CJLA 1S4VA 4PADA 2DCDA 2HXZA 4W5CA 3QSDA 3O65A 1QDQA 3BB7A 1CQDA 4Q8HA 3PBHA 3RNVA 4RY2A 2DC7A 3CH3X 4P16A 1PPOA 1QOLA 3ERVA 1Y08A 2NQDB 4BPVA 3ZNHA 4PI3A 1MEGA 3F5VA 4N4ZA 3OVXA 8PCHA 1PXVA 3B21A 2GFOA 4OW0A 1ICFA 2P86A 3IOQA 4BOSA 3IUTA 1PBHA 3MHHA 4BS6A 4K7CA 2HD5A 1AYWA 2BTWB 3BPMA 4GUAA 4MSXA 5E6JA 4OEMA 7PCKA 4CDCB 4N8WA 2G8EA 3BWKA 2DZYA 3AI8A 1MS6A 2DC9A 1EWOA 4CDDB 3KSEA 2FRAA 1XKGA 4P6GA 2JQFR 3KKUA 2YJBA 1PE6A 3H89A 4Q8GA 2BDZA 4MZSA 2F7DA 2O6XA 1DKIA 4BOPA 3S3RA 2HH5A 2P7UA 2G6DA 3IFUA 1NL6A 2FUDA 5CHTA 3MHSA 3OF8A 4RNAA 2YJ2A 1AYVA 4HWYA 1PPPA 4I07A 3RVVA 3C0RA 3BPFA 2AYOA 4P6EA 4BOZA 2XU3A 5JH3A 4YYQA 1CTEA 1KFUL 1YVBA 1EF7A 3H8BA 1EWMA 5KO3A 4I04A 1F2BA 1QXPA 2DZZA 4QRXA 4CZWA 5PADA 2G8JA 4I05A 2FQ9A 4M0WA 3K8UA 4DMYA 3KWZA 3OVZA 1TLOA 1PIPA 1CB5A 2R9OA 2R9MA 1Q6KA 3O0UA 3O1GA 4DMXA 1A6RA 1MEMA 2GHUA 3OF9A 3N3KA 2FRQA 2PREA 4X6IA 3H8CA 2XU5A 1AU4A 1STFE 2J7QC 3BC3A 1JQPA 1AYUA 1YALA 3IHPA 2YJCA 3CBJA 1K3BB 1BP4A 3PHUA 1KFXL 4CDEB 1ZCMA 1ITOA 1U9XA 1NPZA 3N4CA 4PT5A 3MTVA 1MIRA 1AECA 3KX1A 4D8BA 2AS8A 5CVMA 3KWBX 1EWLA 4XUIA 2Z84A 2B1MA 2J7QA 2DJGB 5J94A 3QJ3A 3F75A 3E9SA 3P5WA 5K16A 2E02A 1VSNA 1F2CA 2FO5A 1PADA 3CBKA 2BDLA 3USVA 2BTWA 3K9MA 3MTNA 5EGWA 2Y5BA 3P5XA 3WXFA 2R9NA 2AUXA 4OELA 2DC6A 2E00A 2FE8A 4YYWA 4A5UA 1U9QX 3H7DA 4BQVA 1YK7A 5CVOB 4WURA 5JZEA 3HHIA 5F02A 3MP2A 9PAPA 2G7YA 4IUMA 2ACTA 2CIOA 3HWNA 1YT7A 4IP3A 1HUCB 2AVWA 1CSBB 4MM3B 2AYNA 1PPNA 4AXLA 1U9VA 1AU3A 2OULA 4G54A 3WXGA 4OVZB 4REZA 3MORA 2YJ9A 2AU1A 3RVWA 2E03A 2YJ8A 3PRPA 1BGOA 2HHNA 1GLOA 4YVAA 2FT2A 1ATKA 4YYUA 1U9WA 1NLJA 3D6SA 1SNKA 2DCBA 3P5UA 3TMPA 2DOSA 1NB3A 3W30A 2DCCA 4QBBA 3HHAA 4N79A 2NQIA 5CVNB 3E1ZB 1CS8A 4YYVA
chains in the Genus database with same CATH topology
3IEJA 3M99A 4PP1A 1NB5A 4BSQA 2H7JA 1YK8A 4YV8A 1BY8A 1E2TA 1GCBA 3K24A 2DJFB 2C0YA 3CH2X 4YYSA 1CVZA 3QT4A 2B1NA 2P0RA 1MDWA 2OZ2A 4W5BA 2FYEA 2PADA 2VHSA 1EWPA 4X6JA 1Y4HA 3LFYA 4QRGA 3V6EA 1BQIA 2R6NA 1KHQA 1FH0A 2DC8A 3P5VA 5FPWA 5A24A 2FTDA 2PBHA 2WBFX 3KW9A 1DEUA 4NV8A 4YYRA 3PW3A 3HD3A 3PDFA 2VHFA 1F29A 1M6DA 3GCBA 1X9YA 1PPDA 1U5IA 1GMYA 2ARYA 3I3TA 2AUZA 3IMAA 3TNXA 6PADA 3BCNA 4QH6A 4AXMA 3I06A 2XU1A 1PCIA 4ZUXU 1CPJA 3ZUAA 1TU6A 4BS5A 4W4UA 2ATOA 3V6CA 1ZIVA 2CB5A 2JQGR 2DCAA 3KFQA 4PP2E 3U8EA 4C5PA 3PNRA 3WXEA 3NHEA 2E01A 1SP4B 3RVXA 1GX3A 3S3QA 2R9FA 3B79A 3C9EA 2IBIA 2AIMA 4FJCA 5JA7A 3OISA 1VJVA 2BSZA 3H6SA 2PNSA 1KHPA 1AU2A 3LXSA 1ME4A 3DF0A 2NQAA 1CV8A 2NQGA 2OP3A 4FIPA 4WA6A 4XR7A 2XU4A 1AU0A 1KXRA 4MZOA 1TL9A 4FK5A 2R9CA 2Y6EA 1THEA 2F1GA 4CDFB 1QMYA 4KLBA 4X6HA 1DF0A 3IV2A 1F2AA 4QRVA 5CHVA 1O0EA 3BOWA 1MHWA 1AIMA 1POPA 1ME3A 1GECE 1NQCA 1IWDA 2IPPB 5EF4A 3N3GA 1CJLA 1S4VA 4PADA 2DCDA 2HXZA 4W5CA 3QSDA 1QDQA 1CQDA 4Q8HA 3PBHA 4RY2A 2DC7A 3CH3X 1PPOA 1QOLA 3ERVA 1Y08A 2NQDB 4BGFA 4BPVA 4PI3A 1MEGA 3F5VA 4N4ZA 3OVXA 8PCHA 1PXVA 2GFOA 1ICFA 2P86A 3IOQA 4BS6A 3IUTA 1PBHA 3MHHA 4K7CA 2HD5A 1AYWA 1W6FA 3BPMA 4MSXA 4OEMA 7PCKA 4CDCB 4N8WA 2G8EA 3BWKA 2DZYA 3AI8A 1MS6A 2DC9A 1EWOA 4CDDB 3KSEA 2FRAA 1XKGA 4P6GA 2JQFR 3KKUA 2YJBA 1PE6A 3H89A 4Q8GA 2BDZA 4MZSA 2F7DA 2O6XA 3S3RA 2HH5A 2P7UA 2G6DA 1NL6A 2FUDA 5CHTA 3MHSA 3OF8A 2YJ2A 1AYVA 4HWYA 1PPPA 1W5RA 4I07A 3RVVA 3BPFA 2AYOA 4P6EA 3D9WA 2XU3A 5JH3A 4YYQA 1CTEA 1KFUL 2VFBA 1YVBA 1EF7A 3H8BA 1EWMA 4I04A 1F2BA 1QXPA 2DZZA 4QRXA 4CZWA 5PADA 2G8JA 4I05A 2FQ9A 3K8UA 4DMYA 3KWZA 3OVZA 1TLOA 1PIPA 1CB5A 2R9OA 2R9MA 1Q6KA 3O0UA 3O1GA 4DMXA 1A6RA 1MEMA 2GHUA 3OF9A 3N3KA 2FRQA 2PREA 4X6IA 3H8CA 2XU5A 1AU4A 1STFE 3BC3A 1JQPA 1AYUA 1YALA 2YJCA 3IHPA 3CBJA 1K3BB 1BP4A 1KFXL 4CDEB 1ZCMA 4NV7A 1ITOA 1U9XA 1NPZA 3N4CA 1W4TA 1MIRA 1AECA 3KX1A 2AS8A 5CVMA 3KWBX 1EWLA 4XUIA 2B1MA 2DJGB 5J94A 3QJ3A 3F75A 3P5WA 5K16A 2E02A 1VSNA 1F2CA 2FO5A 1PADA 3CBKA 2BDLA 3USVA 3K9MA 3MTNA 5EGWA 2Y5BA 3P5XA 3WXFA 2R9NA 2AUXA 4OELA 2DC6A 2E00A 4YYWA 1U9QX 3H7DA 4BQVA 1YK7A 5CVOB 3HHIA 5F02A 9PAPA 2G7YA 2ACTA 2CIOA 3HWNA 1YT7A 1HUCB 2AVWA 1CSBB 2AYNA 1PPNA 4AXLA 1U9VA 1AU3A 2OULA 4G54A 3WXGA 3MORA 4B55A 2YJ9A 2AU1A 3RVWA 2E03A 2YJ8A 1BGOA 2HHNA 1GLOA 4YVAA 2FT2A 1ATKA 4YYUA 1U9WA 4GUZA 1NLJA 3D6SA 1SNKA 2DCBA 3P5UA 1NB3A 2DCCA 3LTWA 4QBBA 3HHAA 4N79A 2NQIA 5CVNB 3E1ZB 1CS8A 2VFCA 4YYVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IEJ A;  3M99 A;  4PP1 A;  1NB5 A;  4BSQ A;  2H7J A;  1YK8 A;  4YV8 A;  1BY8 A;  1GCB A;  3K24 A;  2DJF B;  2C0Y A;  3CH2 X;  4YYS A;  1CVZ A;  3QT4 A;  2B1N A;  2P0R A;  1MDW A;  2OZ2 A;  4W5B A;  2FYE A;  2PAD A;  2VHS A;  1EWP A;  4X6J A;  1Y4H A;  3LFY A;  4QRG A;  3V6E A;  1BQI A;  2R6N A;  1KHQ A;  1FH0 A;  2DC8 A;  3P5V A;  5FPW A;  5A24 A;  2FTD A;  2PBH A;  2WBF X;  3KW9 A;  1DEU A;  4YYR A;  3PW3 A;  3HD3 A;  3PDF A;  2VHF A;  1F29 A;  1M6D A;  3GCB A;  1X9Y A;  1PPD A;  1U5I A;  1GMY A;  2ARY A;  3I3T A;  2AUZ A;  3IMA A;  3TNX A;  6PAD A;  3BCN A;  4QH6 A;  4AXM A;  3I06 A;  2XU1 A;  1PCI A;  4ZUX U;  1CPJ A;  3ZUA A;  1TU6 A;  4BS5 A;  4W4U A;  2ATO A;  3V6C A;  1ZIV A;  2CB5 A;  2JQG R;  2DCA A;  3KFQ A;  4PP2 E;  3U8E A;  3PNR A;  3WXE A;  3NHE A;  2E01 A;  1SP4 B;  3RVX A;  3S3Q A;  2R9F A;  3B79 A;  3C9E A;  2IBI A;  2AIM A;  4FJC A;  5JA7 A;  3OIS A;  1VJV A;  3H6S A;  2PNS A;  1KHP A;  1AU2 A;  3LXS A;  1ME4 A;  3DF0 A;  2NQA A;  1CV8 A;  2NQG A;  2OP3 A;  4FIP A;  4WA6 A;  4XR7 A;  2XU4 A;  1AU0 A;  1KXR A;  4MZO A;  1TL9 A;  4FK5 A;  2R9C A;  2Y6E A;  1THE A;  2F1G A;  4CDF B;  1QMY A;  4KLB A;  4X6H A;  1DF0 A;  3IV2 A;  1F2A A;  4QRV A;  5CHV A;  1O0E A;  3BOW A;  1MHW A;  1AIM A;  1POP A;  1ME3 A;  1GEC E;  1NQC A;  1IWD A;  2IPP B;  5EF4 A;  3N3G A;  1CJL A;  1S4V A;  4PAD A;  2DCD A;  2HXZ A;  4W5C A;  3QSD A;  1QDQ A;  1CQD A;  4Q8H A;  3PBH A;  4RY2 A;  2DC7 A;  3CH3 X;  1PPO A;  1QOL A;  3ERV A;  1Y08 A;  2NQD B;  4BPV A;  4PI3 A;  1MEG A;  3F5V A;  4N4Z A;  3OVX A;  8PCH A;  1PXV A;  2GFO A;  1ICF A;  2P86 A;  3IOQ A;  4BS6 A;  3IUT A;  1PBH A;  3MHH A;  4K7C A;  2HD5 A;  1AYW A;  3BPM A;  4MSX A;  4OEM A;  7PCK A;  4CDC B;  4N8W A;  2G8E A;  3BWK A;  2DZY A;  3AI8 A;  1MS6 A;  2DC9 A;  1EWO A;  4CDD B;  3KSE A;  2FRA A;  1XKG A;  4P6G A;  2JQF R;  3KKU A;  2YJB A;  1PE6 A;  3H89 A;  4Q8G A;  2BDZ A;  4MZS A;  2F7D A;  2O6X A;  3S3R A;  2HH5 A;  2P7U A;  2G6D A;  1NL6 A;  2FUD A;  5CHT A;  3MHS A;  3OF8 A;  2YJ2 A;  1AYV A;  4HWY A;  1PPP A;  4I07 A;  3RVV A;  3BPF A;  2AYO A;  4P6E A;  2XU3 A;  5JH3 A;  4YYQ A;  1CTE A;  1KFU L;  1YVB A;  1EF7 A;  3H8B A;  1EWM A;  4I04 A;  1F2B A;  1QXP A;  2DZZ A;  4QRX A;  4CZW A;  5PAD A;  2G8J A;  4I05 A;  2FQ9 A;  3K8U A;  4DMY A;  3KWZ A;  3OVZ A;  1TLO A;  1PIP A;  1CB5 A;  2R9O A;  2R9M A;  1Q6K A;  3O0U A;  3O1G A;  4DMX A;  1A6R A;  1MEM A;  2GHU A;  3OF9 A;  3N3K A;  2FRQ A;  2PRE A;  4X6I A;  3H8C A;  2XU5 A;  1AU4 A;  1STF E;  3BC3 A;  1JQP A;  1AYU A;  1YAL A;  2YJC A;  3IHP A;  3CBJ A;  1K3B B;  1BP4 A;  1KFX L;  4CDE B;  1ZCM A;  1ITO A;  1U9X A;  1NPZ A;  3N4C A;  1MIR A;  1AEC A;  3KX1 A;  2AS8 A;  5CVM A;  3KWB X;  1EWL A;  4XUI A;  2B1M A;  2DJG B;  5J94 A;  3QJ3 A;  3F75 A;  3P5W A;  5K16 A;  2E02 A;  1VSN A;  1F2C A;  2FO5 A;  1PAD A;  3CBK A;  2BDL A;  3USV A;  3K9M A;  3MTN A;  5EGW A;  2Y5B A;  3P5X A;  3WXF A;  2R9N A;  2AUX A;  4OEL A;  2DC6 A;  2E00 A;  4YYW A;  1U9Q X;  3H7D A;  4BQV A;  1YK7 A;  5CVO B;  3HHI A;  5F02 A;  9PAP A;  2G7Y A;  2ACT A;  2CIO A;  3HWN A;  1YT7 A;  1HUC B;  2AVW A;  1CSB B;  2AYN A;  1PPN A;  4AXL A;  1U9V A;  1AU3 A;  2OUL A;  4G54 A;  3WXG A;  3MOR A;  2YJ9 A;  2AU1 A;  3RVW A;  2E03 A;  2YJ8 A;  1BGO A;  2HHN A;  1GLO A;  4YVA A;  2FT2 A;  1ATK A;  4YYU A;  1U9W A;  1NLJ A;  3D6S A;  1SNK A;  2DCB A;  3P5U A;  1NB3 A;  2DCC A;  4QBB A;  3HHA A;  4N79 A;  2NQI A;  5CVN B;  3E1Z B;  1CS8 A;  4YYV A; 
#chains in the Genus database with same CATH topology
 3IEJ A;  4BOU A;  3M99 A;  4PP1 A;  1NB5 A;  4BSQ A;  2H7J A;  1YK8 A;  4YV8 A;  1BY8 A;  4D8E A;  1GCB A;  5EZS A;  3K24 A;  2DJF B;  2C0Y A;  3CH2 X;  4YYS A;  1CVZ A;  1PVJ A;  3QT4 A;  2B1N A;  2P0R A;  1MDW A;  2OZ2 A;  4RF1 A;  4W5B A;  2FYE A;  2PAD A;  2VHS A;  1EWP A;  4X6J A;  1Y4H A;  3LFY A;  4QRG A;  3V6E A;  1BQI A;  1YZB A;  2R6N A;  1KHQ A;  1FH0 A;  4R3D A;  2DC8 A;  3P5V A;  5FPW A;  5EZQ A;  5A24 A;  2FTD A;  4D8I A;  2PBH A;  2WBF X;  3KW9 A;  1DEU A;  3PT2 A;  4YYR A;  3PW3 A;  3HD3 A;  3PDF A;  2UZJ A;  2VHF A;  1F29 A;  4MI7 A;  1M6D A;  3GCB A;  1X9Y A;  4BOQ A;  1PPD A;  1U5I A;  1GMY A;  2ARY A;  2HWK A;  3I3T A;  1UKF A;  2AUZ A;  3IMA A;  3PSE A;  3TNX A;  6PAD A;  3BCN A;  4QH6 A;  4AXM A;  3I06 A;  2XU1 A;  1PCI A;  4ZUX U;  1CPJ A;  2JRI A;  3ZUA A;  1TU6 A;  4BS5 A;  2AGA A;  4W4U A;  2ATO A;  3V6C A;  1ZIV A;  2CB5 A;  2JQG R;  2DCA A;  3KFQ A;  4PP2 E;  3U8E A;  4RKX A;  3PNR A;  3WXE A;  3NHE A;  2E01 A;  3PRM A;  1SP4 B;  4ZTB A;  3RVX A;  3S3Q A;  2R9F A;  3B79 A;  3C9E A;  2BU3 A;  3PHW A;  2IBI A;  2AIM A;  4FJC A;  4OVZ A;  5JA7 A;  3BY4 A;  3OIS A;  1VJV A;  3H6S A;  2PNS A;  1KHP A;  1AU2 A;  3LXS A;  1ME4 A;  4RF0 A;  4HXD B;  3DF0 A;  2NQA A;  1CV8 A;  2NQG A;  2OP3 A;  4FIP A;  4XZX A;  4WA6 A;  4XR7 A;  2XU4 A;  1AU0 A;  1KXR A;  4MZO A;  1TL9 A;  4FK5 A;  2R9C A;  3OQC A;  3W31 A;  2Y6E A;  3PHX A;  1THE A;  3BBA A;  2F1G A;  4CDF B;  1QMY A;  4KLB A;  4X6H A;  1DF0 A;  3IV2 A;  3MJ5 A;  1F2A A;  4QRV A;  5CHV A;  3TRK A;  1O0E A;  3BOW A;  1MHW A;  1AIM A;  1POP A;  1ME3 A;  1GEC E;  2JTC A;  1NQC A;  1IWD A;  2IPP B;  5EF4 A;  3N3G A;  1CJL A;  1S4V A;  4PAD A;  2DCD A;  2HXZ A;  4W5C A;  3QSD A;  3O65 A;  1QDQ A;  3BB7 A;  1CQD A;  4Q8H A;  3PBH A;  3RNV A;  4RY2 A;  2DC7 A;  3CH3 X;  4P16 A;  1PPO A;  1QOL A;  3ERV A;  1Y08 A;  2NQD B;  4BPV A;  3ZNH A;  4PI3 A;  1MEG A;  3F5V A;  4N4Z A;  3OVX A;  8PCH A;  1PXV A;  3B21 A;  2GFO A;  4OW0 A;  1ICF A;  2P86 A;  3IOQ A;  4BOS A;  3IUT A;  1PBH A;  3MHH A;  4BS6 A;  4K7C A;  2HD5 A;  1AYW A;  2BTW B;  3BPM A;  4GUA A;  4MSX A;  5E6J A;  4OEM A;  7PCK A;  4CDC B;  4N8W A;  2G8E A;  3BWK A;  2DZY A;  3AI8 A;  1MS6 A;  2DC9 A;  1EWO A;  4CDD B;  3KSE A;  2FRA A;  1XKG A;  4P6G A;  2JQF R;  3KKU A;  2YJB A;  1PE6 A;  3H89 A;  4Q8G A;  2BDZ A;  4MZS A;  2F7D A;  2O6X A;  1DKI A;  4BOP A;  3S3R A;  2HH5 A;  2P7U A;  2G6D A;  3IFU A;  1NL6 A;  2FUD A;  5CHT A;  3MHS A;  3OF8 A;  4RNA A;  2YJ2 A;  1AYV A;  4HWY A;  1PPP A;  4I07 A;  3RVV A;  3C0R A;  3BPF A;  2AYO A;  4P6E A;  4BOZ A;  2XU3 A;  5JH3 A;  4YYQ A;  1CTE A;  1KFU L;  1YVB A;  1EF7 A;  3H8B A;  1EWM A;  5KO3 A;  4I04 A;  1F2B A;  1QXP A;  2DZZ A;  4QRX A;  4CZW A;  5PAD A;  2G8J A;  4I05 A;  2FQ9 A;  4M0W A;  3K8U A;  4DMY A;  3KWZ A;  3OVZ A;  1TLO A;  1PIP A;  1CB5 A;  2R9O A;  2R9M A;  1Q6K A;  3O0U A;  3O1G A;  4DMX A;  1A6R A;  1MEM A;  2GHU A;  3OF9 A;  3N3K A;  2FRQ A;  2PRE A;  4X6I A;  3H8C A;  2XU5 A;  1AU4 A;  1STF E;  2J7Q C;  3BC3 A;  1JQP A;  1AYU A;  1YAL A;  3IHP A;  2YJC A;  3CBJ A;  1K3B B;  1BP4 A;  3PHU A;  1KFX L;  4CDE B;  1ZCM A;  1ITO A;  1U9X A;  1NPZ A;  3N4C A;  4PT5 A;  3MTV A;  1MIR A;  1AEC A;  3KX1 A;  4D8B A;  2AS8 A;  5CVM A;  3KWB X;  1EWL A;  4XUI A;  2Z84 A;  2B1M A;  2J7Q A;  2DJG B;  5J94 A;  3QJ3 A;  3F75 A;  3E9S A;  3P5W A;  5K16 A;  2E02 A;  1VSN A;  1F2C A;  2FO5 A;  1PAD A;  3CBK A;  2BDL A;  3USV A;  2BTW A;  3K9M A;  3MTN A;  5EGW A;  2Y5B A;  3P5X A;  3WXF A;  2R9N A;  2AUX A;  4OEL A;  2DC6 A;  2E00 A;  2FE8 A;  4YYW A;  4A5U A;  1U9Q X;  3H7D A;  4BQV A;  1YK7 A;  5CVO B;  4WUR A;  5JZE A;  3HHI A;  5F02 A;  3MP2 A;  9PAP A;  2G7Y A;  4IUM A;  2ACT A;  2CIO A;  3HWN A;  1YT7 A;  4IP3 A;  1HUC B;  2AVW A;  1CSB B;  4MM3 B;  2AYN A;  1PPN A;  4AXL A;  1U9V A;  1AU3 A;  2OUL A;  4G54 A;  3WXG A;  4OVZ B;  4REZ A;  3MOR A;  2YJ9 A;  2AU1 A;  3RVW A;  2E03 A;  2YJ8 A;  3PRP A;  1BGO A;  2HHN A;  1GLO A;  4YVA A;  2FT2 A;  1ATK A;  4YYU A;  1U9W A;  1NLJ A;  3D6S A;  1SNK A;  2DCB A;  3P5U A;  3TMP A;  2DOS A;  1NB3 A;  3W30 A;  2DCC A;  4QBB A;  3HHA A;  4N79 A;  2NQI A;  5CVN B;  3E1Z B;  1CS8 A;  4YYV A; 
#chains in the Genus database with same CATH homology
 3IEJ A;  3M99 A;  4PP1 A;  1NB5 A;  4BSQ A;  2H7J A;  1YK8 A;  4YV8 A;  1BY8 A;  1E2T A;  1GCB A;  3K24 A;  2DJF B;  2C0Y A;  3CH2 X;  4YYS A;  1CVZ A;  3QT4 A;  2B1N A;  2P0R A;  1MDW A;  2OZ2 A;  4W5B A;  2FYE A;  2PAD A;  2VHS A;  1EWP A;  4X6J A;  1Y4H A;  3LFY A;  4QRG A;  3V6E A;  1BQI A;  2R6N A;  1KHQ A;  1FH0 A;  2DC8 A;  3P5V A;  5FPW A;  5A24 A;  2FTD A;  2PBH A;  2WBF X;  3KW9 A;  1DEU A;  4NV8 A;  4YYR A;  3PW3 A;  3HD3 A;  3PDF A;  2VHF A;  1F29 A;  1M6D A;  3GCB A;  1X9Y A;  1PPD A;  1U5I A;  1GMY A;  2ARY A;  3I3T A;  2AUZ A;  3IMA A;  3TNX A;  6PAD A;  3BCN A;  4QH6 A;  4AXM A;  3I06 A;  2XU1 A;  1PCI A;  4ZUX U;  1CPJ A;  3ZUA A;  1TU6 A;  4BS5 A;  4W4U A;  2ATO A;  3V6C A;  1ZIV A;  2CB5 A;  2JQG R;  2DCA A;  3KFQ A;  4PP2 E;  3U8E A;  4C5P A;  3PNR A;  3WXE A;  3NHE A;  2E01 A;  1SP4 B;  3RVX A;  1GX3 A;  3S3Q A;  2R9F A;  3B79 A;  3C9E A;  2IBI A;  2AIM A;  4FJC A;  5JA7 A;  3OIS A;  1VJV A;  2BSZ A;  3H6S A;  2PNS A;  1KHP A;  1AU2 A;  3LXS A;  1ME4 A;  3DF0 A;  2NQA A;  1CV8 A;  2NQG A;  2OP3 A;  4FIP A;  4WA6 A;  4XR7 A;  2XU4 A;  1AU0 A;  1KXR A;  4MZO A;  1TL9 A;  4FK5 A;  2R9C A;  2Y6E A;  1THE A;  2F1G A;  4CDF B;  1QMY A;  4KLB A;  4X6H A;  1DF0 A;  3IV2 A;  1F2A A;  4QRV A;  5CHV A;  1O0E A;  3BOW A;  1MHW A;  1AIM A;  1POP A;  1ME3 A;  1GEC E;  1NQC A;  1IWD A;  2IPP B;  5EF4 A;  3N3G A;  1CJL A;  1S4V A;  4PAD A;  2DCD A;  2HXZ A;  4W5C A;  3QSD A;  1QDQ A;  1CQD A;  4Q8H A;  3PBH A;  4RY2 A;  2DC7 A;  3CH3 X;  1PPO A;  1QOL A;  3ERV A;  1Y08 A;  2NQD B;  4BGF A;  4BPV A;  4PI3 A;  1MEG A;  3F5V A;  4N4Z A;  3OVX A;  8PCH A;  1PXV A;  2GFO A;  1ICF A;  2P86 A;  3IOQ A;  4BS6 A;  3IUT A;  1PBH A;  3MHH A;  4K7C A;  2HD5 A;  1AYW A;  1W6F A;  3BPM A;  4MSX A;  4OEM A;  7PCK A;  4CDC B;  4N8W A;  2G8E A;  3BWK A;  2DZY A;  3AI8 A;  1MS6 A;  2DC9 A;  1EWO A;  4CDD B;  3KSE A;  2FRA A;  1XKG A;  4P6G A;  2JQF R;  3KKU A;  2YJB A;  1PE6 A;  3H89 A;  4Q8G A;  2BDZ A;  4MZS A;  2F7D A;  2O6X A;  3S3R A;  2HH5 A;  2P7U A;  2G6D A;  1NL6 A;  2FUD A;  5CHT A;  3MHS A;  3OF8 A;  2YJ2 A;  1AYV A;  4HWY A;  1PPP A;  1W5R A;  4I07 A;  3RVV A;  3BPF A;  2AYO A;  4P6E A;  3D9W A;  2XU3 A;  5JH3 A;  4YYQ A;  1CTE A;  1KFU L;  2VFB A;  1YVB A;  1EF7 A;  3H8B A;  1EWM A;  4I04 A;  1F2B A;  1QXP A;  2DZZ A;  4QRX A;  4CZW A;  5PAD A;  2G8J A;  4I05 A;  2FQ9 A;  3K8U A;  4DMY A;  3KWZ A;  3OVZ A;  1TLO A;  1PIP A;  1CB5 A;  2R9O A;  2R9M A;  1Q6K A;  3O0U A;  3O1G A;  4DMX A;  1A6R A;  1MEM A;  2GHU A;  3OF9 A;  3N3K A;  2FRQ A;  2PRE A;  4X6I A;  3H8C A;  2XU5 A;  1AU4 A;  1STF E;  3BC3 A;  1JQP A;  1AYU A;  1YAL A;  2YJC A;  3IHP A;  3CBJ A;  1K3B B;  1BP4 A;  1KFX L;  4CDE B;  1ZCM A;  4NV7 A;  1ITO A;  1U9X A;  1NPZ A;  3N4C A;  1W4T A;  1MIR A;  1AEC A;  3KX1 A;  2AS8 A;  5CVM A;  3KWB X;  1EWL A;  4XUI A;  2B1M A;  2DJG B;  5J94 A;  3QJ3 A;  3F75 A;  3P5W A;  5K16 A;  2E02 A;  1VSN A;  1F2C A;  2FO5 A;  1PAD A;  3CBK A;  2BDL A;  3USV A;  3K9M A;  3MTN A;  5EGW A;  2Y5B A;  3P5X A;  3WXF A;  2R9N A;  2AUX A;  4OEL A;  2DC6 A;  2E00 A;  4YYW A;  1U9Q X;  3H7D A;  4BQV A;  1YK7 A;  5CVO B;  3HHI A;  5F02 A;  9PAP A;  2G7Y A;  2ACT A;  2CIO A;  3HWN A;  1YT7 A;  1HUC B;  2AVW A;  1CSB B;  2AYN A;  1PPN A;  4AXL A;  1U9V A;  1AU3 A;  2OUL A;  4G54 A;  3WXG A;  3MOR A;  4B55 A;  2YJ9 A;  2AU1 A;  3RVW A;  2E03 A;  2YJ8 A;  1BGO A;  2HHN A;  1GLO A;  4YVA A;  2FT2 A;  1ATK A;  4YYU A;  1U9W A;  4GUZ A;  1NLJ A;  3D6S A;  1SNK A;  2DCB A;  3P5U A;  1NB3 A;  2DCC A;  3LTW A;  4QBB A;  3HHA A;  4N79 A;  2NQI A;  5CVN B;  3E1Z B;  1CS8 A;  2VFC A;  4YYV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...