3ZNHA

Crimean congo hemorrhagic fever virus otu domain in complex with ubiquitin-propargyl.
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
155
structure length
153
Chain Sequence
LDWTQVIAGQYVSNPRFNISDYFEIVRQPGDGNCFYHSIAELTMPNKTDHSYHYIKRLTESAARKYYQEEPEARLVGLSLEDYLKRMLSDNEWGSTLEASMLAKEMGITIIIWTVADEVEAGIKFGDGDVFTAVNLLHSGQTHFDALRILPQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title On Terminal Alkynes that Can React with Active-Site Cysteine Nucleophiles in Proteases.
pubmed doi rcsb
source organism Crimean-congo hemorrhagic fever virus
molecule tags Hydrolase/signaling protein
molecule keywords UBIQUITIN THIOESTERASE
total genus 45
structure length 153
sequence length 155
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2013-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02338 OTU OTU-like cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.80 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 3znhA00
3BY4A 3PHWA 3PRMA 4HXDB 4BOZA 4BOUA 3PHXA 5JZEA 3PHUA 3PSEA 4BOSA 4BOQA 3C0RA 3PT2A 3ZNHA 4BOPA 3PRPA 3TMPA
chains in the Genus database with same CATH superfamily
2PNSA 3W30A 2FT2A 1AU0A 1YT7A 3E1ZB 3CH3X 1BQIA 3MJ5A 3BB7A 1U5IA 2B1NA 2P0RA 3O1GA 1ME4A 3CBJA 4W4UA 4HWYA 3H6SA 3MORA 4GUAA 4Q8GA 4RKXA 2R9OA 3C9EA 1MEMA 1QMYA 4BOSA 3B79A 3QJ3A 2YJ2A 3KFQA 4ZTBA 1SNKA 2E03A 4XUIA 3HHAA 5JZEA 1Q6KA 4X6HA 2DZZA 2BDZA 4IUMA 1KHPA 2NQDB 3K24A 1MDWA 1NQCA 2DC9A 3P5VA 1FH0A 4OELA 2O6XA 1ATKA 1CTEA 1YK7A 3F75A 1F2CA 2FE8A 2F1GA 5CVOB 5CHTA 1CSBB 1DKIA 1Y08A 1ME3A 2YJCA 3ERVA 1GCBA 4W5BA 1CQDA 2R6NA 3ZNHA 2AVWA 2BU3A 2UZJA 2F7DA 4PP1A 4K7CA 4BQVA 2AGAA 3P5XA 4YV8A 2XU1A 5F02A 4A5UA 5E6JA 4RY2A 4I07A 1THEA 3QSDA 3D6SA 4FIPA 3WXFA 2FTDA 2PBHA 3N3GA 1YVBA 2NQGA 2Y6EA 2FO5A 3MHHA 4CDCB 2PADA 1SP4B 1M6DA 3O65A 2WBFX 1F2AA 3PDFA 2AYNA 2AUXA 4BPVA 3KW9A 3H8BA 2XU4A 4YVAA 3WXEA 4CDDB 2E02A 3K8UA 1NB3A 2JTCA 2AUZA 1CPJA 1STFE 2R9NA 2PREA 3HHIA 3KWZA 4FK5A 4I04A 1NL6A 1F29A 4YYSA 1AIMA 1QDQA 2DJGB 4N4ZA 3DF0A 4AXLA 3U8EA 9PAPA 3PHXA 1EWOA 2ARYA 4ZUXU 2DCDA 3CH2X 1NB5A 5EF4A 3BBAA 4WURA 4QH6A 4I05A 1PCIA 3BCNA 1AU2A 2Y5BA 4YYVA 5EZSA 3PNRA 4BS5A 4X6JA 2CB5A 4MM3B 2FRAA 3F5VA 1DEUA 2OZ2A 4XR7A 1KFXL 3MTNA 2DCCA 2AU1A 3HWNA 2FYEA 3IOQA 3KX1A 1IWDA 2R9CA 3H7DA 4YYWA 4QRGA 3TNXA 1UKFA 1GMYA 1AU3A 1A6RA 2JQGR 1O0EA 5CVMA 3KSEA 2HWKA 3QT4A 1VJVA 7PCKA 1CV8A 4MI7A 2Z84A 4AXMA 3OVXA 2ACTA 4OEMA 1EWLA 3KWBX 3ZUAA 1EF7A 1PADA 4YYUA 3IV2A 1CVZA 2E00A 1AECA 4DMXA 2ATOA 3I3TA 3RVVA 2R9FA 3K9MA 1U9WA 1AYWA 1U9QX 1AYUA 3PBHA 1K3BB 1MIRA 3H89A 2OULA 2HD5A 4YYQA 1VSNA 2G7YA 4D8IA 1TLOA 1YZBA 1DF0A 2E01A 2AYOA 4IP3A 1CS8A 4BOZA 2YJ9A 3PSEA 3V6CA 5EZQA 4R3DA 4QRXA 2YJ8A 3NHEA 2G8EA 1PIPA 4W5CA 2GHUA 4DMYA 4RF0A 4BOUA 1MS6A 3CBKA 5KO3A 1ICFA 2DOSA 1NLJA 4OVZB 2J7QA 1PE6A 1PBHA 1XKGA 1TU6A 4OW0A 4BOQA 1S4VA 3MP2A 2HH5A 4N8WA 1QXPA 2P86A 3P5WA 2DCBA 3IHPA 2G6DA 3OF8A 2GFOA 1GLOA 2DC8A 3OF9A 4OVZA 1KFUL 1MEGA 6PADA 3IEJA 4CZWA 4PADA 4Q8HA 1YK8A 1AYVA 3P5UA 1PPDA 1PPNA 2IPPB 3USVA 4M0WA 1CJLA 4N79A 3OQCA 3BY4A 2P7UA 2AS8A 3GCBA 2YJBA 3PRPA 5J94A 1YALA 2AIMA 2FUDA 1U9XA 3RVXA 1EWPA 2C0YA 3WXGA 2DCAA 4P6EA 2JQFR 1BY8A 3BC3A 3BPFA 1X9YA 1MHWA 5PADA 1ITOA 4G54A 1JQPA 5CVNB 1U9VA 3OISA 4MZOA 4QRVA 4BOPA 3OVZA 3E9SA 3PRMA 4RNAA 5EGWA 2XU3A 4BS6A 2HHNA 5JA7A 1ZCMA 3M99A 1BGOA 1POPA 1CB5A 2DZYA 4RF1A 4CDEB 3AI8A 3MTVA 2BDLA 1TL9A 3PT2A 2J7QC 1PVJA 8PCHA 1GECE 3H8CA 4MZSA 2DC7A 1KXRA 4QBBA 3W31A 4PP2E 2DC6A 3BPMA 3IUTA 2G8JA 1PPOA 4D8EA 3N4CA 3IMAA 4FJCA 5FPWA 3RVWA 2VHFA 1F2BA 3LFYA 2R9MA 2FRQA 4X6IA 4XZXA 5A24A 1Y4HA 1HUCB 3S3QA 2BTWA 3IFUA 3PHWA 3V6EA 2FQ9A 3PHUA 1BP4A 4PT5A 3C0RA 1NPZA 5CHVA 3BOWA 2B1MA 1AU4A 4WA6A 2JRIA 3B21A 4REZA 3KKUA 1EWMA 3TMPA 4CDFB 4YYRA 1QOLA 2XU5A 2BTWB 1ZIVA 2DJFB 3RNVA 2NQAA 1PPPA 2HXZA 2CIOA 2VHSA 4P16A 3I06A 3HD3A 2NQIA 4P6GA 3MHSA 3O0UA 3PW3A 2OP3A 2IBIA 3BWKA 4HXDB 3TRKA 5JH3A 3LXSA 2H7JA 4MSXA 5K16A 1PXVA 4BSQA 4PI3A 4D8BA 1KHQA 3N3KA 3S3RA 4KLBA
chains in the Genus database with same CATH topology
4M0WA 4GUAA 3W31A 3W30A 3O65A 4RKXA 5E6JA 3PHXA 4A5UA 3OQCA 3PSEA 4BOZA 5EZQA 4R3DA 4D8EA 4BOPA 2HWKA 3BY4A 2JRIA 3B21A 3E9SA 3PRMA 4HXDB 4RNAA 3TRKA 4RF0A 4BOUA 3BBAA 4REZA 2FE8A 4MI7A 2JTCA 2Z84A 4OVZA 4WURA 4BOSA 1DKIA 3MJ5A 3PRPA 3BB7A 4ZTBA 3TMPA 5KO3A 4XZXA 4RF1A 5JZEA 2BTWB 4D8BA 3MTVA 3PT2A 3ZNHA 2DOSA 4OVZB 2J7QC 3RNVA 2J7QA 2UZJA 2BU3A 1PVJA 4D8IA 2BTWA 3IFUA 3PHWA 4IUMA 4P16A 1UKFA 1YZBA 2AGAA 3PHUA 4OW0A 4PT5A 3C0RA 5EZSA 4BOQA 3MP2A 4MM3B 4IP3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BY4 A;  3PHW A;  3PRM A;  4HXD B;  4BOZ A;  4BOU A;  3PHX A;  5JZE A;  3PHU A;  3PSE A;  4BOS A;  4BOQ A;  3C0R A;  3PT2 A;  3ZNH A;  4BOP A;  3PRP A;  3TMP A; 
#chains in the Genus database with same CATH topology
 2PNS A;  3W30 A;  2FT2 A;  1AU0 A;  1YT7 A;  3E1Z B;  3CH3 X;  1BQI A;  3MJ5 A;  3BB7 A;  1U5I A;  2B1N A;  2P0R A;  3O1G A;  1ME4 A;  3CBJ A;  4W4U A;  4HWY A;  3H6S A;  3MOR A;  4GUA A;  4Q8G A;  4RKX A;  2R9O A;  3C9E A;  1MEM A;  1QMY A;  4BOS A;  3B79 A;  3QJ3 A;  2YJ2 A;  3KFQ A;  4ZTB A;  1SNK A;  2E03 A;  4XUI A;  3HHA A;  5JZE A;  1Q6K A;  4X6H A;  2DZZ A;  2BDZ A;  4IUM A;  1KHP A;  2NQD B;  3K24 A;  1MDW A;  1NQC A;  2DC9 A;  3P5V A;  1FH0 A;  4OEL A;  2O6X A;  1ATK A;  1CTE A;  1YK7 A;  3F75 A;  1F2C A;  2FE8 A;  2F1G A;  5CVO B;  5CHT A;  1CSB B;  1DKI A;  1Y08 A;  1ME3 A;  2YJC A;  3ERV A;  1GCB A;  4W5B A;  1CQD A;  2R6N A;  3ZNH A;  2AVW A;  2BU3 A;  2UZJ A;  2F7D A;  4PP1 A;  4K7C A;  4BQV A;  2AGA A;  3P5X A;  4YV8 A;  2XU1 A;  5F02 A;  4A5U A;  5E6J A;  4RY2 A;  4I07 A;  1THE A;  3QSD A;  3D6S A;  4FIP A;  3WXF A;  2FTD A;  2PBH A;  3N3G A;  1YVB A;  2NQG A;  2Y6E A;  2FO5 A;  3MHH A;  4CDC B;  2PAD A;  1SP4 B;  1M6D A;  3O65 A;  2WBF X;  1F2A A;  3PDF A;  2AYN A;  2AUX A;  4BPV A;  3KW9 A;  3H8B A;  2XU4 A;  4YVA A;  3WXE A;  4CDD B;  2E02 A;  3K8U A;  1NB3 A;  2JTC A;  2AUZ A;  1CPJ A;  1STF E;  2R9N A;  2PRE A;  3HHI A;  3KWZ A;  4FK5 A;  4I04 A;  1NL6 A;  1F29 A;  4YYS A;  1AIM A;  1QDQ A;  2DJG B;  4N4Z A;  3DF0 A;  4AXL A;  3U8E A;  9PAP A;  3PHX A;  1EWO A;  2ARY A;  4ZUX U;  2DCD A;  3CH2 X;  1NB5 A;  5EF4 A;  3BBA A;  4WUR A;  4QH6 A;  4I05 A;  1PCI A;  3BCN A;  1AU2 A;  2Y5B A;  4YYV A;  5EZS A;  3PNR A;  4BS5 A;  4X6J A;  2CB5 A;  4MM3 B;  2FRA A;  3F5V A;  1DEU A;  2OZ2 A;  4XR7 A;  1KFX L;  3MTN A;  2DCC A;  2AU1 A;  3HWN A;  2FYE A;  3IOQ A;  3KX1 A;  1IWD A;  2R9C A;  3H7D A;  4YYW A;  4QRG A;  3TNX A;  1UKF A;  1GMY A;  1AU3 A;  1A6R A;  2JQG R;  1O0E A;  5CVM A;  3KSE A;  2HWK A;  3QT4 A;  1VJV A;  7PCK A;  1CV8 A;  4MI7 A;  2Z84 A;  4AXM A;  3OVX A;  2ACT A;  4OEM A;  1EWL A;  3KWB X;  3ZUA A;  1EF7 A;  1PAD A;  4YYU A;  3IV2 A;  1CVZ A;  2E00 A;  1AEC A;  4DMX A;  2ATO A;  3I3T A;  3RVV A;  2R9F A;  3K9M A;  1U9W A;  1AYW A;  1U9Q X;  1AYU A;  3PBH A;  1K3B B;  1MIR A;  3H89 A;  2OUL A;  2HD5 A;  4YYQ A;  1VSN A;  2G7Y A;  4D8I A;  1TLO A;  1YZB A;  1DF0 A;  2E01 A;  2AYO A;  4IP3 A;  1CS8 A;  4BOZ A;  2YJ9 A;  3PSE A;  3V6C A;  5EZQ A;  4R3D A;  4QRX A;  2YJ8 A;  3NHE A;  2G8E A;  1PIP A;  4W5C A;  2GHU A;  4DMY A;  4RF0 A;  4BOU A;  1MS6 A;  3CBK A;  5KO3 A;  1ICF A;  2DOS A;  1NLJ A;  4OVZ B;  2J7Q A;  1PE6 A;  1PBH A;  1XKG A;  1TU6 A;  4OW0 A;  4BOQ A;  1S4V A;  3MP2 A;  2HH5 A;  4N8W A;  1QXP A;  2P86 A;  3P5W A;  2DCB A;  3IHP A;  2G6D A;  3OF8 A;  2GFO A;  1GLO A;  2DC8 A;  3OF9 A;  4OVZ A;  1KFU L;  1MEG A;  6PAD A;  3IEJ A;  4CZW A;  4PAD A;  4Q8H A;  1YK8 A;  1AYV A;  3P5U A;  1PPD A;  1PPN A;  2IPP B;  3USV A;  4M0W A;  1CJL A;  4N79 A;  3OQC A;  3BY4 A;  2P7U A;  2AS8 A;  3GCB A;  2YJB A;  3PRP A;  5J94 A;  1YAL A;  2AIM A;  2FUD A;  1U9X A;  3RVX A;  1EWP A;  2C0Y A;  3WXG A;  2DCA A;  4P6E A;  2JQF R;  1BY8 A;  3BC3 A;  3BPF A;  1X9Y A;  1MHW A;  5PAD A;  1ITO A;  4G54 A;  1JQP A;  5CVN B;  1U9V A;  3OIS A;  4MZO A;  4QRV A;  4BOP A;  3OVZ A;  3E9S A;  3PRM A;  4RNA A;  5EGW A;  2XU3 A;  4BS6 A;  2HHN A;  5JA7 A;  1ZCM A;  3M99 A;  1BGO A;  1POP A;  1CB5 A;  2DZY A;  4RF1 A;  4CDE B;  3AI8 A;  3MTV A;  2BDL A;  1TL9 A;  3PT2 A;  2J7Q C;  1PVJ A;  8PCH A;  1GEC E;  3H8C A;  4MZS A;  2DC7 A;  1KXR A;  4QBB A;  3W31 A;  4PP2 E;  2DC6 A;  3BPM A;  3IUT A;  2G8J A;  1PPO A;  4D8E A;  3N4C A;  3IMA A;  4FJC A;  5FPW A;  3RVW A;  2VHF A;  1F2B A;  3LFY A;  2R9M A;  2FRQ A;  4X6I A;  4XZX A;  5A24 A;  1Y4H A;  1HUC B;  3S3Q A;  2BTW A;  3IFU A;  3PHW A;  3V6E A;  2FQ9 A;  3PHU A;  1BP4 A;  4PT5 A;  3C0R A;  1NPZ A;  5CHV A;  3BOW A;  2B1M A;  1AU4 A;  4WA6 A;  2JRI A;  3B21 A;  4REZ A;  3KKU A;  1EWM A;  3TMP A;  4CDF B;  4YYR A;  1QOL A;  2XU5 A;  2BTW B;  1ZIV A;  2DJF B;  3RNV A;  2NQA A;  1PPP A;  2HXZ A;  2CIO A;  2VHS A;  4P16 A;  3I06 A;  3HD3 A;  2NQI A;  4P6G A;  3MHS A;  3O0U A;  3PW3 A;  2OP3 A;  2IBI A;  3BWK A;  4HXD B;  3TRK A;  5JH3 A;  3LXS A;  2H7J A;  4MSX A;  5K16 A;  1PXV A;  4BSQ A;  4PI3 A;  4D8B A;  1KHQ A;  3N3K A;  3S3R A;  4KLB A; 
#chains in the Genus database with same CATH homology
 4M0W A;  4GUA A;  3W31 A;  3W30 A;  3O65 A;  4RKX A;  5E6J A;  3PHX A;  4A5U A;  3OQC A;  3PSE A;  4BOZ A;  5EZQ A;  4R3D A;  4D8E A;  4BOP A;  2HWK A;  3BY4 A;  2JRI A;  3B21 A;  3E9S A;  3PRM A;  4HXD B;  4RNA A;  3TRK A;  4RF0 A;  4BOU A;  3BBA A;  4REZ A;  2FE8 A;  4MI7 A;  2JTC A;  2Z84 A;  4OVZ A;  4WUR A;  4BOS A;  1DKI A;  3MJ5 A;  3PRP A;  3BB7 A;  4ZTB A;  3TMP A;  5KO3 A;  4XZX A;  4RF1 A;  5JZE A;  2BTW B;  4D8B A;  3MTV A;  3PT2 A;  3ZNH A;  2DOS A;  4OVZ B;  2J7Q C;  3RNV A;  2J7Q A;  2UZJ A;  2BU3 A;  1PVJ A;  4D8I A;  2BTW A;  3IFU A;  3PHW A;  4IUM A;  4P16 A;  1UKF A;  1YZB A;  2AGA A;  3PHU A;  4OW0 A;  4PT5 A;  3C0R A;  5EZS A;  4BOQ A;  3MP2 A;  4MM3 B;  4IP3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...