3ZNHA

Crimean congo hemorrhagic fever virus otu domain in complex with ubiquitin-propargyl.
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
155
structure length
153
Chain Sequence
LDWTQVIAGQYVSNPRFNISDYFEIVRQPGDGNCFYHSIAELTMPNKTDHSYHYIKRLTESAARKYYQEEPEARLVGLSLEDYLKRMLSDNEWGSTLEASMLAKEMGITIIIWTVADEVEAGIKFGDGDVFTAVNLLHSGQTHFDALRILPQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UBIQUITIN THIOESTERASE
publication title On Terminal Alkynes that Can React with Active-Site Cysteine Nucleophiles in Proteases.
pubmed doi rcsb
source organism Crimean-congo hemorrhagic fever virus
molecule tags Hydrolase/signaling protein
total genus 45
structure length 153
sequence length 155
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2013-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02338 OTU OTU-like cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.80 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 3znhA00
4BOSA 3ZNHA 3PHXA 3PHWA 3PHUA 3PRPA 3PSEA 4BOUA 3PRMA 4BOPA 4BOZA 4BOQA 3BY4A 5JZEA 3C0RA 3PT2A 3TMPA 4HXDB
chains in the Genus database with same CATH superfamily
3PHXA 4W5BA 3WXEA 2R6NA 4MSXA 2XU4A 2DCCA 3BY4A 1Y4HA 4P6GA 3BBAA 1ME3A 2DC9A 2PREA 4HXDB 2FRAA 1K3BB 1PPOA 2P86A 2FYEA 1A6RA 1BY8A 1KFXL 4MZSA 4P6EA 2O6XA 2Y5BA 2OZ2A 4I07A 5FPWA 1CV8A 3MJ5A 1QOLA 2JQFR 2YJ9A 2UZJA 2DJFB 5F02A 1GLOA 1BQIA 3OF9A 4OEMA 1NLJA 5K16A 2IBIA 3N3GA 4PP2E 4X6HA 4RF1A 1Q6KA 4YV8A 4Q8GA 2E01A 1KXRA 3QT4A 1U9WA 5JA7A 4OW0A 3M99A 1EWLA 1KHQA 1PVJA 4CDFB 2YJ2A 4PI3A 4Q8HA 3E9SA 3BB7A 4BOUA 1NQCA 1PE6A 4I05A 4N8WA 1PBHA 4RNAA 1BGOA 1ITOA 1TU6A 3IHPA 4DMXA 1DEUA 3PDFA 4RY2A 3V6CA 3B21A 3I3TA 4QRGA 1CS8A 1HUCB 2FO5A 2P7UA 3PNRA 1PCIA 5KO3A 3BPMA 4YYUA 2ATOA 1AECA 3MTVA 2OULA 3IV2A 2HHNA 4QRVA 1MEGA 3N4CA 1CJLA 2OP3A 2AGAA 4DMYA 1STFE 2B1NA 9PAPA 1YK7A 3BPFA 3P5WA 4QBBA 4FJCA 2B1MA 8PCHA 3K24A 3KKUA 2HXZA 2WBFX 3RVWA 1U9QX 2DC8A 4MZOA 1VSNA 4YYQA 3PRMA 3LXSA 2R9CA 1IWDA 1AYVA 2DZZA 1QXPA 6PADA 3WXFA 2P0RA 4X6IA 2BU3A 3O65A 2CB5A 3KW9A 2YJ8A 4REZA 2NQGA 5PADA 2BDZA 4CDCB 2AYNA 3P5UA 2JRIA 2DCDA 2NQIA 1NB5A 3MHSA 2H7JA 3CBKA 1AU0A 4OVZA 1CPJA 2JTCA 2Y6EA 1U9VA 4YYRA 3IMAA 2G8EA 1KHPA 5J94A 4XUIA 1X9YA 1QDQA 1NL6A 3RVVA 3HHAA 2FT2A 2DC7A 2DCAA 4BOSA 4OVZB 4ZUXU 1F29A 2BTWA 3PW3A 2FTDA 4WURA 3OISA 5A24A 1NB3A 2F7DA 3W31A 1S4VA 3OF8A 4G54A 1FH0A 1THEA 2VHFA 4IP3A 4BOZA 3IOQA 2BTWB 3TNXA 3ERVA 4QRXA 1YVBA 3W30A 4D8EA 2E00A 1PADA 1KFUL 3HWNA 2F1GA 1CSBB 1MHWA 2AS8A 1YALA 4WA6A 5EZSA 2AYOA 4I04A 1PXVA 1DKIA 3BWKA 2YJCA 2DOSA 3K8UA 4RF0A 4XZXA 4R3DA 2DC6A 1ZIVA 4BQVA 2NQDB 2J7QA 1M6DA 2PNSA 2YJBA 1O0EA 3CH3X 4K7CA 1EWOA 4BS5A 1F2AA 2DZYA 2R9NA 3F5VA 1AYUA 4W4UA 4D8BA 2FRQA 3PSEA 2G8JA 2XU1A 4BOQA 5EGWA 1AIMA 3IFUA 2AUZA 4OELA 1U9XA 3KFQA 4CZWA 3KWBX 4PP1A 5JZEA 1GMYA 1EF7A 4M0WA 1MS6A 1SNKA 1AU4A 2XU3A 2R9OA 4PT5A 3NHEA 5CHVA 1MEMA 1BP4A 3N3KA 4N79A 2AUXA 4P16A 3OVZA 2PBHA 1YK8A 4KLBA 2XU5A 2E03A 3PHUA 4PADA 5CHTA 3RNVA 4MI7A 3U8EA 2R9MA 2HH5A 3PT2A 1MIRA 5CVOB 4CDEB 3O1GA 4BSQA 2ACTA 3H8BA 3USVA 3B79A 3P5VA 1JQPA 2BDLA 3PRPA 4BPVA 2FUDA 2E02A 3LFYA 5E6JA 2C0YA 1NPZA 4XR7A 3I06A 1CB5A 3QJ3A 2DJGB 5EZQA 3KSEA 3WXGA 2HWKA 4RKXA 4D8IA 3IUTA 3F75A 3BOWA 3E1ZB 4HWYA 1U5IA 4FIPA 4N4ZA 1MDWA 3MORA 2HD5A 3C0RA 1PIPA 4X6JA 2G6DA 3CBJA 5EF4A 2FQ9A 1TLOA 2Z84A 5CVNB 3OVXA 1AU3A 2JQGR 5JH3A 4AXMA 2GFOA 3MP2A 3TRKA 3KWZA 1YT7A 3S3RA 2FE8A 1PPNA 1ATKA 1GECE 2R9FA 3GCBA 4BS6A 3P5XA 2AU1A 4ZTBA 2NQAA 2IPPB 4YVAA 2AIMA 3DF0A 4AXLA 3K9MA 1CVZA 3ZUAA 4GUAA 4IUMA 3BCNA 3PBHA 4YYVA 4YYSA 3HD3A 3V6EA 3H8CA 1CTEA 2PADA 1AU2A 3MTNA 1QMYA 1Y08A 3KX1A 4FK5A 3C9EA 1PPDA 1F2BA 5CVMA 2GHUA 3IEJA 1F2CA 2CIOA 1VJVA 3S3QA 3AI8A 1CQDA 3MHHA 1XKGA 3CH2X 1SP4B 2J7QC 2VHSA 3OQCA 3HHIA 3D6SA 1ICFA 2ARYA 1UKFA 1ME4A 4W5CA 4QH6A 3RVXA 1TL9A 3QSDA 1PPPA 1GCBA 4BOPA 3H7DA 4MM3B 3TMPA 3H89A 4YYWA 1POPA 2G7YA 1AYWA 1EWPA 2AVWA 4CDDB 1ZCMA 7PCKA 1YZBA 1DF0A 4A5UA 3PHWA 3BC3A 3H6SA 3ZNHA 3O0UA 1EWMA 2DCBA
chains in the Genus database with same CATH topology
3PHXA 3MTVA 1DKIA 3C0RA 2DOSA 2AGAA 2Z84A 4RF0A 4XZXA 3BY4A 3BBAA 4R3DA 2J7QA 3MP2A 3TRKA 4HXDB 2FE8A 4D8BA 4ZTBA 3MJ5A 3PSEA 3PRMA 4BOQA 2UZJA 3IFUA 4GUAA 4IUMA 5JZEA 2BU3A 3O65A 4M0WA 4REZA 4RF1A 4PT5A 4OW0A 2JRIA 1PVJA 4OVZA 2JTCA 3E9SA 4RKXA 4P16A 3BB7A 2J7QC 4BOUA 3OQCA 1UKFA 4RNAA 4BOSA 4OVZB 3PHUA 2BTWA 3RNVA 4BOPA 4MI7A 3PT2A 4WURA 3TMPA 4MM3B 3W31A 3B21A 3PRPA 4IP3A 4BOZA 1YZBA 2BTWB 4A5UA 5E6JA 5KO3A 3W30A 4D8EA 3PHWA 3ZNHA 5EZQA 2HWKA 5EZSA 4D8IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BOS A;  3ZNH A;  3PHX A;  3PHW A;  3PHU A;  3PRP A;  3PSE A;  4BOU A;  3PRM A;  4BOP A;  4BOZ A;  4BOQ A;  3BY4 A;  5JZE A;  3C0R A;  3PT2 A;  3TMP A;  4HXD B; 
#chains in the Genus database with same CATH topology
 3PHX A;  4W5B A;  3WXE A;  2R6N A;  4MSX A;  2XU4 A;  2DCC A;  3BY4 A;  1Y4H A;  4P6G A;  3BBA A;  1ME3 A;  2DC9 A;  2PRE A;  4HXD B;  2FRA A;  1K3B B;  1PPO A;  2P86 A;  2FYE A;  1A6R A;  1BY8 A;  1KFX L;  4MZS A;  4P6E A;  2O6X A;  2Y5B A;  2OZ2 A;  4I07 A;  5FPW A;  1CV8 A;  3MJ5 A;  1QOL A;  2JQF R;  2YJ9 A;  2UZJ A;  2DJF B;  5F02 A;  1GLO A;  1BQI A;  3OF9 A;  4OEM A;  1NLJ A;  5K16 A;  2IBI A;  3N3G A;  4PP2 E;  4X6H A;  4RF1 A;  1Q6K A;  4YV8 A;  4Q8G A;  2E01 A;  1KXR A;  3QT4 A;  1U9W A;  5JA7 A;  4OW0 A;  3M99 A;  1EWL A;  1KHQ A;  1PVJ A;  4CDF B;  2YJ2 A;  4PI3 A;  4Q8H A;  3E9S A;  3BB7 A;  4BOU A;  1NQC A;  1PE6 A;  4I05 A;  4N8W A;  1PBH A;  4RNA A;  1BGO A;  1ITO A;  1TU6 A;  3IHP A;  4DMX A;  1DEU A;  3PDF A;  4RY2 A;  3V6C A;  3B21 A;  3I3T A;  4QRG A;  1CS8 A;  1HUC B;  2FO5 A;  2P7U A;  3PNR A;  1PCI A;  5KO3 A;  3BPM A;  4YYU A;  2ATO A;  1AEC A;  3MTV A;  2OUL A;  3IV2 A;  2HHN A;  4QRV A;  1MEG A;  3N4C A;  1CJL A;  2OP3 A;  2AGA A;  4DMY A;  1STF E;  2B1N A;  9PAP A;  1YK7 A;  3BPF A;  3P5W A;  4QBB A;  4FJC A;  2B1M A;  8PCH A;  3K24 A;  3KKU A;  2HXZ A;  2WBF X;  3RVW A;  1U9Q X;  2DC8 A;  4MZO A;  1VSN A;  4YYQ A;  3PRM A;  3LXS A;  2R9C A;  1IWD A;  1AYV A;  2DZZ A;  1QXP A;  6PAD A;  3WXF A;  2P0R A;  4X6I A;  2BU3 A;  3O65 A;  2CB5 A;  3KW9 A;  2YJ8 A;  4REZ A;  2NQG A;  5PAD A;  2BDZ A;  4CDC B;  2AYN A;  3P5U A;  2JRI A;  2DCD A;  2NQI A;  1NB5 A;  3MHS A;  2H7J A;  3CBK A;  1AU0 A;  4OVZ A;  1CPJ A;  2JTC A;  2Y6E A;  1U9V A;  4YYR A;  3IMA A;  2G8E A;  1KHP A;  5J94 A;  4XUI A;  1X9Y A;  1QDQ A;  1NL6 A;  3RVV A;  3HHA A;  2FT2 A;  2DC7 A;  2DCA A;  4BOS A;  4OVZ B;  4ZUX U;  1F29 A;  2BTW A;  3PW3 A;  2FTD A;  4WUR A;  3OIS A;  5A24 A;  1NB3 A;  2F7D A;  3W31 A;  1S4V A;  3OF8 A;  4G54 A;  1FH0 A;  1THE A;  2VHF A;  4IP3 A;  4BOZ A;  3IOQ A;  2BTW B;  3TNX A;  3ERV A;  4QRX A;  1YVB A;  3W30 A;  4D8E A;  2E00 A;  1PAD A;  1KFU L;  3HWN A;  2F1G A;  1CSB B;  1MHW A;  2AS8 A;  1YAL A;  4WA6 A;  5EZS A;  2AYO A;  4I04 A;  1PXV A;  1DKI A;  3BWK A;  2YJC A;  2DOS A;  3K8U A;  4RF0 A;  4XZX A;  4R3D A;  2DC6 A;  1ZIV A;  4BQV A;  2NQD B;  2J7Q A;  1M6D A;  2PNS A;  2YJB A;  1O0E A;  3CH3 X;  4K7C A;  1EWO A;  4BS5 A;  1F2A A;  2DZY A;  2R9N A;  3F5V A;  1AYU A;  4W4U A;  4D8B A;  2FRQ A;  3PSE A;  2G8J A;  2XU1 A;  4BOQ A;  5EGW A;  1AIM A;  3IFU A;  2AUZ A;  4OEL A;  1U9X A;  3KFQ A;  4CZW A;  3KWB X;  4PP1 A;  5JZE A;  1GMY A;  1EF7 A;  4M0W A;  1MS6 A;  1SNK A;  1AU4 A;  2XU3 A;  2R9O A;  4PT5 A;  3NHE A;  5CHV A;  1MEM A;  1BP4 A;  3N3K A;  4N79 A;  2AUX A;  4P16 A;  3OVZ A;  2PBH A;  1YK8 A;  4KLB A;  2XU5 A;  2E03 A;  3PHU A;  4PAD A;  5CHT A;  3RNV A;  4MI7 A;  3U8E A;  2R9M A;  2HH5 A;  3PT2 A;  1MIR A;  5CVO B;  4CDE B;  3O1G A;  4BSQ A;  2ACT A;  3H8B A;  3USV A;  3B79 A;  3P5V A;  1JQP A;  2BDL A;  3PRP A;  4BPV A;  2FUD A;  2E02 A;  3LFY A;  5E6J A;  2C0Y A;  1NPZ A;  4XR7 A;  3I06 A;  1CB5 A;  3QJ3 A;  2DJG B;  5EZQ A;  3KSE A;  3WXG A;  2HWK A;  4RKX A;  4D8I A;  3IUT A;  3F75 A;  3BOW A;  3E1Z B;  4HWY A;  1U5I A;  4FIP A;  4N4Z A;  1MDW A;  3MOR A;  2HD5 A;  3C0R A;  1PIP A;  4X6J A;  2G6D A;  3CBJ A;  5EF4 A;  2FQ9 A;  1TLO A;  2Z84 A;  5CVN B;  3OVX A;  1AU3 A;  2JQG R;  5JH3 A;  4AXM A;  2GFO A;  3MP2 A;  3TRK A;  3KWZ A;  1YT7 A;  3S3R A;  2FE8 A;  1PPN A;  1ATK A;  1GEC E;  2R9F A;  3GCB A;  4BS6 A;  3P5X A;  2AU1 A;  4ZTB A;  2NQA A;  2IPP B;  4YVA A;  2AIM A;  3DF0 A;  4AXL A;  3K9M A;  1CVZ A;  3ZUA A;  4GUA A;  4IUM A;  3BCN A;  3PBH A;  4YYV A;  4YYS A;  3HD3 A;  3V6E A;  3H8C A;  1CTE A;  2PAD A;  1AU2 A;  3MTN A;  1QMY A;  1Y08 A;  3KX1 A;  4FK5 A;  3C9E A;  1PPD A;  1F2B A;  5CVM A;  2GHU A;  3IEJ A;  1F2C A;  2CIO A;  1VJV A;  3S3Q A;  3AI8 A;  1CQD A;  3MHH A;  1XKG A;  3CH2 X;  1SP4 B;  2J7Q C;  2VHS A;  3OQC A;  3HHI A;  3D6S A;  1ICF A;  2ARY A;  1UKF A;  1ME4 A;  4W5C A;  4QH6 A;  3RVX A;  1TL9 A;  3QSD A;  1PPP A;  1GCB A;  4BOP A;  3H7D A;  4MM3 B;  3TMP A;  3H89 A;  4YYW A;  1POP A;  2G7Y A;  1AYW A;  1EWP A;  2AVW A;  4CDD B;  1ZCM A;  7PCK A;  1YZB A;  1DF0 A;  4A5U A;  3PHW A;  3BC3 A;  3H6S A;  3ZNH A;  3O0U A;  1EWM A;  2DCB A; 
#chains in the Genus database with same CATH homology
 3PHX A;  3MTV A;  1DKI A;  3C0R A;  2DOS A;  2AGA A;  2Z84 A;  4RF0 A;  4XZX A;  3BY4 A;  3BBA A;  4R3D A;  2J7Q A;  3MP2 A;  3TRK A;  4HXD B;  2FE8 A;  4D8B A;  4ZTB A;  3MJ5 A;  3PSE A;  3PRM A;  4BOQ A;  2UZJ A;  3IFU A;  4GUA A;  4IUM A;  5JZE A;  2BU3 A;  3O65 A;  4M0W A;  4REZ A;  4RF1 A;  4PT5 A;  4OW0 A;  2JRI A;  1PVJ A;  4OVZ A;  2JTC A;  3E9S A;  4RKX A;  4P16 A;  3BB7 A;  2J7Q C;  4BOU A;  3OQC A;  1UKF A;  4RNA A;  4BOS A;  4OVZ B;  3PHU A;  2BTW A;  3RNV A;  4BOP A;  4MI7 A;  3PT2 A;  4WUR A;  3TMP A;  4MM3 B;  3W31 A;  3B21 A;  3PRP A;  4IP3 A;  4BOZ A;  1YZB A;  2BTW B;  4A5U A;  5E6J A;  5KO3 A;  3W30 A;  4D8E A;  3PHW A;  3ZNH A;  5EZQ A;  2HWK A;  5EZS A;  4D8I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...