3ZNHA

Crimean congo hemorrhagic fever virus otu domain in complex with ubiquitin-propargyl.
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
155
structure length
153
Chain Sequence
LDWTQVIAGQYVSNPRFNISDYFEIVRQPGDGNCFYHSIAELTMPNKTDHSYHYIKRLTESAARKYYQEEPEARLVGLSLEDYLKRMLSDNEWGSTLEASMLAKEMGITIIIWTVADEVEAGIKFGDGDVFTAVNLLHSGQTHFDALRILPQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/signaling protein
molecule keywords UBIQUITIN THIOESTERASE
publication title On Terminal Alkynes that Can React with Active-Site Cysteine Nucleophiles in Proteases.
pubmed doi rcsb
source organism Crimean-congo hemorrhagic fever virus
total genus 45
structure length 153
sequence length 155
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2013-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02338 OTU OTU-like cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.80 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 3znhA00
3PHUA 4HXDB 3BY4A 5JZEA 3C0RA 3TMPA 3PHXA 4BOUA 4BOZA 3PRPA 3PRMA 3PHWA 3PT2A 3PSEA 3ZNHA 4BOSA 4BOPA 4BOQA
chains in the Genus database with same CATH superfamily
2JRIA 8PCHA 1YK7A 3B79A 3WXFA 1POPA 1MEMA 4D8EA 3QT4A 2Y5BA 4P16A 4N8WA 2HD5A 3PHXA 3O0UA 2CB5A 1ITOA 1PADA 3C9EA 2CIOA 3QSDA 2AS8A 2PBHA 3PRMA 1NB5A 2DCCA 2NQAA 2R9CA 4BSQA 3N4CA 4QRXA 3HHAA 1AYWA 3LFYA 1GMYA 1CS8A 2G8EA 1U9XA 3S3QA 2YJ2A 2FTDA 3PHWA 1AU3A 1GLOA 1F2BA 5JA7A 1BGOA 4RF0A 4BOUA 2DJGB 4BOSA 4YYWA 2HXZA 2NQIA 2BDZA 1PCIA 4QRGA 2FT2A 4WA6A 3W30A 1TLOA 2HHNA 1PIPA 5EF4A 3S3RA 1CB5A 2R6NA 1QOLA 3BPMA 4MSXA 2XU3A 4ZUXU 4YYSA 1CVZA 1ME4A 1KFUL 3P5WA 3PHUA 4HXDB 4DMXA 3BPFA 1EWLA 3PT2A 1NB3A 1BQIA 1YVBA 2VHSA 3PSEA 5CVOB 3QJ3A 2P86A 2AU1A 2XU4A 4CDEB 4I07A 1AU0A 3N3KA 3ZNHA 9PAPA 4CDDB 2AIMA 2DC8A 3LXSA 4QBBA 1X9YA 2R9OA 4R3DA 4AXMA 4CDFB 4PP2E 5CHTA 2R9NA 5PADA 4BS6A 1PVJA 3V6CA 2OP3A 3OISA 1AU4A 1PE6A 5CVMA 2H7JA 2DC9A 2E01A 2JQFR 4FIPA 1AECA 5J94A 3KX1A 2DZZA 5A24A 5JH3A 1MS6A 2DC6A 3MTNA 4OVZB 3O65A 2FE8A 3P5XA 2P0RA 3P5UA 1FH0A 1ME3A 1KHPA 4ZTBA 3BOWA 3OQCA 3TRKA 3MTVA 1M6DA 5JZEA 2PADA 1EWOA 3CBJA 2J7QA 1AYUA 5F02A 2YJCA 2BDLA 4N4ZA 3ERVA 1F2AA 4QRVA 4XR7A 4I05A 1GECE 2JTCA 3WXEA 3O1GA 1KHQA 3HHIA 1QDQA 3USVA 1STFE 4M0WA 4YYUA 4W4UA 3IOQA 2NQGA 2OULA 1EWPA 2F7DA 1CV8A 2DZYA 3AI8A 4BOPA 3KWZA 4YYQA 3B21A 2E00A 3BB7A 4MZOA 1F2CA 1NPZA 4BS5A 4D8BA 1VSNA 4IP3A 3OF8A 3IFUA 1U9VA 2ARYA 4IUMA 4BOZA 2OZ2A 2YJ8A 4N79A 2J7QC 1CJLA 3IUTA 2AGAA 4GUAA 1U9WA 5CVNB 2E02A 3MHHA 3BCNA 1VJVA 4DMYA 2FRQA 2DCDA 4AXLA 4FJCA 3IMAA 1CPJA 4YV8A 3RNVA 2G6DA 4MM3B 4CZWA 2AUXA 3CH2X 2O6XA 2G7YA 1S4VA 2DCBA 2R9FA 4OVZA 1CQDA 2GFOA 2AYNA 3PW3A 4P6GA 2BTWB 2YJ9A 2FUDA 2FQ9A 2F1GA 4RNAA 2Y6EA 5E6JA 2FRAA 3MORA 1TU6A 1PPNA 1YK8A 3E9SA 3PNRA 3PBHA 1YT7A 3N3GA 2IBIA 7PCKA 5EZSA 3CH3X 2DCAA 3RVVA 4D8IA 3HD3A 2WBFX 1SNKA 1QXPA 3HWNA 1NLJA 2ACTA 2E03A 4CDCB 2IPPB 1MEGA 4YYVA 2YJBA 5K16A 3H6SA 1HUCB 1JQPA 1U9QX 3W31A 1TL9A 3RVXA 1SP4B 3F5VA 1DKIA 2VHFA 4FK5A 3PRPA 1YZBA 4W5CA 4A5UA 3NHEA 2DJFB 1ATKA 3KFQA 4RF1A 1UKFA 3H8BA 3I3TA 5EZQA 2JQGR 2PREA 3MHSA 3MP2A 2ATOA 3I06A 3M99A 4YYRA 1PPOA 2PNSA 5KO3A 1XKGA 4G54A 1A6RA 3K24A 6PADA 2BTWA 4OELA 4OW0A 1PXVA 2DC7A 3F75A 1NL6A 1AIMA 4PI3A 1MIRA 1PPPA 3U8EA 4HWYA 4BPVA 4MI7A 4WURA 2AUZA 4BQVA 2B1MA 4PP1A 3MJ5A 1DF0A 1GCBA 3K8UA 3IV2A 3RVWA 1PBHA 3ZUAA 3D6SA 2NQDB 3DF0A 3E1ZB 2FO5A 2C0YA 1DEUA 2FYEA 1K3BB 4RKXA 3BY4A 1IWDA 3KKUA 3TMPA 1YALA 3H7DA 2UZJA 3OVZA 3OVXA 1AYVA 1ZIVA 1EF7A 5FPWA 4REZA 4MZSA 3P5VA 4OEMA 1ICFA 3PDFA 1THEA 4XZXA 1AU2A 2HWKA 1BP4A 3IHPA 3V6EA 2Z84A 4W5BA 1KFXL 4PADA 4BOQA 4P6EA 1ZCMA 1Q6KA 4X6IA 1KXRA 5EGWA 2AYOA 1NQCA 4Q8GA 3H89A 4X6JA 1EWMA 1CTEA 1Y4HA 1MHWA 3IEJA 3BC3A 4QH6A 3KW9A 3TNXA 1MDWA 4X6HA 1QMYA 4K7CA 1PPDA 2DOSA 3H8CA 2B1NA 1Y08A 2BU3A 3K9MA 4YVAA 2XU5A 1F29A 3BBAA 2G8JA 2R9MA 2P7UA 3KWBX 1O0EA 1U5IA 4I04A 3C0RA 2GHUA 2XU1A 4XUIA 4RY2A 2AVWA 4Q8HA 3CBKA 4PT5A 5CHVA 1BY8A 3OF9A 4KLBA 3KSEA 3BWKA 3WXGA 2HH5A 1CSBB 3GCBA
chains in the Genus database with same CATH topology
2JRIA 1PVJA 3MJ5A 4OVZA 4D8EA 4P16A 3PHXA 2BTWB 4RKXA 3BY4A 4RNAA 3TMPA 5E6JA 3E9SA 2UZJA 3PRMA 5EZSA 4REZA 4D8IA 4OVZB 3O65A 2FE8A 4XZXA 2HWKA 2Z84A 4ZTBA 3PHWA 3OQCA 3TRKA 3MTVA 4BOQA 5JZEA 2J7QA 4RF0A 4BOUA 4BOSA 3W31A 1DKIA 2JTCA 3W30A 3PRPA 4M0WA 1YZBA 2DOSA 4A5UA 2BU3A 4RF1A 1UKFA 4BOPA 3PHUA 4HXDB 5EZQA 3B21A 3BB7A 3MP2A 3PT2A 3PSEA 3BBAA 5KO3A 4D8BA 4IP3A 3ZNHA 3IFUA 3C0RA 2BTWA 4IUMA 4OW0A 4BOZA 2J7QC 4PT5A 2AGAA 4GUAA 4R3DA 4MI7A 4WURA 3RNVA 4MM3B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PHU A;  4HXD B;  3BY4 A;  5JZE A;  3C0R A;  3TMP A;  3PHX A;  4BOU A;  4BOZ A;  3PRP A;  3PRM A;  3PHW A;  3PT2 A;  3PSE A;  3ZNH A;  4BOS A;  4BOP A;  4BOQ A; 
#chains in the Genus database with same CATH topology
 2JRI A;  8PCH A;  1YK7 A;  3B79 A;  3WXF A;  1POP A;  1MEM A;  4D8E A;  3QT4 A;  2Y5B A;  4P16 A;  4N8W A;  2HD5 A;  3PHX A;  3O0U A;  2CB5 A;  1ITO A;  1PAD A;  3C9E A;  2CIO A;  3QSD A;  2AS8 A;  2PBH A;  3PRM A;  1NB5 A;  2DCC A;  2NQA A;  2R9C A;  4BSQ A;  3N4C A;  4QRX A;  3HHA A;  1AYW A;  3LFY A;  1GMY A;  1CS8 A;  2G8E A;  1U9X A;  3S3Q A;  2YJ2 A;  2FTD A;  3PHW A;  1AU3 A;  1GLO A;  1F2B A;  5JA7 A;  1BGO A;  4RF0 A;  4BOU A;  2DJG B;  4BOS A;  4YYW A;  2HXZ A;  2NQI A;  2BDZ A;  1PCI A;  4QRG A;  2FT2 A;  4WA6 A;  3W30 A;  1TLO A;  2HHN A;  1PIP A;  5EF4 A;  3S3R A;  1CB5 A;  2R6N A;  1QOL A;  3BPM A;  4MSX A;  2XU3 A;  4ZUX U;  4YYS A;  1CVZ A;  1ME4 A;  1KFU L;  3P5W A;  3PHU A;  4HXD B;  4DMX A;  3BPF A;  1EWL A;  3PT2 A;  1NB3 A;  1BQI A;  1YVB A;  2VHS A;  3PSE A;  5CVO B;  3QJ3 A;  2P86 A;  2AU1 A;  2XU4 A;  4CDE B;  4I07 A;  1AU0 A;  3N3K A;  3ZNH A;  9PAP A;  4CDD B;  2AIM A;  2DC8 A;  3LXS A;  4QBB A;  1X9Y A;  2R9O A;  4R3D A;  4AXM A;  4CDF B;  4PP2 E;  5CHT A;  2R9N A;  5PAD A;  4BS6 A;  1PVJ A;  3V6C A;  2OP3 A;  3OIS A;  1AU4 A;  1PE6 A;  5CVM A;  2H7J A;  2DC9 A;  2E01 A;  2JQF R;  4FIP A;  1AEC A;  5J94 A;  3KX1 A;  2DZZ A;  5A24 A;  5JH3 A;  1MS6 A;  2DC6 A;  3MTN A;  4OVZ B;  3O65 A;  2FE8 A;  3P5X A;  2P0R A;  3P5U A;  1FH0 A;  1ME3 A;  1KHP A;  4ZTB A;  3BOW A;  3OQC A;  3TRK A;  3MTV A;  1M6D A;  5JZE A;  2PAD A;  1EWO A;  3CBJ A;  2J7Q A;  1AYU A;  5F02 A;  2YJC A;  2BDL A;  4N4Z A;  3ERV A;  1F2A A;  4QRV A;  4XR7 A;  4I05 A;  1GEC E;  2JTC A;  3WXE A;  3O1G A;  1KHQ A;  3HHI A;  1QDQ A;  3USV A;  1STF E;  4M0W A;  4YYU A;  4W4U A;  3IOQ A;  2NQG A;  2OUL A;  1EWP A;  2F7D A;  1CV8 A;  2DZY A;  3AI8 A;  4BOP A;  3KWZ A;  4YYQ A;  3B21 A;  2E00 A;  3BB7 A;  4MZO A;  1F2C A;  1NPZ A;  4BS5 A;  4D8B A;  1VSN A;  4IP3 A;  3OF8 A;  3IFU A;  1U9V A;  2ARY A;  4IUM A;  4BOZ A;  2OZ2 A;  2YJ8 A;  4N79 A;  2J7Q C;  1CJL A;  3IUT A;  2AGA A;  4GUA A;  1U9W A;  5CVN B;  2E02 A;  3MHH A;  3BCN A;  1VJV A;  4DMY A;  2FRQ A;  2DCD A;  4AXL A;  4FJC A;  3IMA A;  1CPJ A;  4YV8 A;  3RNV A;  2G6D A;  4MM3 B;  4CZW A;  2AUX A;  3CH2 X;  2O6X A;  2G7Y A;  1S4V A;  2DCB A;  2R9F A;  4OVZ A;  1CQD A;  2GFO A;  2AYN A;  3PW3 A;  4P6G A;  2BTW B;  2YJ9 A;  2FUD A;  2FQ9 A;  2F1G A;  4RNA A;  2Y6E A;  5E6J A;  2FRA A;  3MOR A;  1TU6 A;  1PPN A;  1YK8 A;  3E9S A;  3PNR A;  3PBH A;  1YT7 A;  3N3G A;  2IBI A;  7PCK A;  5EZS A;  3CH3 X;  2DCA A;  3RVV A;  4D8I A;  3HD3 A;  2WBF X;  1SNK A;  1QXP A;  3HWN A;  1NLJ A;  2ACT A;  2E03 A;  4CDC B;  2IPP B;  1MEG A;  4YYV A;  2YJB A;  5K16 A;  3H6S A;  1HUC B;  1JQP A;  1U9Q X;  3W31 A;  1TL9 A;  3RVX A;  1SP4 B;  3F5V A;  1DKI A;  2VHF A;  4FK5 A;  3PRP A;  1YZB A;  4W5C A;  4A5U A;  3NHE A;  2DJF B;  1ATK A;  3KFQ A;  4RF1 A;  1UKF A;  3H8B A;  3I3T A;  5EZQ A;  2JQG R;  2PRE A;  3MHS A;  3MP2 A;  2ATO A;  3I06 A;  3M99 A;  4YYR A;  1PPO A;  2PNS A;  5KO3 A;  1XKG A;  4G54 A;  1A6R A;  3K24 A;  6PAD A;  2BTW A;  4OEL A;  4OW0 A;  1PXV A;  2DC7 A;  3F75 A;  1NL6 A;  1AIM A;  4PI3 A;  1MIR A;  1PPP A;  3U8E A;  4HWY A;  4BPV A;  4MI7 A;  4WUR A;  2AUZ A;  4BQV A;  2B1M A;  4PP1 A;  3MJ5 A;  1DF0 A;  1GCB A;  3K8U A;  3IV2 A;  3RVW A;  1PBH A;  3ZUA A;  3D6S A;  2NQD B;  3DF0 A;  3E1Z B;  2FO5 A;  2C0Y A;  1DEU A;  2FYE A;  1K3B B;  4RKX A;  3BY4 A;  1IWD A;  3KKU A;  3TMP A;  1YAL A;  3H7D A;  2UZJ A;  3OVZ A;  3OVX A;  1AYV A;  1ZIV A;  1EF7 A;  5FPW A;  4REZ A;  4MZS A;  3P5V A;  4OEM A;  1ICF A;  3PDF A;  1THE A;  4XZX A;  1AU2 A;  2HWK A;  1BP4 A;  3IHP A;  3V6E A;  2Z84 A;  4W5B A;  1KFX L;  4PAD A;  4BOQ A;  4P6E A;  1ZCM A;  1Q6K A;  4X6I A;  1KXR A;  5EGW A;  2AYO A;  1NQC A;  4Q8G A;  3H89 A;  4X6J A;  1EWM A;  1CTE A;  1Y4H A;  1MHW A;  3IEJ A;  3BC3 A;  4QH6 A;  3KW9 A;  3TNX A;  1MDW A;  4X6H A;  1QMY A;  4K7C A;  1PPD A;  2DOS A;  3H8C A;  2B1N A;  1Y08 A;  2BU3 A;  3K9M A;  4YVA A;  2XU5 A;  1F29 A;  3BBA A;  2G8J A;  2R9M A;  2P7U A;  3KWB X;  1O0E A;  1U5I A;  4I04 A;  3C0R A;  2GHU A;  2XU1 A;  4XUI A;  4RY2 A;  2AVW A;  4Q8H A;  3CBK A;  4PT5 A;  5CHV A;  1BY8 A;  3OF9 A;  4KLB A;  3KSE A;  3BWK A;  3WXG A;  2HH5 A;  1CSB B;  3GCB A; 
#chains in the Genus database with same CATH homology
 2JRI A;  1PVJ A;  3MJ5 A;  4OVZ A;  4D8E A;  4P16 A;  3PHX A;  2BTW B;  4RKX A;  3BY4 A;  4RNA A;  3TMP A;  5E6J A;  3E9S A;  2UZJ A;  3PRM A;  5EZS A;  4REZ A;  4D8I A;  4OVZ B;  3O65 A;  2FE8 A;  4XZX A;  2HWK A;  2Z84 A;  4ZTB A;  3PHW A;  3OQC A;  3TRK A;  3MTV A;  4BOQ A;  5JZE A;  2J7Q A;  4RF0 A;  4BOU A;  4BOS A;  3W31 A;  1DKI A;  2JTC A;  3W30 A;  3PRP A;  4M0W A;  1YZB A;  2DOS A;  4A5U A;  2BU3 A;  4RF1 A;  1UKF A;  4BOP A;  3PHU A;  4HXD B;  5EZQ A;  3B21 A;  3BB7 A;  3MP2 A;  3PT2 A;  3PSE A;  3BBA A;  5KO3 A;  4D8B A;  4IP3 A;  3ZNH A;  3IFU A;  3C0R A;  2BTW A;  4IUM A;  4OW0 A;  4BOZ A;  2J7Q C;  4PT5 A;  2AGA A;  4GUA A;  4R3D A;  4MI7 A;  4WUR A;  3RNV A;  4MM3 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...