3BWKA

Crystal structure of falcipain-3 with its inhibitor, k11017
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
242
structure length
242
Chain Sequence
YEANYEDVIKKYKPADAKLDRIAYDWRLHGGVTPVKDQALCGSCWAFSSVGSVESQYAIRKKALFLFSEQELVDCSVKNNGCYGGYITNAFDDMIDLGGLCSQDDYPYVSNLPETCNLKRCNERYTIKSYVSIPDDKFKEALRYLGPISISIAASDDFAFYRGGFYDGECGAAPNHAVILVGYGMKDIYNEDTGRMEKFYYYIIKNSWGSDWGEGGYINLETDENGYKKTCSIGTEAYVPLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Vinyl sulfones as antiparasitic agents and a structural basis for drug design.
pubmed doi rcsb
molecule keywords Cysteine protease falcipain-3
molecule tags Hydrolase
total genus 69
structure length 242
sequence length 242
chains with identical sequence B, C, D
ec nomenclature ec 3.4.22.-:
pdb deposition date 2008-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3bwkA00
3BPMA 2E03A 3S3RA 4BS5A 3C9EA 4MZSA 3BPFA 1S4VA 4Q8GA 3HWNA 3O0UA 1A6RA 2G6DA 4OELA 1ICFA 4I07A 1KXRA 3LFYA 2OULA 4YYSA 2F7DA 3PNRA 5PADA 1ATKA 2FYEA 3KFQA 1F29A 3V6CA 3KW9A 2B1MA 2OZ2A 2HXZA 1EWMA 2BDZA 1JQPA 2JQGR 1EF7A 1BGOA 1YALA 3KSEA 4CDCB 1CQDA 4Q8HA 3O1GA 3ERVA 2Y5BA 2FT2A 1ME4A 1PBHA 4N79A 1TL9A 3OF8A 4CDDB 1NL6A 1EWLA 3PDFA 3IOQA 3RVWA 5JH3A 4ZUXU 1NQCA 1AU0A 2DCBA 3QSDA 1PPDA 2YJ8A 1BQIA 3QJ3A 5A24A 1U5IA 1CV8A 3S3QA 1BP4A 3U8EA 3MHHA 4CZWA 2FUDA 4PI3A 4YVAA 2NQIA 3ZUAA 3M99A 4QRGA 1F2BA 1U9WA 3F75A 1U9VA 3CBJA 1CS8A 2NQGA 4XR7A 1F2AA 1KFUL 4K7CA 4MZOA 2H7JA 4BSQA 4I05A 4PP2E 1MS6A 2DC9A 3H89A 2AIMA 2PADA 2FRAA 2DC6A 2JQFR 3F5VA 2G8EA 1YK8A 3K8UA 1TLOA 3PBHA 4AXLA 4X6IA 4N4ZA 3N3KA 1GCBA 1IWDA 2IPPB 1NB3A 1QOLA 3MORA 3KWZA 1ITOA 2VHSA 2AU1A 2XU5A 1Q6KA 2R9NA 2DJFB 2XU1A 1MHWA 4YV8A 3WXGA 2PNSA 1STFE 2XU3A 3HD3A 3E1ZB 1MDWA 1QDQA 2B1NA 4DMYA 3P5WA 7PCKA 1AIMA 2DCDA 2PREA 8PCHA 3IMAA 1GMYA 2G8JA 2R9MA 4WA6A 2O6XA 3AI8A 1PXVA 2DC8A 1NB5A 3WXFA 3KWBX 4HWYA 1CVZA 5K16A 2GHUA 1O0EA 1AU4A 1U9XA 3P5XA 3QT4A 3BC3A 1AYWA 3MTNA 2AYOA 1NLJA 4QRVA 1POPA 3WXEA 5CHTA 2R9FA 3B79A 5EF4A 2HD5A 4XUIA 3IHPA 4BS6A 1U9QX 2FQ9A 3USVA 2P86A 4PP1A 2AVWA 1SP4B 4YYVA 2FRQA 4BPVA 1DF0A 1Y4HA 2G7YA 4X6JA 1X9YA 3CH3X 3OF9A 1AU3A 3BOWA 5CVOB 5CHVA 1YT7A 3HHIA 5FPWA 5CVMA 1SNKA 3TNXA 2AYNA 1PCIA 2GFOA 1PE6A 3KKUA 4YYWA 3BWKA 2PBHA 2CB5A 4QRXA 3RVXA 5F02A 1CJLA 2VHFA 3LXSA 1GECE 1FH0A 4FJCA 4X6HA 4DMXA 1BY8A 5JA7A 2DZYA 3P5UA 1ZCMA 1KHQA 3DF0A 3IUTA 3N4CA 2ATOA 3K9MA 4MSXA 1QXPA 2DZZA 1AU2A 2F1GA 5EGWA 3IEJA 1CSBB 1PADA 4G54A 2R6NA 1TU6A 3I06A 4PADA 2YJBA 4W4UA 9PAPA 4I04A 2HHNA 2FO5A 1PPPA 1PPNA 4KLBA 3D6SA 2AS8A 1CPJA 1MEGA 4W5CA 2DCCA 3CBKA 1AYUA 2Y6EA 3NHEA 2HH5A 2DJGB 1GLOA 1YVBA 3OVXA 1THEA 2IBIA 1EWOA 2AUXA 1Y08A 1VJVA 4N8WA 4QH6A 1CTEA 1F2CA 5CVNB 3H8BA 1K3BB 1AECA 3OISA 4AXMA 4YYQA 4BQVA 2ACTA 1NPZA 1VSNA 2P7UA 3K24A 4P6GA 2BDLA 1ME3A 4RY2A 3CH2X 1XKGA 2NQDB 2WBFX 3OVZA 1AYVA 1MIRA 4YYRA 2C0YA 3IV2A 1KHPA 1DEUA 2R9CA 4CDFB 1KFXL 3P5VA 3BCNA 4CDEB 1EWPA 1ZIVA 4OEMA 2E01A 2OP3A 4W5BA 2YJ2A 2XU4A 2AUZA 3H6SA 1YK7A 3HHAA 3N3GA 2CIOA 4FK5A 3H7DA 2ARYA 5J94A 1PIPA 1PPOA 4FIPA 3PW3A 1QMYA 2NQAA 3H8CA 3V6EA 2DC7A 2YJCA 3KX1A 6PADA 2E00A 2FTDA 2DCAA 3GCBA 3RVVA 2P0RA 2E02A 1MEMA 4QBBA 4YYUA 3I3TA 4P6EA 1CB5A 2R9OA 1HUCB 3MHSA 2YJ9A 1M6DA
chains in the Genus database with same CATH superfamily
3BPMA 2E03A 3S3RA 4BS5A 3MJ5A 3C9EA 4MZSA 3BPFA 1S4VA 4Q8GA 3HWNA 3O0UA 1A6RA 2G6DA 4OELA 1ICFA 4I07A 1KXRA 3LFYA 2OULA 4YYSA 2F7DA 3PRPA 2DOSA 3PNRA 2HWKA 3PSEA 5PADA 1ATKA 3E9SA 2FYEA 4OVZB 1PVJA 3KFQA 1F29A 3V6CA 3KW9A 4IUMA 2B1MA 2OZ2A 2HXZA 1EWMA 2BDZA 4IP3A 1JQPA 2JQGR 1EF7A 1BGOA 1YALA 3KSEA 4CDCB 4D8EA 1CQDA 4Q8HA 4BOZA 3O1GA 3ERVA 2Y5BA 2FT2A 1ME4A 1PBHA 4N79A 1TL9A 3OF8A 4CDDB 5JZEA 1NL6A 1EWLA 3PDFA 3IOQA 4WURA 3RVWA 5JH3A 4ZUXU 1NQCA 1AU0A 2DCBA 3QSDA 1PPDA 2YJ8A 1BQIA 3QJ3A 5A24A 1U5IA 1CV8A 3S3QA 1BP4A 3U8EA 3MHHA 4CZWA 2FUDA 4PI3A 4YVAA 4RF1A 2NQIA 4MI7A 3ZUAA 3M99A 4QRGA 1F2BA 1U9WA 3F75A 1U9VA 3CBJA 2JTCA 1CS8A 2NQGA 4XR7A 1F2AA 1KFUL 4K7CA 4MZOA 2H7JA 4BSQA 4I05A 4PP2E 1MS6A 2DC9A 3H89A 2AIMA 2PADA 2FRAA 2DC6A 4GUAA 2JQFR 3F5VA 2G8EA 1YK8A 3K8UA 1TLOA 3PBHA 3OQCA 2Z84A 4AXLA 4X6IA 4N4ZA 3N3KA 1GCBA 1IWDA 2IPPB 4MM3B 1NB3A 1QOLA 4P16A 3MORA 3KWZA 1ITOA 2BTWA 2VHSA 2AU1A 2XU5A 3W31A 5E6JA 3PHXA 1Q6KA 2R9NA 2DJFB 2XU1A 1MHWA 4YV8A 3WXGA 2PNSA 1STFE 2XU3A 3HD3A 3E1ZB 1MDWA 1QDQA 2B1NA 4DMYA 3P5WA 7PCKA 1AIMA 4M0WA 2DCDA 2PREA 8PCHA 3IMAA 1GMYA 2G8JA 2R9MA 4WA6A 2O6XA 3AI8A 1PXVA 2DC8A 1NB5A 3WXFA 3KWBX 4BOSA 4HWYA 1CVZA 5K16A 2GHUA 1O0EA 1AU4A 1U9XA 3P5XA 4A5UA 3QT4A 3TMPA 3BC3A 1AYWA 4PT5A 3MTNA 2AYOA 1NLJA 4QRVA 1POPA 3WXEA 5CHTA 4BOQA 2R9FA 3B79A 5EF4A 2BU3A 2HD5A 5EZSA 4XUIA 3IHPA 4BS6A 1U9QX 2FQ9A 4BOUA 3USVA 2P86A 4PP1A 5KO3A 3PT2A 2AVWA 1SP4B 4YYVA 2FRQA 3PHUA 4BPVA 1DF0A 1Y4HA 3MP2A 2G7YA 3ZNHA 3PRMA 4X6JA 3C0RA 1X9YA 3CH3X 3OF9A 1AU3A 3BOWA 3PHWA 5CVOB 5CHVA 1YT7A 3HHIA 5FPWA 5CVMA 1SNKA 3TNXA 2AYNA 1PCIA 2GFOA 1PE6A 2BTWB 3KKUA 4YYWA 3BWKA 2PBHA 2CB5A 4R3DA 4QRXA 3RVXA 5F02A 1CJLA 2VHFA 3LXSA 1GECE 1FH0A 4FJCA 2UZJA 4X6HA 4DMXA 1BY8A 2AGAA 5JA7A 2DZYA 3P5UA 1ZCMA 1KHQA 3DF0A 3IUTA 3N4CA 2ATOA 3K9MA 4MSXA 1QXPA 2DZZA 1AU2A 2F1GA 5EGWA 3IEJA 3TRKA 1CSBB 1PADA 4G54A 4D8BA 2R6NA 1TU6A 3I06A 4PADA 2FE8A 2YJBA 4OW0A 4W4UA 9PAPA 4I04A 2HHNA 2FO5A 4BOPA 1PPPA 1PPNA 4KLBA 3D6SA 4ZTBA 3BB7A 2AS8A 1CPJA 1MEGA 4W5CA 2DCCA 3CBKA 1AYUA 2Y6EA 3NHEA 3BY4A 2HH5A 2DJGB 1GLOA 4RKXA 1YVBA 3OVXA 1THEA 2IBIA 2J7QA 1EWOA 2AUXA 1Y08A 1VJVA 4N8WA 4QH6A 1CTEA 1F2CA 5CVNB 3H8BA 1K3BB 1AECA 3OISA 4AXMA 4YYQA 4BQVA 2ACTA 1NPZA 3MTVA 1VSNA 2P7UA 3K24A 4P6GA 4XZXA 2BDLA 4RF0A 1ME3A 4RY2A 3CH2X 1XKGA 2NQDB 2WBFX 4OVZA 3OVZA 1DKIA 1AYVA 3RNVA 1MIRA 4YYRA 2C0YA 3IV2A 1KHPA 1DEUA 2R9CA 4CDFB 1KFXL 3P5VA 1YZBA 3W30A 4RNAA 3BCNA 4CDEB 1EWPA 1ZIVA 4OEMA 2E01A 3BBAA 2OP3A 4W5BA 2YJ2A 2XU4A 2AUZA 3H6SA 1YK7A 2JRIA 3HHAA 3N3GA 2CIOA 4FK5A 3H7DA 2ARYA 5J94A 1PIPA 1PPOA 3B21A 4FIPA 3PW3A 1QMYA 3O65A 4REZA 2NQAA 3H8CA 3V6EA 5EZQA 2DC7A 2YJCA 2J7QC 3KX1A 6PADA 2E00A 4D8IA 4HXDB 2FTDA 2DCAA 3GCBA 3RVVA 2P0RA 3IFUA 2E02A 1MEMA 4QBBA 4YYUA 3I3TA 4P6EA 1CB5A 2R9OA 1HUCB 3MHSA 1UKFA 2YJ9A 1M6DA
chains in the Genus database with same CATH topology
3BPMA 1GX3A 2E03A 3S3RA 4BS5A 3C9EA 4MZSA 3BPFA 1S4VA 4Q8GA 3HWNA 3O0UA 1A6RA 2G6DA 4OELA 1ICFA 4I07A 1KXRA 3LFYA 2OULA 4YYSA 2F7DA 1W4TA 3PNRA 5PADA 1ATKA 2FYEA 3KFQA 1F29A 3V6CA 3KW9A 2B1MA 2OZ2A 2HXZA 1EWMA 2BDZA 1JQPA 2JQGR 1EF7A 1BGOA 1YALA 3KSEA 4CDCB 1CQDA 4Q8HA 3O1GA 3ERVA 2Y5BA 2FT2A 1ME4A 1PBHA 4N79A 1TL9A 3OF8A 4CDDB 1NL6A 1EWLA 3PDFA 3IOQA 3RVWA 5JH3A 4ZUXU 1NQCA 1AU0A 2DCBA 3QSDA 4GUZA 1PPDA 2YJ8A 1BQIA 3QJ3A 5A24A 1U5IA 1CV8A 3S3QA 1BP4A 3U8EA 3MHHA 4CZWA 2FUDA 4PI3A 4YVAA 2NQIA 3ZUAA 1W6FA 3M99A 4QRGA 1F2BA 1U9WA 3F75A 1U9VA 3CBJA 1CS8A 2NQGA 4XR7A 1F2AA 1KFUL 4K7CA 4MZOA 2H7JA 4BSQA 4I05A 4PP2E 1MS6A 2DC9A 3H89A 2AIMA 2PADA 2FRAA 2DC6A 2JQFR 3F5VA 2G8EA 1YK8A 3K8UA 1TLOA 3PBHA 4AXLA 4X6IA 4N4ZA 3N3KA 1GCBA 4BGFA 1IWDA 2IPPB 1NB3A 1QOLA 3MORA 3KWZA 1ITOA 2VHSA 2AU1A 2XU5A 1Q6KA 2R9NA 2DJFB 2XU1A 1MHWA 4YV8A 3WXGA 2PNSA 1STFE 2XU3A 3HD3A 3E1ZB 1MDWA 1QDQA 2B1NA 4DMYA 3P5WA 7PCKA 1AIMA 2DCDA 2PREA 8PCHA 3IMAA 1GMYA 2G8JA 2R9MA 4WA6A 2O6XA 3AI8A 1PXVA 2DC8A 1NB5A 3WXFA 3KWBX 4HWYA 1CVZA 5K16A 2GHUA 1O0EA 1AU4A 1U9XA 3P5XA 3QT4A 3BC3A 1AYWA 3MTNA 2AYOA 1NLJA 4QRVA 1POPA 3WXEA 5CHTA 2R9FA 3B79A 5EF4A 4B55A 2HD5A 4XUIA 3IHPA 2BSZA 2VFBA 4BS6A 1U9QX 2FQ9A 3USVA 2P86A 4PP1A 2AVWA 1SP4B 4YYVA 2FRQA 4BPVA 1DF0A 1Y4HA 2G7YA 4X6JA 1X9YA 3CH3X 3OF9A 1AU3A 3BOWA 5CVOB 5CHVA 1YT7A 3HHIA 5FPWA 5CVMA 1SNKA 3TNXA 2AYNA 1PCIA 2GFOA 1PE6A 3KKUA 4YYWA 3BWKA 2PBHA 2CB5A 4QRXA 3RVXA 5F02A 1CJLA 2VHFA 3LXSA 1GECE 1FH0A 4FJCA 4X6HA 4DMXA 1BY8A 5JA7A 2DZYA 3P5UA 1ZCMA 1KHQA 3DF0A 3IUTA 3N4CA 2ATOA 3K9MA 4MSXA 1QXPA 2DZZA 1AU2A 2F1GA 5EGWA 3IEJA 1CSBB 1PADA 4G54A 2R6NA 1E2TA 1TU6A 3I06A 4PADA 2YJBA 4W4UA 9PAPA 4I04A 2HHNA 2FO5A 1PPPA 1PPNA 2VFCA 4KLBA 3D6SA 2AS8A 1CPJA 1MEGA 4W5CA 2DCCA 3CBKA 1AYUA 2Y6EA 3NHEA 2HH5A 2DJGB 1GLOA 1YVBA 3OVXA 1THEA 2IBIA 1EWOA 2AUXA 1Y08A 1VJVA 4N8WA 4QH6A 1CTEA 1F2CA 3D9WA 5CVNB 3H8BA 1K3BB 1AECA 3OISA 4AXMA 4YYQA 4BQVA 2ACTA 1NPZA 1VSNA 2P7UA 3K24A 4P6GA 2BDLA 1ME3A 4RY2A 4C5PA 3CH2X 1XKGA 2NQDB 2WBFX 3OVZA 1AYVA 1MIRA 4YYRA 4NV8A 2C0YA 3IV2A 1KHPA 1DEUA 2R9CA 4CDFB 1W5RA 1KFXL 3P5VA 3BCNA 4CDEB 1EWPA 1ZIVA 4OEMA 2E01A 2OP3A 4W5BA 2YJ2A 2XU4A 2AUZA 3H6SA 1YK7A 3HHAA 3N3GA 2CIOA 4FK5A 3H7DA 2ARYA 4NV7A 1PIPA 5J94A 1PPOA 4FIPA 3PW3A 1QMYA 2NQAA 3H8CA 3V6EA 2DC7A 2YJCA 3KX1A 6PADA 2E00A 2FTDA 2DCAA 3LTWA 3GCBA 3RVVA 2P0RA 2E02A 1MEMA 4QBBA 4YYUA 3I3TA 4P6EA 1CB5A 2R9OA 1HUCB 3MHSA 2YJ9A 1M6DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BPM A;  2E03 A;  3S3R A;  4BS5 A;  3C9E A;  4MZS A;  3BPF A;  1S4V A;  4Q8G A;  3HWN A;  3O0U A;  1A6R A;  2G6D A;  4OEL A;  1ICF A;  4I07 A;  1KXR A;  3LFY A;  2OUL A;  4YYS A;  2F7D A;  3PNR A;  5PAD A;  1ATK A;  2FYE A;  3KFQ A;  1F29 A;  3V6C A;  3KW9 A;  2B1M A;  2OZ2 A;  2HXZ A;  1EWM A;  2BDZ A;  1JQP A;  2JQG R;  1EF7 A;  1BGO A;  1YAL A;  3KSE A;  4CDC B;  1CQD A;  4Q8H A;  3O1G A;  3ERV A;  2Y5B A;  2FT2 A;  1ME4 A;  1PBH A;  4N79 A;  1TL9 A;  3OF8 A;  4CDD B;  1NL6 A;  1EWL A;  3PDF A;  3IOQ A;  3RVW A;  5JH3 A;  4ZUX U;  1NQC A;  1AU0 A;  2DCB A;  3QSD A;  1PPD A;  2YJ8 A;  1BQI A;  3QJ3 A;  5A24 A;  1U5I A;  1CV8 A;  3S3Q A;  1BP4 A;  3U8E A;  3MHH A;  4CZW A;  2FUD A;  4PI3 A;  4YVA A;  2NQI A;  3ZUA A;  3M99 A;  4QRG A;  1F2B A;  1U9W A;  3F75 A;  1U9V A;  3CBJ A;  1CS8 A;  2NQG A;  4XR7 A;  1F2A A;  1KFU L;  4K7C A;  4MZO A;  2H7J A;  4BSQ A;  4I05 A;  4PP2 E;  1MS6 A;  2DC9 A;  3H89 A;  2AIM A;  2PAD A;  2FRA A;  2DC6 A;  2JQF R;  3F5V A;  2G8E A;  1YK8 A;  3K8U A;  1TLO A;  3PBH A;  4AXL A;  4X6I A;  4N4Z A;  3N3K A;  1GCB A;  1IWD A;  2IPP B;  1NB3 A;  1QOL A;  3MOR A;  3KWZ A;  1ITO A;  2VHS A;  2AU1 A;  2XU5 A;  1Q6K A;  2R9N A;  2DJF B;  2XU1 A;  1MHW A;  4YV8 A;  3WXG A;  2PNS A;  1STF E;  2XU3 A;  3HD3 A;  3E1Z B;  1MDW A;  1QDQ A;  2B1N A;  4DMY A;  3P5W A;  7PCK A;  1AIM A;  2DCD A;  2PRE A;  8PCH A;  3IMA A;  1GMY A;  2G8J A;  2R9M A;  4WA6 A;  2O6X A;  3AI8 A;  1PXV A;  2DC8 A;  1NB5 A;  3WXF A;  3KWB X;  4HWY A;  1CVZ A;  5K16 A;  2GHU A;  1O0E A;  1AU4 A;  1U9X A;  3P5X A;  3QT4 A;  3BC3 A;  1AYW A;  3MTN A;  2AYO A;  1NLJ A;  4QRV A;  1POP A;  3WXE A;  5CHT A;  2R9F A;  3B79 A;  5EF4 A;  2HD5 A;  4XUI A;  3IHP A;  4BS6 A;  1U9Q X;  2FQ9 A;  3USV A;  2P86 A;  4PP1 A;  2AVW A;  1SP4 B;  4YYV A;  2FRQ A;  4BPV A;  1DF0 A;  1Y4H A;  2G7Y A;  4X6J A;  1X9Y A;  3CH3 X;  3OF9 A;  1AU3 A;  3BOW A;  5CVO B;  5CHV A;  1YT7 A;  3HHI A;  5FPW A;  5CVM A;  1SNK A;  3TNX A;  2AYN A;  1PCI A;  2GFO A;  1PE6 A;  3KKU A;  4YYW A;  3BWK A;  2PBH A;  2CB5 A;  4QRX A;  3RVX A;  5F02 A;  1CJL A;  2VHF A;  3LXS A;  1GEC E;  1FH0 A;  4FJC A;  4X6H A;  4DMX A;  1BY8 A;  5JA7 A;  2DZY A;  3P5U A;  1ZCM A;  1KHQ A;  3DF0 A;  3IUT A;  3N4C A;  2ATO A;  3K9M A;  4MSX A;  1QXP A;  2DZZ A;  1AU2 A;  2F1G A;  5EGW A;  3IEJ A;  1CSB B;  1PAD A;  4G54 A;  2R6N A;  1TU6 A;  3I06 A;  4PAD A;  2YJB A;  4W4U A;  9PAP A;  4I04 A;  2HHN A;  2FO5 A;  1PPP A;  1PPN A;  4KLB A;  3D6S A;  2AS8 A;  1CPJ A;  1MEG A;  4W5C A;  2DCC A;  3CBK A;  1AYU A;  2Y6E A;  3NHE A;  2HH5 A;  2DJG B;  1GLO A;  1YVB A;  3OVX A;  1THE A;  2IBI A;  1EWO A;  2AUX A;  1Y08 A;  1VJV A;  4N8W A;  4QH6 A;  1CTE A;  1F2C A;  5CVN B;  3H8B A;  1K3B B;  1AEC A;  3OIS A;  4AXM A;  4YYQ A;  4BQV A;  2ACT A;  1NPZ A;  1VSN A;  2P7U A;  3K24 A;  4P6G A;  2BDL A;  1ME3 A;  4RY2 A;  3CH2 X;  1XKG A;  2NQD B;  2WBF X;  3OVZ A;  1AYV A;  1MIR A;  4YYR A;  2C0Y A;  3IV2 A;  1KHP A;  1DEU A;  2R9C A;  4CDF B;  1KFX L;  3P5V A;  3BCN A;  4CDE B;  1EWP A;  1ZIV A;  4OEM A;  2E01 A;  2OP3 A;  4W5B A;  2YJ2 A;  2XU4 A;  2AUZ A;  3H6S A;  1YK7 A;  3HHA A;  3N3G A;  2CIO A;  4FK5 A;  3H7D A;  2ARY A;  5J94 A;  1PIP A;  1PPO A;  4FIP A;  3PW3 A;  1QMY A;  2NQA A;  3H8C A;  3V6E A;  2DC7 A;  2YJC A;  3KX1 A;  6PAD A;  2E00 A;  2FTD A;  2DCA A;  3GCB A;  3RVV A;  2P0R A;  2E02 A;  1MEM A;  4QBB A;  4YYU A;  3I3T A;  4P6E A;  1CB5 A;  2R9O A;  1HUC B;  3MHS A;  2YJ9 A;  1M6D A; 
#chains in the Genus database with same CATH topology
 3BPM A;  2E03 A;  3S3R A;  4BS5 A;  3MJ5 A;  3C9E A;  4MZS A;  3BPF A;  1S4V A;  4Q8G A;  3HWN A;  3O0U A;  1A6R A;  2G6D A;  4OEL A;  1ICF A;  4I07 A;  1KXR A;  3LFY A;  2OUL A;  4YYS A;  2F7D A;  3PRP A;  2DOS A;  3PNR A;  2HWK A;  3PSE A;  5PAD A;  1ATK A;  3E9S A;  2FYE A;  4OVZ B;  1PVJ A;  3KFQ A;  1F29 A;  3V6C A;  3KW9 A;  4IUM A;  2B1M A;  2OZ2 A;  2HXZ A;  1EWM A;  2BDZ A;  4IP3 A;  1JQP A;  2JQG R;  1EF7 A;  1BGO A;  1YAL A;  3KSE A;  4CDC B;  4D8E A;  1CQD A;  4Q8H A;  4BOZ A;  3O1G A;  3ERV A;  2Y5B A;  2FT2 A;  1ME4 A;  1PBH A;  4N79 A;  1TL9 A;  3OF8 A;  4CDD B;  5JZE A;  1NL6 A;  1EWL A;  3PDF A;  3IOQ A;  4WUR A;  3RVW A;  5JH3 A;  4ZUX U;  1NQC A;  1AU0 A;  2DCB A;  3QSD A;  1PPD A;  2YJ8 A;  1BQI A;  3QJ3 A;  5A24 A;  1U5I A;  1CV8 A;  3S3Q A;  1BP4 A;  3U8E A;  3MHH A;  4CZW A;  2FUD A;  4PI3 A;  4YVA A;  4RF1 A;  2NQI A;  4MI7 A;  3ZUA A;  3M99 A;  4QRG A;  1F2B A;  1U9W A;  3F75 A;  1U9V A;  3CBJ A;  2JTC A;  1CS8 A;  2NQG A;  4XR7 A;  1F2A A;  1KFU L;  4K7C A;  4MZO A;  2H7J A;  4BSQ A;  4I05 A;  4PP2 E;  1MS6 A;  2DC9 A;  3H89 A;  2AIM A;  2PAD A;  2FRA A;  2DC6 A;  4GUA A;  2JQF R;  3F5V A;  2G8E A;  1YK8 A;  3K8U A;  1TLO A;  3PBH A;  3OQC A;  2Z84 A;  4AXL A;  4X6I A;  4N4Z A;  3N3K A;  1GCB A;  1IWD A;  2IPP B;  4MM3 B;  1NB3 A;  1QOL A;  4P16 A;  3MOR A;  3KWZ A;  1ITO A;  2BTW A;  2VHS A;  2AU1 A;  2XU5 A;  3W31 A;  5E6J A;  3PHX A;  1Q6K A;  2R9N A;  2DJF B;  2XU1 A;  1MHW A;  4YV8 A;  3WXG A;  2PNS A;  1STF E;  2XU3 A;  3HD3 A;  3E1Z B;  1MDW A;  1QDQ A;  2B1N A;  4DMY A;  3P5W A;  7PCK A;  1AIM A;  4M0W A;  2DCD A;  2PRE A;  8PCH A;  3IMA A;  1GMY A;  2G8J A;  2R9M A;  4WA6 A;  2O6X A;  3AI8 A;  1PXV A;  2DC8 A;  1NB5 A;  3WXF A;  3KWB X;  4BOS A;  4HWY A;  1CVZ A;  5K16 A;  2GHU A;  1O0E A;  1AU4 A;  1U9X A;  3P5X A;  4A5U A;  3QT4 A;  3TMP A;  3BC3 A;  1AYW A;  4PT5 A;  3MTN A;  2AYO A;  1NLJ A;  4QRV A;  1POP A;  3WXE A;  5CHT A;  4BOQ A;  2R9F A;  3B79 A;  5EF4 A;  2BU3 A;  2HD5 A;  5EZS A;  4XUI A;  3IHP A;  4BS6 A;  1U9Q X;  2FQ9 A;  4BOU A;  3USV A;  2P86 A;  4PP1 A;  5KO3 A;  3PT2 A;  2AVW A;  1SP4 B;  4YYV A;  2FRQ A;  3PHU A;  4BPV A;  1DF0 A;  1Y4H A;  3MP2 A;  2G7Y A;  3ZNH A;  3PRM A;  4X6J A;  3C0R A;  1X9Y A;  3CH3 X;  3OF9 A;  1AU3 A;  3BOW A;  3PHW A;  5CVO B;  5CHV A;  1YT7 A;  3HHI A;  5FPW A;  5CVM A;  1SNK A;  3TNX A;  2AYN A;  1PCI A;  2GFO A;  1PE6 A;  2BTW B;  3KKU A;  4YYW A;  3BWK A;  2PBH A;  2CB5 A;  4R3D A;  4QRX A;  3RVX A;  5F02 A;  1CJL A;  2VHF A;  3LXS A;  1GEC E;  1FH0 A;  4FJC A;  2UZJ A;  4X6H A;  4DMX A;  1BY8 A;  2AGA A;  5JA7 A;  2DZY A;  3P5U A;  1ZCM A;  1KHQ A;  3DF0 A;  3IUT A;  3N4C A;  2ATO A;  3K9M A;  4MSX A;  1QXP A;  2DZZ A;  1AU2 A;  2F1G A;  5EGW A;  3IEJ A;  3TRK A;  1CSB B;  1PAD A;  4G54 A;  4D8B A;  2R6N A;  1TU6 A;  3I06 A;  4PAD A;  2FE8 A;  2YJB A;  4OW0 A;  4W4U A;  9PAP A;  4I04 A;  2HHN A;  2FO5 A;  4BOP A;  1PPP A;  1PPN A;  4KLB A;  3D6S A;  4ZTB A;  3BB7 A;  2AS8 A;  1CPJ A;  1MEG A;  4W5C A;  2DCC A;  3CBK A;  1AYU A;  2Y6E A;  3NHE A;  3BY4 A;  2HH5 A;  2DJG B;  1GLO A;  4RKX A;  1YVB A;  3OVX A;  1THE A;  2IBI A;  2J7Q A;  1EWO A;  2AUX A;  1Y08 A;  1VJV A;  4N8W A;  4QH6 A;  1CTE A;  1F2C A;  5CVN B;  3H8B A;  1K3B B;  1AEC A;  3OIS A;  4AXM A;  4YYQ A;  4BQV A;  2ACT A;  1NPZ A;  3MTV A;  1VSN A;  2P7U A;  3K24 A;  4P6G A;  4XZX A;  2BDL A;  4RF0 A;  1ME3 A;  4RY2 A;  3CH2 X;  1XKG A;  2NQD B;  2WBF X;  4OVZ A;  3OVZ A;  1DKI A;  1AYV A;  3RNV A;  1MIR A;  4YYR A;  2C0Y A;  3IV2 A;  1KHP A;  1DEU A;  2R9C A;  4CDF B;  1KFX L;  3P5V A;  1YZB A;  3W30 A;  4RNA A;  3BCN A;  4CDE B;  1EWP A;  1ZIV A;  4OEM A;  2E01 A;  3BBA A;  2OP3 A;  4W5B A;  2YJ2 A;  2XU4 A;  2AUZ A;  3H6S A;  1YK7 A;  2JRI A;  3HHA A;  3N3G A;  2CIO A;  4FK5 A;  3H7D A;  2ARY A;  5J94 A;  1PIP A;  1PPO A;  3B21 A;  4FIP A;  3PW3 A;  1QMY A;  3O65 A;  4REZ A;  2NQA A;  3H8C A;  3V6E A;  5EZQ A;  2DC7 A;  2YJC A;  2J7Q C;  3KX1 A;  6PAD A;  2E00 A;  4D8I A;  4HXD B;  2FTD A;  2DCA A;  3GCB A;  3RVV A;  2P0R A;  3IFU A;  2E02 A;  1MEM A;  4QBB A;  4YYU A;  3I3T A;  4P6E A;  1CB5 A;  2R9O A;  1HUC B;  3MHS A;  1UKF A;  2YJ9 A;  1M6D A; 
#chains in the Genus database with same CATH homology
 3BPM A;  1GX3 A;  2E03 A;  3S3R A;  4BS5 A;  3C9E A;  4MZS A;  3BPF A;  1S4V A;  4Q8G A;  3HWN A;  3O0U A;  1A6R A;  2G6D A;  4OEL A;  1ICF A;  4I07 A;  1KXR A;  3LFY A;  2OUL A;  4YYS A;  2F7D A;  1W4T A;  3PNR A;  5PAD A;  1ATK A;  2FYE A;  3KFQ A;  1F29 A;  3V6C A;  3KW9 A;  2B1M A;  2OZ2 A;  2HXZ A;  1EWM A;  2BDZ A;  1JQP A;  2JQG R;  1EF7 A;  1BGO A;  1YAL A;  3KSE A;  4CDC B;  1CQD A;  4Q8H A;  3O1G A;  3ERV A;  2Y5B A;  2FT2 A;  1ME4 A;  1PBH A;  4N79 A;  1TL9 A;  3OF8 A;  4CDD B;  1NL6 A;  1EWL A;  3PDF A;  3IOQ A;  3RVW A;  5JH3 A;  4ZUX U;  1NQC A;  1AU0 A;  2DCB A;  3QSD A;  4GUZ A;  1PPD A;  2YJ8 A;  1BQI A;  3QJ3 A;  5A24 A;  1U5I A;  1CV8 A;  3S3Q A;  1BP4 A;  3U8E A;  3MHH A;  4CZW A;  2FUD A;  4PI3 A;  4YVA A;  2NQI A;  3ZUA A;  1W6F A;  3M99 A;  4QRG A;  1F2B A;  1U9W A;  3F75 A;  1U9V A;  3CBJ A;  1CS8 A;  2NQG A;  4XR7 A;  1F2A A;  1KFU L;  4K7C A;  4MZO A;  2H7J A;  4BSQ A;  4I05 A;  4PP2 E;  1MS6 A;  2DC9 A;  3H89 A;  2AIM A;  2PAD A;  2FRA A;  2DC6 A;  2JQF R;  3F5V A;  2G8E A;  1YK8 A;  3K8U A;  1TLO A;  3PBH A;  4AXL A;  4X6I A;  4N4Z A;  3N3K A;  1GCB A;  4BGF A;  1IWD A;  2IPP B;  1NB3 A;  1QOL A;  3MOR A;  3KWZ A;  1ITO A;  2VHS A;  2AU1 A;  2XU5 A;  1Q6K A;  2R9N A;  2DJF B;  2XU1 A;  1MHW A;  4YV8 A;  3WXG A;  2PNS A;  1STF E;  2XU3 A;  3HD3 A;  3E1Z B;  1MDW A;  1QDQ A;  2B1N A;  4DMY A;  3P5W A;  7PCK A;  1AIM A;  2DCD A;  2PRE A;  8PCH A;  3IMA A;  1GMY A;  2G8J A;  2R9M A;  4WA6 A;  2O6X A;  3AI8 A;  1PXV A;  2DC8 A;  1NB5 A;  3WXF A;  3KWB X;  4HWY A;  1CVZ A;  5K16 A;  2GHU A;  1O0E A;  1AU4 A;  1U9X A;  3P5X A;  3QT4 A;  3BC3 A;  1AYW A;  3MTN A;  2AYO A;  1NLJ A;  4QRV A;  1POP A;  3WXE A;  5CHT A;  2R9F A;  3B79 A;  5EF4 A;  4B55 A;  2HD5 A;  4XUI A;  3IHP A;  2BSZ A;  2VFB A;  4BS6 A;  1U9Q X;  2FQ9 A;  3USV A;  2P86 A;  4PP1 A;  2AVW A;  1SP4 B;  4YYV A;  2FRQ A;  4BPV A;  1DF0 A;  1Y4H A;  2G7Y A;  4X6J A;  1X9Y A;  3CH3 X;  3OF9 A;  1AU3 A;  3BOW A;  5CVO B;  5CHV A;  1YT7 A;  3HHI A;  5FPW A;  5CVM A;  1SNK A;  3TNX A;  2AYN A;  1PCI A;  2GFO A;  1PE6 A;  3KKU A;  4YYW A;  3BWK A;  2PBH A;  2CB5 A;  4QRX A;  3RVX A;  5F02 A;  1CJL A;  2VHF A;  3LXS A;  1GEC E;  1FH0 A;  4FJC A;  4X6H A;  4DMX A;  1BY8 A;  5JA7 A;  2DZY A;  3P5U A;  1ZCM A;  1KHQ A;  3DF0 A;  3IUT A;  3N4C A;  2ATO A;  3K9M A;  4MSX A;  1QXP A;  2DZZ A;  1AU2 A;  2F1G A;  5EGW A;  3IEJ A;  1CSB B;  1PAD A;  4G54 A;  2R6N A;  1E2T A;  1TU6 A;  3I06 A;  4PAD A;  2YJB A;  4W4U A;  9PAP A;  4I04 A;  2HHN A;  2FO5 A;  1PPP A;  1PPN A;  2VFC A;  4KLB A;  3D6S A;  2AS8 A;  1CPJ A;  1MEG A;  4W5C A;  2DCC A;  3CBK A;  1AYU A;  2Y6E A;  3NHE A;  2HH5 A;  2DJG B;  1GLO A;  1YVB A;  3OVX A;  1THE A;  2IBI A;  1EWO A;  2AUX A;  1Y08 A;  1VJV A;  4N8W A;  4QH6 A;  1CTE A;  1F2C A;  3D9W A;  5CVN B;  3H8B A;  1K3B B;  1AEC A;  3OIS A;  4AXM A;  4YYQ A;  4BQV A;  2ACT A;  1NPZ A;  1VSN A;  2P7U A;  3K24 A;  4P6G A;  2BDL A;  1ME3 A;  4RY2 A;  4C5P A;  3CH2 X;  1XKG A;  2NQD B;  2WBF X;  3OVZ A;  1AYV A;  1MIR A;  4YYR A;  4NV8 A;  2C0Y A;  3IV2 A;  1KHP A;  1DEU A;  2R9C A;  4CDF B;  1W5R A;  1KFX L;  3P5V A;  3BCN A;  4CDE B;  1EWP A;  1ZIV A;  4OEM A;  2E01 A;  2OP3 A;  4W5B A;  2YJ2 A;  2XU4 A;  2AUZ A;  3H6S A;  1YK7 A;  3HHA A;  3N3G A;  2CIO A;  4FK5 A;  3H7D A;  2ARY A;  4NV7 A;  1PIP A;  5J94 A;  1PPO A;  4FIP A;  3PW3 A;  1QMY A;  2NQA A;  3H8C A;  3V6E A;  2DC7 A;  2YJC A;  3KX1 A;  6PAD A;  2E00 A;  2FTD A;  2DCA A;  3LTW A;  3GCB A;  3RVV A;  2P0R A;  2E02 A;  1MEM A;  4QBB A;  4YYU A;  3I3T A;  4P6E A;  1CB5 A;  2R9O A;  1HUC B;  3MHS A;  2YJ9 A;  1M6D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...