3BWKA

Crystal structure of falcipain-3 with its inhibitor, k11017
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
242
structure length
242
Chain Sequence
YEANYEDVIKKYKPADAKLDRIAYDWRLHGGVTPVKDQALCGSCWAFSSVGSVESQYAIRKKALFLFSEQELVDCSVKNNGCYGGYITNAFDDMIDLGGLCSQDDYPYVSNLPETCNLKRCNERYTIKSYVSIPDDKFKEALRYLGPISISIAASDDFAFYRGGFYDGECGAAPNHAVILVGYGMKDIYNEDTGRMEKFYYYIIKNSWGSDWGEGGYINLETDENGYKKTCSIGTEAYVPLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cysteine protease falcipain-3
publication title Vinyl sulfones as antiparasitic agents and a structural basis for drug design.
pubmed doi rcsb
molecule tags Hydrolase
total genus 69
structure length 242
sequence length 242
chains with identical sequence B, C, D
ec nomenclature ec 3.4.22.-:
pdb deposition date 2008-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3bwkA00
3F75A 3KX1A 1MEGA 2NQDB 3I3TA 7PCKA 1PADA 3F5VA 2IPPB 3D6SA 3IOQA 2DC8A 3H6SA 4DMYA 4MSXA 3B79A 2DC7A 2FT2A 1XKGA 3BPMA 3LXSA 2CB5A 3CH3X 1CB5A 1AU4A 3V6EA 1EWLA 2PREA 2XU3A 1AYVA 4YV8A 4I04A 5JA7A 3BPFA 1ZIVA 3OISA 1KHQA 4CDFB 2VHSA 4WA6A 1BQIA 4FJCA 5JH3A 4PI3A 1EWPA 2HD5A 2XU4A 2FRAA 3U8EA 4YYSA 1GCBA 3OVZA 2AVWA 2XU5A 1TU6A 3KWBX 1PBHA 8PCHA 2JQFR 4BPVA 2C0YA 2NQIA 1F29A 4XR7A 1BY8A 4YYUA 2F7DA 2AS8A 2R9FA 4BQVA 5CVNB 3I06A 1M6DA 4X6IA 3K9MA 3RVXA 4QRVA 4I07A 4BS6A 4BS5A 3N4CA 1MEMA 2E00A 2IBIA 3KKUA 1KHPA 4N8WA 3H8CA 4YYWA 1DF0A 2YJ9A 5CVMA 2HHNA 3LFYA 1AIMA 1CS8A 4FIPA 4Q8GA 4OELA 5CHTA 1MIRA 5A24A 1GLOA 2OP3A 2JQGR 1POPA 2PADA 1KFXL 1PCIA 1X9YA 1U5IA 2YJ2A 4Q8HA 1U9QX 4G54A 2OULA 3OF9A 4QRXA 1NB3A 1MDWA 4DMXA 4X6JA 1MS6A 3IHPA 1CTEA 5K16A 4AXLA 2P86A 2DCDA 1BGOA 2HXZA 2R9CA 4MZOA 1TL9A 2FUDA 2FTDA 4N79A 1KFUL 1NPZA 3QT4A 2AIMA 3KWZA 3PDFA 2BDZA 3KFQA 1ZCMA 2PBHA 3IV2A 1F2BA 1BP4A 4CDDB 2DJFB 4PP1A 1JQPA 2AUXA 1AYUA 3PNRA 3K8UA 2FQ9A 2O6XA 1CQDA 3OF8A 2NQAA 3WXFA 3QJ3A 1ATKA 1AU0A 1Y4HA 1KXRA 3P5VA 1NB5A 1S4VA 2DJGB 4OEMA 1GMYA 4K7CA 3ERVA 4PADA 4QBBA 3IUTA 3S3QA 3PBHA 2AYOA 1DEUA 1SP4B 2ACTA 2VHFA 2HH5A 2Y6EA 1ME3A 1QMYA 3E1ZB 3QSDA 2DCBA 3BWKA 5FPWA 4ZUXU 1YK8A 1SNKA 2YJBA 4HWYA 3MHSA 1ITOA 4PP2E 3GCBA 3HWNA 1NL6A 2FRQA 3ZUAA 2YJCA 2AUZA 3P5WA 4N4ZA 1ICFA 3C9EA 3MTNA 4P6GA 2DZZA 2PNSA 4X6HA 4W5CA 4YYRA 2GHUA 2P7UA 3O1GA 2AU1A 2ARYA 1K3BB 3DF0A 3P5UA 2R9MA 4MZSA 1AYWA 2DCCA 3H8BA 1VJVA 1EWOA 3H7DA 1THEA 1MHWA 1U9WA 3N3GA 4FK5A 4XUIA 1QXPA 2H7JA 1CJLA 2WBFX 4RY2A 3PW3A 1PPPA 2NQGA 9PAPA 4P6EA 4W5BA 4YYQA 1PPNA 5CVOB 3BOWA 3CBJA 3USVA 3NHEA 2P0RA 3KW9A 3RVVA 4CZWA 2DZYA 2E01A 3HHIA 2R9OA 2E03A 6PADA 3KSEA 1VSNA 3MHHA 1GECE 2OZ2A 1YVBA 1YALA 2G8EA 3N3KA 1HUCB 3V6CA 2E02A 2AYNA 3MORA 2G7YA 1FH0A 4QRGA 2DC6A 2XU1A 3AI8A 3O0UA 5EGWA 1QDQA 1AU3A 1PE6A 5PADA 2DC9A 1CSBB 4AXMA 1Y08A 1A6RA 1PXVA 1STFE 2BDLA 1F2CA 2B1MA 3M99A 1NLJA 1Q6KA 1CPJA 1TLOA 3OVXA 3CBKA 1PPDA 2R9NA 3RVWA 3WXGA 3P5XA 2GFOA 2Y5BA 2CIOA 2ATOA 4QH6A 1YK7A 3TNXA 4CDEB 2B1NA 5F02A 2YJ8A 3H89A 5EF4A 1U9XA 2F1GA 1NQCA 3WXEA 1EF7A 5J94A 1U9VA 2FO5A 2DCAA 3BCNA 4I05A 4YYVA 3IMAA 1CV8A 4CDCB 3HD3A 3HHAA 1EWMA 4YVAA 1F2AA 2FYEA 1AU2A 3CH2X 1CVZA 2G8JA 2G6DA 5CHVA 4W4UA 3BC3A 1AECA 4KLBA 2R6NA 1QOLA 1YT7A 4BSQA 3IEJA 1ME4A 1IWDA 1PIPA 3K24A 3S3RA 1O0EA 1PPOA
chains in the Genus database with same CATH superfamily
3F75A 3KX1A 1MEGA 3O65A 3PRPA 4P16A 4RKXA 2NQDB 3I3TA 7PCKA 4RF0A 1PADA 3F5VA 2IPPB 3D6SA 3IOQA 2DC8A 3H6SA 3MJ5A 4DMYA 4MSXA 3B79A 3MTVA 2DC7A 2FT2A 4BOZA 1XKGA 3W31A 3BPMA 3LXSA 2CB5A 3CH3X 1CB5A 2JRIA 1AU4A 3V6EA 1EWLA 2PREA 2XU3A 1AYVA 2AGAA 3W30A 4YV8A 4I04A 5JA7A 3BPFA 1ZIVA 3OISA 1KHQA 4BOPA 4CDFB 2VHSA 4WA6A 1BQIA 4FJCA 5JH3A 3BY4A 4PI3A 3E9SA 1EWPA 2HD5A 2XU4A 3C0RA 2FRAA 3U8EA 4YYSA 1GCBA 4OVZA 3OVZA 2AVWA 3BBAA 2XU5A 1TU6A 3KWBX 1PBHA 8PCHA 2JQFR 4BPVA 2C0YA 2NQIA 1F29A 4XR7A 1BY8A 4YYUA 2F7DA 2AS8A 2R9FA 1PVJA 4BQVA 5CVNB 3I06A 1M6DA 4X6IA 3K9MA 3RVXA 4QRVA 4I07A 4BS6A 4BS5A 3N4CA 1MEMA 2E00A 2IBIA 3KKUA 1KHPA 2BTWA 4N8WA 3H8CA 4YYWA 1DF0A 2YJ9A 5CVMA 2HHNA 3LFYA 4XZXA 5E6JA 1AIMA 1CS8A 4FIPA 4Q8GA 4OELA 5CHTA 1MIRA 5A24A 1GLOA 2OP3A 2JQGR 1POPA 2PADA 1KFXL 1PCIA 1X9YA 1U5IA 2YJ2A 4Q8HA 1U9QX 4G54A 2OULA 2FE8A 3RNVA 2HWKA 3OF9A 4QRXA 1NB3A 1MDWA 4DMXA 4X6JA 1MS6A 3IHPA 1CTEA 5K16A 4AXLA 2P86A 2DCDA 1BGOA 2HXZA 2R9CA 4MZOA 1TL9A 2FUDA 2FTDA 4N79A 1KFUL 1NPZA 3QT4A 2AIMA 3KWZA 3PDFA 2BDZA 3KFQA 1ZCMA 2PBHA 3IV2A 4D8IA 1F2BA 2J7QC 1BP4A 4CDDB 2DJFB 4PP1A 1JQPA 2AUXA 1AYUA 3PNRA 3K8UA 2FQ9A 2O6XA 1CQDA 1YZBA 3OF8A 3PRMA 2NQAA 3WXFA 3QJ3A 1ATKA 1AU0A 1Y4HA 1KXRA 3P5VA 1NB5A 1S4VA 2DJGB 4OEMA 3IFUA 1GMYA 4M0WA 3PHUA 4MM3B 4K7CA 3ERVA 4PADA 4IUMA 3IUTA 4QBBA 3S3QA 3PBHA 2AYOA 2UZJA 1DEUA 1SP4B 4OVZB 3TRKA 2ACTA 2VHFA 2HH5A 2Y6EA 1ME3A 4RNAA 3TMPA 1QMYA 3E1ZB 3QSDA 3PT2A 2DCBA 4GUAA 3BWKA 5FPWA 4ZUXU 1YK8A 1SNKA 3MP2A 2YJBA 4HWYA 5EZQA 3MHSA 1ITOA 4PP2E 3GCBA 3HWNA 1NL6A 4R3DA 2FRQA 3ZUAA 4MI7A 3PHXA 2YJCA 2AUZA 3P5WA 4N4ZA 1ICFA 3C9EA 5EZSA 3MTNA 2BU3A 4P6GA 4IP3A 2DZZA 2PNSA 4BOSA 4X6HA 4W5CA 4YYRA 2GHUA 2P7UA 3O1GA 2AU1A 2ARYA 3B21A 1K3BB 3DF0A 3P5UA 2R9MA 4MZSA 1AYWA 2DCCA 3ZNHA 3H8BA 1VJVA 2BTWB 1EWOA 3H7DA 1THEA 1MHWA 3N3GA 1U9WA 4FK5A 4HXDB 1QXPA 4XUIA 2H7JA 4OW0A 4PT5A 1CJLA 2WBFX 4D8BA 4RY2A 3PSEA 3PW3A 1PPPA 2NQGA 9PAPA 4P6EA 4W5BA 4YYQA 2DOSA 2Z84A 1PPNA 5CVOB 3BOWA 3CBJA 3USVA 3NHEA 2J7QA 2P0RA 3KW9A 4BOQA 4WURA 3RVVA 4CZWA 4REZA 2DZYA 2E01A 3HHIA 2R9OA 2E03A 6PADA 3KSEA 1VSNA 3MHHA 1GECE 2OZ2A 4D8EA 1YVBA 1YALA 2G8EA 3N3KA 1HUCB 3V6CA 2JTCA 2E02A 2AYNA 3MORA 2G7YA 1FH0A 4QRGA 2DC6A 2XU1A 3AI8A 3O0UA 4RF1A 5EGWA 1QDQA 1AU3A 1PE6A 5PADA 2DC9A 1CSBB 4AXMA 1Y08A 1A6RA 5KO3A 1PXVA 1STFE 2BDLA 1F2CA 2B1MA 3M99A 1NLJA 1Q6KA 1CPJA 1TLOA 3OVXA 4A5UA 3CBKA 1PPDA 2R9NA 4BOUA 3RVWA 3WXGA 3P5XA 2GFOA 2Y5BA 2CIOA 2ATOA 4QH6A 1YK7A 3TNXA 4ZTBA 4CDEB 2B1NA 5F02A 2YJ8A 3H89A 3BB7A 5EF4A 1U9XA 2F1GA 5JZEA 1NQCA 3WXEA 1EF7A 5J94A 1DKIA 1UKFA 1U9VA 2FO5A 3PHWA 2DCAA 3BCNA 4I05A 4YYVA 3OQCA 3IMAA 1CV8A 4CDCB 3HD3A 3HHAA 1EWMA 4YVAA 1F2AA 2FYEA 1AU2A 3CH2X 1CVZA 2G8JA 2G6DA 5CHVA 4W4UA 3BC3A 1AECA 4KLBA 2R6NA 1QOLA 1YT7A 4BSQA 3IEJA 1ME4A 1IWDA 1PIPA 3K24A 3S3RA 1O0EA 1PPOA
chains in the Genus database with same CATH topology
3F75A 3KX1A 1MEGA 2NQDB 3I3TA 7PCKA 1PADA 3F5VA 2IPPB 3D6SA 3IOQA 2DC8A 3H6SA 4DMYA 4MSXA 3B79A 2DC7A 2FT2A 1XKGA 3BPMA 3LXSA 2CB5A 3CH3X 1CB5A 1AU4A 3V6EA 1EWLA 2PREA 2XU3A 1AYVA 4YV8A 4I04A 5JA7A 3BPFA 1ZIVA 3OISA 1KHQA 4CDFB 2VHSA 4WA6A 1BQIA 4FJCA 5JH3A 4PI3A 1EWPA 2HD5A 2XU4A 2FRAA 3U8EA 4YYSA 1GCBA 3OVZA 2AVWA 2XU5A 1TU6A 3KWBX 1PBHA 8PCHA 2JQFR 4BPVA 2C0YA 2NQIA 1F29A 4XR7A 1BY8A 4YYUA 2F7DA 2AS8A 2R9FA 4BQVA 5CVNB 3I06A 1M6DA 4X6IA 3K9MA 3RVXA 4QRVA 4I07A 4BS6A 4BS5A 3N4CA 1MEMA 2E00A 2IBIA 3KKUA 1KHPA 4N8WA 3H8CA 4YYWA 1DF0A 2YJ9A 5CVMA 2HHNA 3LFYA 1W5RA 1AIMA 1CS8A 4FIPA 4Q8GA 4OELA 5CHTA 1MIRA 5A24A 1GLOA 2OP3A 2JQGR 1POPA 2PADA 1KFXL 1PCIA 1X9YA 1U5IA 2YJ2A 4Q8HA 1U9QX 4G54A 1E2TA 2OULA 3OF9A 4QRXA 1NB3A 1MDWA 1W6FA 4DMXA 4X6JA 1MS6A 3IHPA 1CTEA 5K16A 4AXLA 2P86A 2DCDA 1BGOA 2HXZA 2R9CA 4MZOA 1TL9A 2FUDA 2FTDA 4N79A 1KFUL 1NPZA 3QT4A 2AIMA 3KWZA 3PDFA 2BDZA 3KFQA 1ZCMA 2PBHA 3IV2A 1F2BA 1BP4A 4CDDB 2DJFB 3D9WA 4PP1A 1JQPA 2AUXA 1AYUA 3PNRA 2VFCA 3K8UA 2FQ9A 2O6XA 1CQDA 3OF8A 2NQAA 3WXFA 3QJ3A 1ATKA 1AU0A 1Y4HA 1KXRA 3P5VA 1NB5A 1S4VA 2DJGB 4OEMA 1GMYA 4K7CA 3ERVA 4PADA 4QBBA 3IUTA 3S3QA 4B55A 3PBHA 2AYOA 1DEUA 1SP4B 4BGFA 2ACTA 2VHFA 2HH5A 2Y6EA 1ME3A 2VFBA 1QMYA 3E1ZB 3QSDA 2DCBA 3BWKA 5FPWA 4ZUXU 1YK8A 1SNKA 2YJBA 4HWYA 3MHSA 1ITOA 4PP2E 3GCBA 3HWNA 1NL6A 2FRQA 3ZUAA 2YJCA 2AUZA 3P5WA 4N4ZA 1ICFA 3C9EA 3MTNA 4P6GA 2DZZA 2PNSA 4X6HA 4W5CA 4YYRA 2GHUA 2P7UA 3O1GA 2AU1A 4NV7A 2ARYA 1K3BB 3DF0A 3P5UA 2R9MA 4MZSA 1AYWA 2DCCA 3H8BA 1VJVA 1EWOA 3H7DA 1THEA 1MHWA 1U9WA 3N3GA 4FK5A 4XUIA 1QXPA 2H7JA 1CJLA 2BSZA 2WBFX 4RY2A 3PW3A 1PPPA 2NQGA 9PAPA 4P6EA 4W5BA 4YYQA 1PPNA 5CVOB 3BOWA 3CBJA 3USVA 3NHEA 2P0RA 3KW9A 4NV8A 3RVVA 4CZWA 2DZYA 2E01A 3HHIA 2R9OA 2E03A 6PADA 3KSEA 1VSNA 3MHHA 1GECE 2OZ2A 1YVBA 3LTWA 1YALA 2G8EA 3N3KA 1HUCB 3V6CA 2E02A 2AYNA 3MORA 2G7YA 1FH0A 4QRGA 2DC6A 2XU1A 3AI8A 3O0UA 5EGWA 1QDQA 1AU3A 1PE6A 1GX3A 5PADA 2DC9A 1CSBB 4AXMA 1Y08A 1A6RA 1PXVA 1STFE 2BDLA 1F2CA 2B1MA 3M99A 1NLJA 1Q6KA 1CPJA 1TLOA 3OVXA 3CBKA 1PPDA 2R9NA 3RVWA 3WXGA 3P5XA 2GFOA 2Y5BA 2CIOA 2ATOA 4QH6A 1YK7A 3TNXA 4CDEB 2B1NA 5F02A 2YJ8A 3H89A 5EF4A 1U9XA 2F1GA 1NQCA 3WXEA 1EF7A 5J94A 1U9VA 2FO5A 2DCAA 3BCNA 4I05A 4YYVA 3IMAA 1CV8A 4CDCB 3HD3A 3HHAA 1EWMA 4YVAA 1F2AA 2FYEA 1W4TA 1AU2A 3CH2X 1CVZA 2G8JA 2G6DA 5CHVA 4C5PA 4W4UA 4GUZA 3BC3A 1AECA 4KLBA 2R6NA 1QOLA 1YT7A 4BSQA 3IEJA 1ME4A 1IWDA 1PIPA 3K24A 3S3RA 1O0EA 1PPOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F75 A;  3KX1 A;  1MEG A;  2NQD B;  3I3T A;  7PCK A;  1PAD A;  3F5V A;  2IPP B;  3D6S A;  3IOQ A;  2DC8 A;  3H6S A;  4DMY A;  4MSX A;  3B79 A;  2DC7 A;  2FT2 A;  1XKG A;  3BPM A;  3LXS A;  2CB5 A;  3CH3 X;  1CB5 A;  1AU4 A;  3V6E A;  1EWL A;  2PRE A;  2XU3 A;  1AYV A;  4YV8 A;  4I04 A;  5JA7 A;  3BPF A;  1ZIV A;  3OIS A;  1KHQ A;  4CDF B;  2VHS A;  4WA6 A;  1BQI A;  4FJC A;  5JH3 A;  4PI3 A;  1EWP A;  2HD5 A;  2XU4 A;  2FRA A;  3U8E A;  4YYS A;  1GCB A;  3OVZ A;  2AVW A;  2XU5 A;  1TU6 A;  3KWB X;  1PBH A;  8PCH A;  2JQF R;  4BPV A;  2C0Y A;  2NQI A;  1F29 A;  4XR7 A;  1BY8 A;  4YYU A;  2F7D A;  2AS8 A;  2R9F A;  4BQV A;  5CVN B;  3I06 A;  1M6D A;  4X6I A;  3K9M A;  3RVX A;  4QRV A;  4I07 A;  4BS6 A;  4BS5 A;  3N4C A;  1MEM A;  2E00 A;  2IBI A;  3KKU A;  1KHP A;  4N8W A;  3H8C A;  4YYW A;  1DF0 A;  2YJ9 A;  5CVM A;  2HHN A;  3LFY A;  1AIM A;  1CS8 A;  4FIP A;  4Q8G A;  4OEL A;  5CHT A;  1MIR A;  5A24 A;  1GLO A;  2OP3 A;  2JQG R;  1POP A;  2PAD A;  1KFX L;  1PCI A;  1X9Y A;  1U5I A;  2YJ2 A;  4Q8H A;  1U9Q X;  4G54 A;  2OUL A;  3OF9 A;  4QRX A;  1NB3 A;  1MDW A;  4DMX A;  4X6J A;  1MS6 A;  3IHP A;  1CTE A;  5K16 A;  4AXL A;  2P86 A;  2DCD A;  1BGO A;  2HXZ A;  2R9C A;  4MZO A;  1TL9 A;  2FUD A;  2FTD A;  4N79 A;  1KFU L;  1NPZ A;  3QT4 A;  2AIM A;  3KWZ A;  3PDF A;  2BDZ A;  3KFQ A;  1ZCM A;  2PBH A;  3IV2 A;  1F2B A;  1BP4 A;  4CDD B;  2DJF B;  4PP1 A;  1JQP A;  2AUX A;  1AYU A;  3PNR A;  3K8U A;  2FQ9 A;  2O6X A;  1CQD A;  3OF8 A;  2NQA A;  3WXF A;  3QJ3 A;  1ATK A;  1AU0 A;  1Y4H A;  1KXR A;  3P5V A;  1NB5 A;  1S4V A;  2DJG B;  4OEM A;  1GMY A;  4K7C A;  3ERV A;  4PAD A;  4QBB A;  3IUT A;  3S3Q A;  3PBH A;  2AYO A;  1DEU A;  1SP4 B;  2ACT A;  2VHF A;  2HH5 A;  2Y6E A;  1ME3 A;  1QMY A;  3E1Z B;  3QSD A;  2DCB A;  3BWK A;  5FPW A;  4ZUX U;  1YK8 A;  1SNK A;  2YJB A;  4HWY A;  3MHS A;  1ITO A;  4PP2 E;  3GCB A;  3HWN A;  1NL6 A;  2FRQ A;  3ZUA A;  2YJC A;  2AUZ A;  3P5W A;  4N4Z A;  1ICF A;  3C9E A;  3MTN A;  4P6G A;  2DZZ A;  2PNS A;  4X6H A;  4W5C A;  4YYR A;  2GHU A;  2P7U A;  3O1G A;  2AU1 A;  2ARY A;  1K3B B;  3DF0 A;  3P5U A;  2R9M A;  4MZS A;  1AYW A;  2DCC A;  3H8B A;  1VJV A;  1EWO A;  3H7D A;  1THE A;  1MHW A;  1U9W A;  3N3G A;  4FK5 A;  4XUI A;  1QXP A;  2H7J A;  1CJL A;  2WBF X;  4RY2 A;  3PW3 A;  1PPP A;  2NQG A;  9PAP A;  4P6E A;  4W5B A;  4YYQ A;  1PPN A;  5CVO B;  3BOW A;  3CBJ A;  3USV A;  3NHE A;  2P0R A;  3KW9 A;  3RVV A;  4CZW A;  2DZY A;  2E01 A;  3HHI A;  2R9O A;  2E03 A;  6PAD A;  3KSE A;  1VSN A;  3MHH A;  1GEC E;  2OZ2 A;  1YVB A;  1YAL A;  2G8E A;  3N3K A;  1HUC B;  3V6C A;  2E02 A;  2AYN A;  3MOR A;  2G7Y A;  1FH0 A;  4QRG A;  2DC6 A;  2XU1 A;  3AI8 A;  3O0U A;  5EGW A;  1QDQ A;  1AU3 A;  1PE6 A;  5PAD A;  2DC9 A;  1CSB B;  4AXM A;  1Y08 A;  1A6R A;  1PXV A;  1STF E;  2BDL A;  1F2C A;  2B1M A;  3M99 A;  1NLJ A;  1Q6K A;  1CPJ A;  1TLO A;  3OVX A;  3CBK A;  1PPD A;  2R9N A;  3RVW A;  3WXG A;  3P5X A;  2GFO A;  2Y5B A;  2CIO A;  2ATO A;  4QH6 A;  1YK7 A;  3TNX A;  4CDE B;  2B1N A;  5F02 A;  2YJ8 A;  3H89 A;  5EF4 A;  1U9X A;  2F1G A;  1NQC A;  3WXE A;  1EF7 A;  5J94 A;  1U9V A;  2FO5 A;  2DCA A;  3BCN A;  4I05 A;  4YYV A;  3IMA A;  1CV8 A;  4CDC B;  3HD3 A;  3HHA A;  1EWM A;  4YVA A;  1F2A A;  2FYE A;  1AU2 A;  3CH2 X;  1CVZ A;  2G8J A;  2G6D A;  5CHV A;  4W4U A;  3BC3 A;  1AEC A;  4KLB A;  2R6N A;  1QOL A;  1YT7 A;  4BSQ A;  3IEJ A;  1ME4 A;  1IWD A;  1PIP A;  3K24 A;  3S3R A;  1O0E A;  1PPO A; 
#chains in the Genus database with same CATH topology
 3F75 A;  3KX1 A;  1MEG A;  3O65 A;  3PRP A;  4P16 A;  4RKX A;  2NQD B;  3I3T A;  7PCK A;  4RF0 A;  1PAD A;  3F5V A;  2IPP B;  3D6S A;  3IOQ A;  2DC8 A;  3H6S A;  3MJ5 A;  4DMY A;  4MSX A;  3B79 A;  3MTV A;  2DC7 A;  2FT2 A;  4BOZ A;  1XKG A;  3W31 A;  3BPM A;  3LXS A;  2CB5 A;  3CH3 X;  1CB5 A;  2JRI A;  1AU4 A;  3V6E A;  1EWL A;  2PRE A;  2XU3 A;  1AYV A;  2AGA A;  3W30 A;  4YV8 A;  4I04 A;  5JA7 A;  3BPF A;  1ZIV A;  3OIS A;  1KHQ A;  4BOP A;  4CDF B;  2VHS A;  4WA6 A;  1BQI A;  4FJC A;  5JH3 A;  3BY4 A;  4PI3 A;  3E9S A;  1EWP A;  2HD5 A;  2XU4 A;  3C0R A;  2FRA A;  3U8E A;  4YYS A;  1GCB A;  4OVZ A;  3OVZ A;  2AVW A;  3BBA A;  2XU5 A;  1TU6 A;  3KWB X;  1PBH A;  8PCH A;  2JQF R;  4BPV A;  2C0Y A;  2NQI A;  1F29 A;  4XR7 A;  1BY8 A;  4YYU A;  2F7D A;  2AS8 A;  2R9F A;  1PVJ A;  4BQV A;  5CVN B;  3I06 A;  1M6D A;  4X6I A;  3K9M A;  3RVX A;  4QRV A;  4I07 A;  4BS6 A;  4BS5 A;  3N4C A;  1MEM A;  2E00 A;  2IBI A;  3KKU A;  1KHP A;  2BTW A;  4N8W A;  3H8C A;  4YYW A;  1DF0 A;  2YJ9 A;  5CVM A;  2HHN A;  3LFY A;  4XZX A;  5E6J A;  1AIM A;  1CS8 A;  4FIP A;  4Q8G A;  4OEL A;  5CHT A;  1MIR A;  5A24 A;  1GLO A;  2OP3 A;  2JQG R;  1POP A;  2PAD A;  1KFX L;  1PCI A;  1X9Y A;  1U5I A;  2YJ2 A;  4Q8H A;  1U9Q X;  4G54 A;  2OUL A;  2FE8 A;  3RNV A;  2HWK A;  3OF9 A;  4QRX A;  1NB3 A;  1MDW A;  4DMX A;  4X6J A;  1MS6 A;  3IHP A;  1CTE A;  5K16 A;  4AXL A;  2P86 A;  2DCD A;  1BGO A;  2HXZ A;  2R9C A;  4MZO A;  1TL9 A;  2FUD A;  2FTD A;  4N79 A;  1KFU L;  1NPZ A;  3QT4 A;  2AIM A;  3KWZ A;  3PDF A;  2BDZ A;  3KFQ A;  1ZCM A;  2PBH A;  3IV2 A;  4D8I A;  1F2B A;  2J7Q C;  1BP4 A;  4CDD B;  2DJF B;  4PP1 A;  1JQP A;  2AUX A;  1AYU A;  3PNR A;  3K8U A;  2FQ9 A;  2O6X A;  1CQD A;  1YZB A;  3OF8 A;  3PRM A;  2NQA A;  3WXF A;  3QJ3 A;  1ATK A;  1AU0 A;  1Y4H A;  1KXR A;  3P5V A;  1NB5 A;  1S4V A;  2DJG B;  4OEM A;  3IFU A;  1GMY A;  4M0W A;  3PHU A;  4MM3 B;  4K7C A;  3ERV A;  4PAD A;  4IUM A;  3IUT A;  4QBB A;  3S3Q A;  3PBH A;  2AYO A;  2UZJ A;  1DEU A;  1SP4 B;  4OVZ B;  3TRK A;  2ACT A;  2VHF A;  2HH5 A;  2Y6E A;  1ME3 A;  4RNA A;  3TMP A;  1QMY A;  3E1Z B;  3QSD A;  3PT2 A;  2DCB A;  4GUA A;  3BWK A;  5FPW A;  4ZUX U;  1YK8 A;  1SNK A;  3MP2 A;  2YJB A;  4HWY A;  5EZQ A;  3MHS A;  1ITO A;  4PP2 E;  3GCB A;  3HWN A;  1NL6 A;  4R3D A;  2FRQ A;  3ZUA A;  4MI7 A;  3PHX A;  2YJC A;  2AUZ A;  3P5W A;  4N4Z A;  1ICF A;  3C9E A;  5EZS A;  3MTN A;  2BU3 A;  4P6G A;  4IP3 A;  2DZZ A;  2PNS A;  4BOS A;  4X6H A;  4W5C A;  4YYR A;  2GHU A;  2P7U A;  3O1G A;  2AU1 A;  2ARY A;  3B21 A;  1K3B B;  3DF0 A;  3P5U A;  2R9M A;  4MZS A;  1AYW A;  2DCC A;  3ZNH A;  3H8B A;  1VJV A;  2BTW B;  1EWO A;  3H7D A;  1THE A;  1MHW A;  3N3G A;  1U9W A;  4FK5 A;  4HXD B;  1QXP A;  4XUI A;  2H7J A;  4OW0 A;  4PT5 A;  1CJL A;  2WBF X;  4D8B A;  4RY2 A;  3PSE A;  3PW3 A;  1PPP A;  2NQG A;  9PAP A;  4P6E A;  4W5B A;  4YYQ A;  2DOS A;  2Z84 A;  1PPN A;  5CVO B;  3BOW A;  3CBJ A;  3USV A;  3NHE A;  2J7Q A;  2P0R A;  3KW9 A;  4BOQ A;  4WUR A;  3RVV A;  4CZW A;  4REZ A;  2DZY A;  2E01 A;  3HHI A;  2R9O A;  2E03 A;  6PAD A;  3KSE A;  1VSN A;  3MHH A;  1GEC E;  2OZ2 A;  4D8E A;  1YVB A;  1YAL A;  2G8E A;  3N3K A;  1HUC B;  3V6C A;  2JTC A;  2E02 A;  2AYN A;  3MOR A;  2G7Y A;  1FH0 A;  4QRG A;  2DC6 A;  2XU1 A;  3AI8 A;  3O0U A;  4RF1 A;  5EGW A;  1QDQ A;  1AU3 A;  1PE6 A;  5PAD A;  2DC9 A;  1CSB B;  4AXM A;  1Y08 A;  1A6R A;  5KO3 A;  1PXV A;  1STF E;  2BDL A;  1F2C A;  2B1M A;  3M99 A;  1NLJ A;  1Q6K A;  1CPJ A;  1TLO A;  3OVX A;  4A5U A;  3CBK A;  1PPD A;  2R9N A;  4BOU A;  3RVW A;  3WXG A;  3P5X A;  2GFO A;  2Y5B A;  2CIO A;  2ATO A;  4QH6 A;  1YK7 A;  3TNX A;  4ZTB A;  4CDE B;  2B1N A;  5F02 A;  2YJ8 A;  3H89 A;  3BB7 A;  5EF4 A;  1U9X A;  2F1G A;  5JZE A;  1NQC A;  3WXE A;  1EF7 A;  5J94 A;  1DKI A;  1UKF A;  1U9V A;  2FO5 A;  3PHW A;  2DCA A;  3BCN A;  4I05 A;  4YYV A;  3OQC A;  3IMA A;  1CV8 A;  4CDC B;  3HD3 A;  3HHA A;  1EWM A;  4YVA A;  1F2A A;  2FYE A;  1AU2 A;  3CH2 X;  1CVZ A;  2G8J A;  2G6D A;  5CHV A;  4W4U A;  3BC3 A;  1AEC A;  4KLB A;  2R6N A;  1QOL A;  1YT7 A;  4BSQ A;  3IEJ A;  1ME4 A;  1IWD A;  1PIP A;  3K24 A;  3S3R A;  1O0E A;  1PPO A; 
#chains in the Genus database with same CATH homology
 3F75 A;  3KX1 A;  1MEG A;  2NQD B;  3I3T A;  7PCK A;  1PAD A;  3F5V A;  2IPP B;  3D6S A;  3IOQ A;  2DC8 A;  3H6S A;  4DMY A;  4MSX A;  3B79 A;  2DC7 A;  2FT2 A;  1XKG A;  3BPM A;  3LXS A;  2CB5 A;  3CH3 X;  1CB5 A;  1AU4 A;  3V6E A;  1EWL A;  2PRE A;  2XU3 A;  1AYV A;  4YV8 A;  4I04 A;  5JA7 A;  3BPF A;  1ZIV A;  3OIS A;  1KHQ A;  4CDF B;  2VHS A;  4WA6 A;  1BQI A;  4FJC A;  5JH3 A;  4PI3 A;  1EWP A;  2HD5 A;  2XU4 A;  2FRA A;  3U8E A;  4YYS A;  1GCB A;  3OVZ A;  2AVW A;  2XU5 A;  1TU6 A;  3KWB X;  1PBH A;  8PCH A;  2JQF R;  4BPV A;  2C0Y A;  2NQI A;  1F29 A;  4XR7 A;  1BY8 A;  4YYU A;  2F7D A;  2AS8 A;  2R9F A;  4BQV A;  5CVN B;  3I06 A;  1M6D A;  4X6I A;  3K9M A;  3RVX A;  4QRV A;  4I07 A;  4BS6 A;  4BS5 A;  3N4C A;  1MEM A;  2E00 A;  2IBI A;  3KKU A;  1KHP A;  4N8W A;  3H8C A;  4YYW A;  1DF0 A;  2YJ9 A;  5CVM A;  2HHN A;  3LFY A;  1W5R A;  1AIM A;  1CS8 A;  4FIP A;  4Q8G A;  4OEL A;  5CHT A;  1MIR A;  5A24 A;  1GLO A;  2OP3 A;  2JQG R;  1POP A;  2PAD A;  1KFX L;  1PCI A;  1X9Y A;  1U5I A;  2YJ2 A;  4Q8H A;  1U9Q X;  4G54 A;  1E2T A;  2OUL A;  3OF9 A;  4QRX A;  1NB3 A;  1MDW A;  1W6F A;  4DMX A;  4X6J A;  1MS6 A;  3IHP A;  1CTE A;  5K16 A;  4AXL A;  2P86 A;  2DCD A;  1BGO A;  2HXZ A;  2R9C A;  4MZO A;  1TL9 A;  2FUD A;  2FTD A;  4N79 A;  1KFU L;  1NPZ A;  3QT4 A;  2AIM A;  3KWZ A;  3PDF A;  2BDZ A;  3KFQ A;  1ZCM A;  2PBH A;  3IV2 A;  1F2B A;  1BP4 A;  4CDD B;  2DJF B;  3D9W A;  4PP1 A;  1JQP A;  2AUX A;  1AYU A;  3PNR A;  2VFC A;  3K8U A;  2FQ9 A;  2O6X A;  1CQD A;  3OF8 A;  2NQA A;  3WXF A;  3QJ3 A;  1ATK A;  1AU0 A;  1Y4H A;  1KXR A;  3P5V A;  1NB5 A;  1S4V A;  2DJG B;  4OEM A;  1GMY A;  4K7C A;  3ERV A;  4PAD A;  4QBB A;  3IUT A;  3S3Q A;  4B55 A;  3PBH A;  2AYO A;  1DEU A;  1SP4 B;  4BGF A;  2ACT A;  2VHF A;  2HH5 A;  2Y6E A;  1ME3 A;  2VFB A;  1QMY A;  3E1Z B;  3QSD A;  2DCB A;  3BWK A;  5FPW A;  4ZUX U;  1YK8 A;  1SNK A;  2YJB A;  4HWY A;  3MHS A;  1ITO A;  4PP2 E;  3GCB A;  3HWN A;  1NL6 A;  2FRQ A;  3ZUA A;  2YJC A;  2AUZ A;  3P5W A;  4N4Z A;  1ICF A;  3C9E A;  3MTN A;  4P6G A;  2DZZ A;  2PNS A;  4X6H A;  4W5C A;  4YYR A;  2GHU A;  2P7U A;  3O1G A;  2AU1 A;  4NV7 A;  2ARY A;  1K3B B;  3DF0 A;  3P5U A;  2R9M A;  4MZS A;  1AYW A;  2DCC A;  3H8B A;  1VJV A;  1EWO A;  3H7D A;  1THE A;  1MHW A;  1U9W A;  3N3G A;  4FK5 A;  4XUI A;  1QXP A;  2H7J A;  1CJL A;  2BSZ A;  2WBF X;  4RY2 A;  3PW3 A;  1PPP A;  2NQG A;  9PAP A;  4P6E A;  4W5B A;  4YYQ A;  1PPN A;  5CVO B;  3BOW A;  3CBJ A;  3USV A;  3NHE A;  2P0R A;  3KW9 A;  4NV8 A;  3RVV A;  4CZW A;  2DZY A;  2E01 A;  3HHI A;  2R9O A;  2E03 A;  6PAD A;  3KSE A;  1VSN A;  3MHH A;  1GEC E;  2OZ2 A;  1YVB A;  3LTW A;  1YAL A;  2G8E A;  3N3K A;  1HUC B;  3V6C A;  2E02 A;  2AYN A;  3MOR A;  2G7Y A;  1FH0 A;  4QRG A;  2DC6 A;  2XU1 A;  3AI8 A;  3O0U A;  5EGW A;  1QDQ A;  1AU3 A;  1PE6 A;  1GX3 A;  5PAD A;  2DC9 A;  1CSB B;  4AXM A;  1Y08 A;  1A6R A;  1PXV A;  1STF E;  2BDL A;  1F2C A;  2B1M A;  3M99 A;  1NLJ A;  1Q6K A;  1CPJ A;  1TLO A;  3OVX A;  3CBK A;  1PPD A;  2R9N A;  3RVW A;  3WXG A;  3P5X A;  2GFO A;  2Y5B A;  2CIO A;  2ATO A;  4QH6 A;  1YK7 A;  3TNX A;  4CDE B;  2B1N A;  5F02 A;  2YJ8 A;  3H89 A;  5EF4 A;  1U9X A;  2F1G A;  1NQC A;  3WXE A;  1EF7 A;  5J94 A;  1U9V A;  2FO5 A;  2DCA A;  3BCN A;  4I05 A;  4YYV A;  3IMA A;  1CV8 A;  4CDC B;  3HD3 A;  3HHA A;  1EWM A;  4YVA A;  1F2A A;  2FYE A;  1W4T A;  1AU2 A;  3CH2 X;  1CVZ A;  2G8J A;  2G6D A;  5CHV A;  4C5P A;  4W4U A;  4GUZ A;  3BC3 A;  1AEC A;  4KLB A;  2R6N A;  1QOL A;  1YT7 A;  4BSQ A;  3IEJ A;  1ME4 A;  1IWD A;  1PIP A;  3K24 A;  3S3R A;  1O0E A;  1PPO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...