2F1GA

Cathepsin s in complex with non-covalent 2-(benzoxazol-2-ylamino)-acetamide
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
220
structure length
220
Chain Sequence
NRILPDSVDWREKGCVTEVKYQGSCGACWAFSAVGALEAQLKLKTGKLVSLSAQNLVDCSTEKYGNKGCNGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYDSKYRAATCSKYTELPYGREDVLKEAVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSWGHNFGEEGYIRMARNKGNHCGIASFPSYPEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Cathepsin S
publication title Synthesis and evaluation of arylaminoethyl amides as noncovalent inhibitors of cathepsin S. Part 3: Heterocyclic P3.
pubmed doi rcsb
source organism Homo sapiens
total genus 68
structure length 220
sequence length 220
chains with identical sequence B
ec nomenclature ec 3.4.22.27: Cathepsin S.
pdb deposition date 2005-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2f1gA00
3KWZA 3OF8A 1F2CA 3KKUA 2DCBA 1AIMA 3I3TA 1AU2A 4QBBA 1F2BA 4X6JA 3D6SA 2GHUA 2O6XA 3BWKA 3MORA 3IUTA 3O0UA 1PADA 2C0YA 2NQGA 1NL6A 1MHWA 1MDWA 2ATOA 2DZZA 4FIPA 4WA6A 3F5VA 5JA7A 1TL9A 1Y4HA 4BQVA 3P5UA 4CDFB 2NQAA 3IHPA 3H8CA 3HHAA 4I07A 4W5CA 1MEMA 2P7UA 2G6DA 2PNSA 2R6NA 3WXGA 1GMYA 3OVZA 4K7CA 1MEGA 1QXPA 3BCNA 4BPVA 2YJCA 3M99A 3N4CA 4PP2E 3CBJA 3B79A 1U9VA 3K9MA 2AU1A 2FRAA 3WXFA 1CTEA 2H7JA 1EWOA 2G8JA 4XUIA 4YV8A 2DCDA 3ERVA 2ACTA 3BPMA 3N3KA 2NQDB 1PXVA 1BY8A 3BPFA 3QSDA 2XU5A 5F02A 3OISA 2G7YA 1TLOA 1BGOA 3U8EA 1AU3A 3DF0A 2DZYA 2VHSA 4PI3A 5PADA 1CQDA 2DCAA 1AU4A 2DCCA 1K3BB 4Q8HA 1A6RA 2BDZA 1BQIA 1YK8A 3CH3X 5EF4A 2YJBA 4FK5A 2WBFX 1AYWA 2HD5A 2VHFA 2Y6EA 1PPDA 2IBIA 2YJ2A 2CIOA 2F1GA 2B1MA 2E00A 3MTNA 3H8BA 1ZIVA 2OZ2A 1YT7A 2XU3A 3IOQA 1CS8A 4I04A 1ATKA 2YJ8A 1Y08A 4AXLA 1M6DA 1YK7A 4MZOA 1EWLA 7PCKA 2GFOA 4CDEB 4X6HA 3QT4A 3P5VA 2PBHA 1DEUA 2P0RA 3BOWA 1QDQA 2OULA 3I06A 5CHVA 1MIRA 5JH3A 1KFXL 3N3GA 3RVWA 3CH2X 4BSQA 1AECA 3S3RA 2E02A 2G8EA 4KLBA 4QRXA 1QOLA 2AUZA 1ZCMA 2E01A 1CSBB 3O1GA 8PCHA 1AU0A 5CVMA 3F75A 2HXZA 3RVVA 1NQCA 3BC3A 3V6CA 2PADA 2CB5A 2P86A 3PDFA 5CVOB 2XU4A 4DMXA 5EGWA 3TNXA 5A24A 3QJ3A 1X9YA 1CJLA 3HHIA 1VJVA 2XU1A 1KFUL 1POPA 1ME3A 1U9WA 2R9OA 1IWDA 1NLJA 1AYVA 1YVBA 1S4VA 3IMAA 1F2AA 4CZWA 4YYRA 1STFE 2OP3A 4I05A 2DC6A 4YYWA 3S3QA 2F7DA 3MHSA 4QRGA 2FUDA 2DC8A 3PNRA 3H89A 3OVXA 1SNKA 3E1ZB 2BDLA 1F29A 4CDDB 2NQIA 1EWPA 2FTDA 1CV8A 2Y5BA 3H7DA 2DJFB 4QH6A 1GLOA 3HWNA 1DF0A 2FQ9A 3KSEA 3AI8A 2DC7A 1U9XA 4OEMA 1YALA 2AIMA 3KW9A 1PE6A 3LFYA 4W5BA 1ICFA 1ITOA 3P5XA 1AYUA 4MZSA 4YVAA 1GCBA 2AYNA 3GCBA 1PPPA 1KXRA 2HH5A 3H6SA 4BS5A 1NB5A 3RVXA 4AXMA 1PCIA 2JQGR 2E03A 4FJCA 4P6EA 4W4UA 2ARYA 2IPPB 1U5IA 2JQFR 2R9NA 4PADA 4DMYA 2AVWA 4HWYA 3KX1A 3USVA 3KFQA 3PW3A 2B1NA 2R9CA 1ME4A 3WXEA 2FO5A 4YYQA 2HHNA 4G54A 9PAPA 4XR7A 4OELA 1CVZA 1XKGA 3HD3A 2AUXA 4YYSA 4P6GA 4N79A 3ZUAA 3V6EA 3PBHA 4Q8GA 5K16A 5CVNB 4YYVA 1PPOA 4ZUXU 3C9EA 3CBKA 1KHPA 3MHHA 1CPJA 4YYUA 1TU6A 1FH0A 6PADA 3P5WA 1EF7A 1PIPA 3NHEA 1PBHA 3KWBX 2AYOA 4BS6A 3OF9A 4PP1A 4X6IA 1U9QX 3IEJA 2R9FA 5J94A 3IV2A 2FT2A 1THEA 1CB5A 1VSNA 1GECE 2DC9A 4N8WA 2PREA 2YJ9A 4RY2A 1QMYA 1HUCB 5FPWA 1SP4B 1MS6A 1JQPA 4N4ZA 5CHTA 1NPZA 3K24A 1PPNA 1O0EA 3LXSA 1BP4A 3K8UA 1Q6KA 4MSXA 1NB3A 1KHQA 2FRQA 1EWMA 2R9MA 2DJGB 2AS8A 4QRVA 2FYEA 4CDCB
chains in the Genus database with same CATH superfamily
3RNVA 3KWZA 3OF8A 1F2CA 3KKUA 4BOSA 2DCBA 1AIMA 3I3TA 1AU2A 4QBBA 1F2BA 4X6JA 3D6SA 2GHUA 2O6XA 3BWKA 3MORA 3IUTA 3O0UA 3ZNHA 1PADA 4RKXA 2C0YA 2NQGA 1NL6A 1MHWA 1MDWA 3IFUA 3BY4A 2ATOA 2DZZA 3MTVA 4FIPA 4WA6A 3F5VA 5JA7A 1TL9A 1Y4HA 2J7QC 4BQVA 2FE8A 3PHUA 3P5UA 4CDFB 2NQAA 1YZBA 3IHPA 3H8CA 2JTCA 3HHAA 4I07A 4W5CA 1MEMA 2P7UA 3B21A 2G6DA 2PNSA 2R6NA 4IUMA 3WXGA 1GMYA 4P16A 2UZJA 3OVZA 4K7CA 1MEGA 1QXPA 3BCNA 2BTWB 4BPVA 4GUAA 2YJCA 3M99A 3N4CA 4PP2E 3CBJA 3B79A 1U9VA 3K9MA 2AU1A 2FRAA 1UKFA 3WXFA 1CTEA 2H7JA 1EWOA 2G8JA 4XUIA 4YV8A 2DCDA 3ERVA 2ACTA 3BPMA 3N3KA 2NQDB 1PXVA 1BY8A 3BPFA 3QSDA 2XU5A 5F02A 3E9SA 3OISA 4RF1A 4ZTBA 2G7YA 4M0WA 1TLOA 1BGOA 3U8EA 1AU3A 3DF0A 2DZYA 2VHSA 4PI3A 5PADA 1CQDA 2DCAA 1AU4A 2DCCA 1K3BB 4Q8HA 1A6RA 2BDZA 1DKIA 1BQIA 4REZA 1YK8A 3PRPA 4D8IA 3CH3X 5EF4A 2YJBA 4FK5A 2WBFX 1AYWA 2HWKA 2HD5A 2VHFA 3TMPA 2Y6EA 1PPDA 2IBIA 2YJ2A 2CIOA 2F1GA 2B1MA 2E00A 3MTNA 3W31A 3H8BA 1ZIVA 2OZ2A 2BU3A 5JZEA 1YT7A 2XU3A 3IOQA 1CS8A 4I04A 1ATKA 2YJ8A 4OVZA 1Y08A 4AXLA 1M6DA 1YK7A 4MZOA 1EWLA 7PCKA 2GFOA 4CDEB 4X6HA 3QT4A 3P5VA 2PBHA 1DEUA 2P0RA 3BOWA 1QDQA 2OULA 3I06A 5CHVA 1MIRA 5JH3A 1KFXL 3N3GA 3RVWA 3CH2X 2JRIA 4BSQA 1AECA 3S3RA 3MJ5A 2E02A 2G8EA 4KLBA 1QOLA 4QRXA 2AUZA 1ZCMA 2E01A 1CSBB 3O1GA 8PCHA 1AU0A 2BTWA 5CVMA 3F75A 2HXZA 3RVVA 1NQCA 3BC3A 3V6CA 2PADA 2CB5A 4R3DA 2P86A 3PDFA 5CVOB 2XU4A 4DMXA 4XZXA 5EGWA 3TNXA 5A24A 3QJ3A 1X9YA 4D8EA 1CJLA 3HHIA 1VJVA 2XU1A 1KFUL 1POPA 1ME3A 1U9WA 2R9OA 1IWDA 1NLJA 1AYVA 1YVBA 1S4VA 3IMAA 1F2AA 1PVJA 4CZWA 4YYRA 1STFE 2OP3A 4I05A 2DC6A 4YYWA 3S3QA 2F7DA 3MHSA 4QRGA 2FUDA 2DC8A 3PNRA 3H89A 5EZSA 3OVXA 4BOUA 1SNKA 4RNAA 3E1ZB 2BDLA 1F29A 4MM3B 4CDDB 2NQIA 1EWPA 2FTDA 1CV8A 3W30A 2Y5BA 3H7DA 2DJFB 4QH6A 1GLOA 3HWNA 4PT5A 1DF0A 5KO3A 3BB7A 5EZQA 2FQ9A 3KSEA 3AI8A 2DC7A 1U9XA 4OEMA 1YALA 3BBAA 2AIMA 3KW9A 1PE6A 3LFYA 4W5BA 4OW0A 1ICFA 1ITOA 3P5XA 1AYUA 4MZSA 4YVAA 1GCBA 2AYNA 3GCBA 1PPPA 1KXRA 2HH5A 3H6SA 4BS5A 4BOQA 4BOZA 1NB5A 3RVXA 4AXMA 4HXDB 1PCIA 2JQGR 2E03A 4FJCA 4BOPA 4P6EA 4W4UA 2ARYA 2IPPB 1U5IA 2JQFR 2R9NA 3O65A 4PADA 4DMYA 2AVWA 4HWYA 3TRKA 3KX1A 2Z84A 3USVA 3KFQA 3PW3A 2B1NA 2R9CA 1ME4A 3WXEA 2FO5A 4OVZB 4YYQA 2HHNA 4G54A 9PAPA 4XR7A 4OELA 1CVZA 1XKGA 3HD3A 2AUXA 4YYSA 2AGAA 4A5UA 3OQCA 4P6GA 3PSEA 4N79A 3ZUAA 3V6EA 3PBHA 4Q8GA 5K16A 5CVNB 4YYVA 4IP3A 1PPOA 3C0RA 4D8BA 4ZUXU 4RF0A 3C9EA 3CBKA 1KHPA 3MHHA 1CPJA 3PRMA 4YYUA 1TU6A 1FH0A 2J7QA 6PADA 3PHWA 3P5WA 1EF7A 1PIPA 3NHEA 2DOSA 1PBHA 3KWBX 2AYOA 4BS6A 3OF9A 4PP1A 4X6IA 1U9QX 3IEJA 2R9FA 5J94A 3IV2A 2FT2A 1THEA 1CB5A 4WURA 1VSNA 1GECE 2DC9A 4N8WA 2PREA 2YJ9A 4RY2A 1QMYA 1HUCB 5FPWA 1SP4B 1MS6A 1JQPA 4N4ZA 5CHTA 1NPZA 3K24A 1PPNA 1O0EA 3LXSA 4MI7A 1BP4A 3PHXA 3K8UA 3PT2A 1Q6KA 4MSXA 1NB3A 1KHQA 2FRQA 1EWMA 2R9MA 5E6JA 2DJGB 3MP2A 2AS8A 4QRVA 2FYEA 4CDCB
chains in the Genus database with same CATH topology
3KWZA 3OF8A 1F2CA 3KKUA 2DCBA 1AIMA 3I3TA 1AU2A 4QBBA 1F2BA 4X6JA 3D6SA 2GHUA 2O6XA 3BWKA 3MORA 3IUTA 3O0UA 2BSZA 1PADA 2C0YA 2NQGA 1NL6A 1MHWA 1MDWA 2ATOA 2DZZA 4FIPA 4WA6A 3F5VA 5JA7A 1TL9A 1Y4HA 4BQVA 3P5UA 4CDFB 1W6FA 2NQAA 3IHPA 3H8CA 3HHAA 4I07A 4W5CA 1MEMA 2P7UA 2G6DA 2PNSA 2R6NA 3WXGA 1GMYA 3OVZA 4K7CA 1MEGA 1QXPA 3BCNA 4BPVA 2YJCA 3M99A 3N4CA 4PP2E 3CBJA 3B79A 1U9VA 3K9MA 2AU1A 2FRAA 3WXFA 1CTEA 2H7JA 1EWOA 2G8JA 4XUIA 4YV8A 2DCDA 3ERVA 2ACTA 3BPMA 3N3KA 2NQDB 1PXVA 1BY8A 3BPFA 3QSDA 4GUZA 2XU5A 5F02A 3OISA 2G7YA 1TLOA 1BGOA 3U8EA 1AU3A 3DF0A 2DZYA 2VHSA 4PI3A 5PADA 1CQDA 2DCAA 1AU4A 2DCCA 1K3BB 4Q8HA 1A6RA 2BDZA 1BQIA 1W4TA 1YK8A 3CH3X 5EF4A 2YJBA 4FK5A 2WBFX 1AYWA 2HD5A 2VHFA 2Y6EA 1PPDA 2IBIA 2YJ2A 2CIOA 2F1GA 4C5PA 2B1MA 2E00A 3MTNA 3H8BA 1ZIVA 2OZ2A 1YT7A 2XU3A 3IOQA 1CS8A 4I04A 1ATKA 2YJ8A 1Y08A 4AXLA 1M6DA 1YK7A 4MZOA 1EWLA 7PCKA 2GFOA 4CDEB 4X6HA 3QT4A 3P5VA 2PBHA 3D9WA 1DEUA 2P0RA 3BOWA 1QDQA 2OULA 3I06A 5CHVA 1MIRA 5JH3A 1KFXL 3N3GA 3RVWA 3CH2X 4BSQA 1AECA 3S3RA 2E02A 2G8EA 4KLBA 1QOLA 4QRXA 2AUZA 1ZCMA 2E01A 1CSBB 3O1GA 8PCHA 1AU0A 5CVMA 3F75A 2HXZA 3RVVA 1NQCA 3BC3A 3V6CA 2PADA 2CB5A 2P86A 3PDFA 5CVOB 2XU4A 4DMXA 4NV7A 5EGWA 3TNXA 5A24A 3QJ3A 1X9YA 1CJLA 3HHIA 1VJVA 2XU1A 1KFUL 1POPA 1ME3A 1U9WA 2R9OA 1IWDA 1NLJA 1AYVA 1YVBA 1S4VA 3IMAA 1F2AA 4CZWA 4YYRA 1STFE 2OP3A 4I05A 2DC6A 4YYWA 3S3QA 2F7DA 3MHSA 4QRGA 2FUDA 2DC8A 3PNRA 3H89A 3OVXA 1SNKA 3E1ZB 2BDLA 1F29A 4CDDB 2NQIA 1EWPA 2FTDA 1CV8A 2Y5BA 3H7DA 2DJFB 4QH6A 1GLOA 3HWNA 1DF0A 2FQ9A 3KSEA 3AI8A 2DC7A 2VFBA 1U9XA 4OEMA 1YALA 2AIMA 3KW9A 1PE6A 3LFYA 4W5BA 1ICFA 1ITOA 3P5XA 1AYUA 4MZSA 4YVAA 1GCBA 2AYNA 3GCBA 1PPPA 1KXRA 2HH5A 2VFCA 3H6SA 4BS5A 1NB5A 3RVXA 4AXMA 1PCIA 2JQGR 2E03A 4FJCA 4P6EA 4W4UA 2ARYA 2IPPB 1U5IA 2JQFR 2R9NA 4PADA 4DMYA 2AVWA 4HWYA 3KX1A 3USVA 3KFQA 3PW3A 2B1NA 2R9CA 1ME4A 3WXEA 2FO5A 4BGFA 4YYQA 2HHNA 4G54A 9PAPA 4XR7A 4OELA 1CVZA 1XKGA 3LTWA 3HD3A 2AUXA 4YYSA 4P6GA 4N79A 3ZUAA 1E2TA 3PBHA 3V6EA 4Q8GA 5K16A 5CVNB 4YYVA 1PPOA 4ZUXU 3C9EA 3CBKA 1KHPA 3MHHA 1CPJA 4YYUA 1TU6A 1FH0A 6PADA 3P5WA 1EF7A 1PIPA 3NHEA 1PBHA 3KWBX 2AYOA 4BS6A 3OF9A 4PP1A 4X6IA 1U9QX 3IEJA 2R9FA 5J94A 1W5RA 3IV2A 2FT2A 1THEA 1GX3A 1CB5A 1VSNA 1GECE 2DC9A 4N8WA 2PREA 2YJ9A 4RY2A 1QMYA 1HUCB 5FPWA 1SP4B 1MS6A 1JQPA 4N4ZA 5CHTA 1NPZA 3K24A 1PPNA 1O0EA 3LXSA 1BP4A 3K8UA 1Q6KA 4MSXA 1NB3A 4NV8A 1KHQA 2FRQA 1EWMA 2R9MA 2DJGB 2AS8A 4QRVA 4B55A 2FYEA 4CDCB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KWZ A;  3OF8 A;  1F2C A;  3KKU A;  2DCB A;  1AIM A;  3I3T A;  1AU2 A;  4QBB A;  1F2B A;  4X6J A;  3D6S A;  2GHU A;  2O6X A;  3BWK A;  3MOR A;  3IUT A;  3O0U A;  1PAD A;  2C0Y A;  2NQG A;  1NL6 A;  1MHW A;  1MDW A;  2ATO A;  2DZZ A;  4FIP A;  4WA6 A;  3F5V A;  5JA7 A;  1TL9 A;  1Y4H A;  4BQV A;  3P5U A;  4CDF B;  2NQA A;  3IHP A;  3H8C A;  3HHA A;  4I07 A;  4W5C A;  1MEM A;  2P7U A;  2G6D A;  2PNS A;  2R6N A;  3WXG A;  1GMY A;  3OVZ A;  4K7C A;  1MEG A;  1QXP A;  3BCN A;  4BPV A;  2YJC A;  3M99 A;  3N4C A;  4PP2 E;  3CBJ A;  3B79 A;  1U9V A;  3K9M A;  2AU1 A;  2FRA A;  3WXF A;  1CTE A;  2H7J A;  1EWO A;  2G8J A;  4XUI A;  4YV8 A;  2DCD A;  3ERV A;  2ACT A;  3BPM A;  3N3K A;  2NQD B;  1PXV A;  1BY8 A;  3BPF A;  3QSD A;  2XU5 A;  5F02 A;  3OIS A;  2G7Y A;  1TLO A;  1BGO A;  3U8E A;  1AU3 A;  3DF0 A;  2DZY A;  2VHS A;  4PI3 A;  5PAD A;  1CQD A;  2DCA A;  1AU4 A;  2DCC A;  1K3B B;  4Q8H A;  1A6R A;  2BDZ A;  1BQI A;  1YK8 A;  3CH3 X;  5EF4 A;  2YJB A;  4FK5 A;  2WBF X;  1AYW A;  2HD5 A;  2VHF A;  2Y6E A;  1PPD A;  2IBI A;  2YJ2 A;  2CIO A;  2F1G A;  2B1M A;  2E00 A;  3MTN A;  3H8B A;  1ZIV A;  2OZ2 A;  1YT7 A;  2XU3 A;  3IOQ A;  1CS8 A;  4I04 A;  1ATK A;  2YJ8 A;  1Y08 A;  4AXL A;  1M6D A;  1YK7 A;  4MZO A;  1EWL A;  7PCK A;  2GFO A;  4CDE B;  4X6H A;  3QT4 A;  3P5V A;  2PBH A;  1DEU A;  2P0R A;  3BOW A;  1QDQ A;  2OUL A;  3I06 A;  5CHV A;  1MIR A;  5JH3 A;  1KFX L;  3N3G A;  3RVW A;  3CH2 X;  4BSQ A;  1AEC A;  3S3R A;  2E02 A;  2G8E A;  4KLB A;  4QRX A;  1QOL A;  2AUZ A;  1ZCM A;  2E01 A;  1CSB B;  3O1G A;  8PCH A;  1AU0 A;  5CVM A;  3F75 A;  2HXZ A;  3RVV A;  1NQC A;  3BC3 A;  3V6C A;  2PAD A;  2CB5 A;  2P86 A;  3PDF A;  5CVO B;  2XU4 A;  4DMX A;  5EGW A;  3TNX A;  5A24 A;  3QJ3 A;  1X9Y A;  1CJL A;  3HHI A;  1VJV A;  2XU1 A;  1KFU L;  1POP A;  1ME3 A;  1U9W A;  2R9O A;  1IWD A;  1NLJ A;  1AYV A;  1YVB A;  1S4V A;  3IMA A;  1F2A A;  4CZW A;  4YYR A;  1STF E;  2OP3 A;  4I05 A;  2DC6 A;  4YYW A;  3S3Q A;  2F7D A;  3MHS A;  4QRG A;  2FUD A;  2DC8 A;  3PNR A;  3H89 A;  3OVX A;  1SNK A;  3E1Z B;  2BDL A;  1F29 A;  4CDD B;  2NQI A;  1EWP A;  2FTD A;  1CV8 A;  2Y5B A;  3H7D A;  2DJF B;  4QH6 A;  1GLO A;  3HWN A;  1DF0 A;  2FQ9 A;  3KSE A;  3AI8 A;  2DC7 A;  1U9X A;  4OEM A;  1YAL A;  2AIM A;  3KW9 A;  1PE6 A;  3LFY A;  4W5B A;  1ICF A;  1ITO A;  3P5X A;  1AYU A;  4MZS A;  4YVA A;  1GCB A;  2AYN A;  3GCB A;  1PPP A;  1KXR A;  2HH5 A;  3H6S A;  4BS5 A;  1NB5 A;  3RVX A;  4AXM A;  1PCI A;  2JQG R;  2E03 A;  4FJC A;  4P6E A;  4W4U A;  2ARY A;  2IPP B;  1U5I A;  2JQF R;  2R9N A;  4PAD A;  4DMY A;  2AVW A;  4HWY A;  3KX1 A;  3USV A;  3KFQ A;  3PW3 A;  2B1N A;  2R9C A;  1ME4 A;  3WXE A;  2FO5 A;  4YYQ A;  2HHN A;  4G54 A;  9PAP A;  4XR7 A;  4OEL A;  1CVZ A;  1XKG A;  3HD3 A;  2AUX A;  4YYS A;  4P6G A;  4N79 A;  3ZUA A;  3V6E A;  3PBH A;  4Q8G A;  5K16 A;  5CVN B;  4YYV A;  1PPO A;  4ZUX U;  3C9E A;  3CBK A;  1KHP A;  3MHH A;  1CPJ A;  4YYU A;  1TU6 A;  1FH0 A;  6PAD A;  3P5W A;  1EF7 A;  1PIP A;  3NHE A;  1PBH A;  3KWB X;  2AYO A;  4BS6 A;  3OF9 A;  4PP1 A;  4X6I A;  1U9Q X;  3IEJ A;  2R9F A;  5J94 A;  3IV2 A;  2FT2 A;  1THE A;  1CB5 A;  1VSN A;  1GEC E;  2DC9 A;  4N8W A;  2PRE A;  2YJ9 A;  4RY2 A;  1QMY A;  1HUC B;  5FPW A;  1SP4 B;  1MS6 A;  1JQP A;  4N4Z A;  5CHT A;  1NPZ A;  3K24 A;  1PPN A;  1O0E A;  3LXS A;  1BP4 A;  3K8U A;  1Q6K A;  4MSX A;  1NB3 A;  1KHQ A;  2FRQ A;  1EWM A;  2R9M A;  2DJG B;  2AS8 A;  4QRV A;  2FYE A;  4CDC B; 
#chains in the Genus database with same CATH topology
 3RNV A;  3KWZ A;  3OF8 A;  1F2C A;  3KKU A;  4BOS A;  2DCB A;  1AIM A;  3I3T A;  1AU2 A;  4QBB A;  1F2B A;  4X6J A;  3D6S A;  2GHU A;  2O6X A;  3BWK A;  3MOR A;  3IUT A;  3O0U A;  3ZNH A;  1PAD A;  4RKX A;  2C0Y A;  2NQG A;  1NL6 A;  1MHW A;  1MDW A;  3IFU A;  3BY4 A;  2ATO A;  2DZZ A;  3MTV A;  4FIP A;  4WA6 A;  3F5V A;  5JA7 A;  1TL9 A;  1Y4H A;  2J7Q C;  4BQV A;  2FE8 A;  3PHU A;  3P5U A;  4CDF B;  2NQA A;  1YZB A;  3IHP A;  3H8C A;  2JTC A;  3HHA A;  4I07 A;  4W5C A;  1MEM A;  2P7U A;  3B21 A;  2G6D A;  2PNS A;  2R6N A;  4IUM A;  3WXG A;  1GMY A;  4P16 A;  2UZJ A;  3OVZ A;  4K7C A;  1MEG A;  1QXP A;  3BCN A;  2BTW B;  4BPV A;  4GUA A;  2YJC A;  3M99 A;  3N4C A;  4PP2 E;  3CBJ A;  3B79 A;  1U9V A;  3K9M A;  2AU1 A;  2FRA A;  1UKF A;  3WXF A;  1CTE A;  2H7J A;  1EWO A;  2G8J A;  4XUI A;  4YV8 A;  2DCD A;  3ERV A;  2ACT A;  3BPM A;  3N3K A;  2NQD B;  1PXV A;  1BY8 A;  3BPF A;  3QSD A;  2XU5 A;  5F02 A;  3E9S A;  3OIS A;  4RF1 A;  4ZTB A;  2G7Y A;  4M0W A;  1TLO A;  1BGO A;  3U8E A;  1AU3 A;  3DF0 A;  2DZY A;  2VHS A;  4PI3 A;  5PAD A;  1CQD A;  2DCA A;  1AU4 A;  2DCC A;  1K3B B;  4Q8H A;  1A6R A;  2BDZ A;  1DKI A;  1BQI A;  4REZ A;  1YK8 A;  3PRP A;  4D8I A;  3CH3 X;  5EF4 A;  2YJB A;  4FK5 A;  2WBF X;  1AYW A;  2HWK A;  2HD5 A;  2VHF A;  3TMP A;  2Y6E A;  1PPD A;  2IBI A;  2YJ2 A;  2CIO A;  2F1G A;  2B1M A;  2E00 A;  3MTN A;  3W31 A;  3H8B A;  1ZIV A;  2OZ2 A;  2BU3 A;  5JZE A;  1YT7 A;  2XU3 A;  3IOQ A;  1CS8 A;  4I04 A;  1ATK A;  2YJ8 A;  4OVZ A;  1Y08 A;  4AXL A;  1M6D A;  1YK7 A;  4MZO A;  1EWL A;  7PCK A;  2GFO A;  4CDE B;  4X6H A;  3QT4 A;  3P5V A;  2PBH A;  1DEU A;  2P0R A;  3BOW A;  1QDQ A;  2OUL A;  3I06 A;  5CHV A;  1MIR A;  5JH3 A;  1KFX L;  3N3G A;  3RVW A;  3CH2 X;  2JRI A;  4BSQ A;  1AEC A;  3S3R A;  3MJ5 A;  2E02 A;  2G8E A;  4KLB A;  1QOL A;  4QRX A;  2AUZ A;  1ZCM A;  2E01 A;  1CSB B;  3O1G A;  8PCH A;  1AU0 A;  2BTW A;  5CVM A;  3F75 A;  2HXZ A;  3RVV A;  1NQC A;  3BC3 A;  3V6C A;  2PAD A;  2CB5 A;  4R3D A;  2P86 A;  3PDF A;  5CVO B;  2XU4 A;  4DMX A;  4XZX A;  5EGW A;  3TNX A;  5A24 A;  3QJ3 A;  1X9Y A;  4D8E A;  1CJL A;  3HHI A;  1VJV A;  2XU1 A;  1KFU L;  1POP A;  1ME3 A;  1U9W A;  2R9O A;  1IWD A;  1NLJ A;  1AYV A;  1YVB A;  1S4V A;  3IMA A;  1F2A A;  1PVJ A;  4CZW A;  4YYR A;  1STF E;  2OP3 A;  4I05 A;  2DC6 A;  4YYW A;  3S3Q A;  2F7D A;  3MHS A;  4QRG A;  2FUD A;  2DC8 A;  3PNR A;  3H89 A;  5EZS A;  3OVX A;  4BOU A;  1SNK A;  4RNA A;  3E1Z B;  2BDL A;  1F29 A;  4MM3 B;  4CDD B;  2NQI A;  1EWP A;  2FTD A;  1CV8 A;  3W30 A;  2Y5B A;  3H7D A;  2DJF B;  4QH6 A;  1GLO A;  3HWN A;  4PT5 A;  1DF0 A;  5KO3 A;  3BB7 A;  5EZQ A;  2FQ9 A;  3KSE A;  3AI8 A;  2DC7 A;  1U9X A;  4OEM A;  1YAL A;  3BBA A;  2AIM A;  3KW9 A;  1PE6 A;  3LFY A;  4W5B A;  4OW0 A;  1ICF A;  1ITO A;  3P5X A;  1AYU A;  4MZS A;  4YVA A;  1GCB A;  2AYN A;  3GCB A;  1PPP A;  1KXR A;  2HH5 A;  3H6S A;  4BS5 A;  4BOQ A;  4BOZ A;  1NB5 A;  3RVX A;  4AXM A;  4HXD B;  1PCI A;  2JQG R;  2E03 A;  4FJC A;  4BOP A;  4P6E A;  4W4U A;  2ARY A;  2IPP B;  1U5I A;  2JQF R;  2R9N A;  3O65 A;  4PAD A;  4DMY A;  2AVW A;  4HWY A;  3TRK A;  3KX1 A;  2Z84 A;  3USV A;  3KFQ A;  3PW3 A;  2B1N A;  2R9C A;  1ME4 A;  3WXE A;  2FO5 A;  4OVZ B;  4YYQ A;  2HHN A;  4G54 A;  9PAP A;  4XR7 A;  4OEL A;  1CVZ A;  1XKG A;  3HD3 A;  2AUX A;  4YYS A;  2AGA A;  4A5U A;  3OQC A;  4P6G A;  3PSE A;  4N79 A;  3ZUA A;  3V6E A;  3PBH A;  4Q8G A;  5K16 A;  5CVN B;  4YYV A;  4IP3 A;  1PPO A;  3C0R A;  4D8B A;  4ZUX U;  4RF0 A;  3C9E A;  3CBK A;  1KHP A;  3MHH A;  1CPJ A;  3PRM A;  4YYU A;  1TU6 A;  1FH0 A;  2J7Q A;  6PAD A;  3PHW A;  3P5W A;  1EF7 A;  1PIP A;  3NHE A;  2DOS A;  1PBH A;  3KWB X;  2AYO A;  4BS6 A;  3OF9 A;  4PP1 A;  4X6I A;  1U9Q X;  3IEJ A;  2R9F A;  5J94 A;  3IV2 A;  2FT2 A;  1THE A;  1CB5 A;  4WUR A;  1VSN A;  1GEC E;  2DC9 A;  4N8W A;  2PRE A;  2YJ9 A;  4RY2 A;  1QMY A;  1HUC B;  5FPW A;  1SP4 B;  1MS6 A;  1JQP A;  4N4Z A;  5CHT A;  1NPZ A;  3K24 A;  1PPN A;  1O0E A;  3LXS A;  4MI7 A;  1BP4 A;  3PHX A;  3K8U A;  3PT2 A;  1Q6K A;  4MSX A;  1NB3 A;  1KHQ A;  2FRQ A;  1EWM A;  2R9M A;  5E6J A;  2DJG B;  3MP2 A;  2AS8 A;  4QRV A;  2FYE A;  4CDC B; 
#chains in the Genus database with same CATH homology
 3KWZ A;  3OF8 A;  1F2C A;  3KKU A;  2DCB A;  1AIM A;  3I3T A;  1AU2 A;  4QBB A;  1F2B A;  4X6J A;  3D6S A;  2GHU A;  2O6X A;  3BWK A;  3MOR A;  3IUT A;  3O0U A;  2BSZ A;  1PAD A;  2C0Y A;  2NQG A;  1NL6 A;  1MHW A;  1MDW A;  2ATO A;  2DZZ A;  4FIP A;  4WA6 A;  3F5V A;  5JA7 A;  1TL9 A;  1Y4H A;  4BQV A;  3P5U A;  4CDF B;  1W6F A;  2NQA A;  3IHP A;  3H8C A;  3HHA A;  4I07 A;  4W5C A;  1MEM A;  2P7U A;  2G6D A;  2PNS A;  2R6N A;  3WXG A;  1GMY A;  3OVZ A;  4K7C A;  1MEG A;  1QXP A;  3BCN A;  4BPV A;  2YJC A;  3M99 A;  3N4C A;  4PP2 E;  3CBJ A;  3B79 A;  1U9V A;  3K9M A;  2AU1 A;  2FRA A;  3WXF A;  1CTE A;  2H7J A;  1EWO A;  2G8J A;  4XUI A;  4YV8 A;  2DCD A;  3ERV A;  2ACT A;  3BPM A;  3N3K A;  2NQD B;  1PXV A;  1BY8 A;  3BPF A;  3QSD A;  4GUZ A;  2XU5 A;  5F02 A;  3OIS A;  2G7Y A;  1TLO A;  1BGO A;  3U8E A;  1AU3 A;  3DF0 A;  2DZY A;  2VHS A;  4PI3 A;  5PAD A;  1CQD A;  2DCA A;  1AU4 A;  2DCC A;  1K3B B;  4Q8H A;  1A6R A;  2BDZ A;  1BQI A;  1W4T A;  1YK8 A;  3CH3 X;  5EF4 A;  2YJB A;  4FK5 A;  2WBF X;  1AYW A;  2HD5 A;  2VHF A;  2Y6E A;  1PPD A;  2IBI A;  2YJ2 A;  2CIO A;  2F1G A;  4C5P A;  2B1M A;  2E00 A;  3MTN A;  3H8B A;  1ZIV A;  2OZ2 A;  1YT7 A;  2XU3 A;  3IOQ A;  1CS8 A;  4I04 A;  1ATK A;  2YJ8 A;  1Y08 A;  4AXL A;  1M6D A;  1YK7 A;  4MZO A;  1EWL A;  7PCK A;  2GFO A;  4CDE B;  4X6H A;  3QT4 A;  3P5V A;  2PBH A;  3D9W A;  1DEU A;  2P0R A;  3BOW A;  1QDQ A;  2OUL A;  3I06 A;  5CHV A;  1MIR A;  5JH3 A;  1KFX L;  3N3G A;  3RVW A;  3CH2 X;  4BSQ A;  1AEC A;  3S3R A;  2E02 A;  2G8E A;  4KLB A;  1QOL A;  4QRX A;  2AUZ A;  1ZCM A;  2E01 A;  1CSB B;  3O1G A;  8PCH A;  1AU0 A;  5CVM A;  3F75 A;  2HXZ A;  3RVV A;  1NQC A;  3BC3 A;  3V6C A;  2PAD A;  2CB5 A;  2P86 A;  3PDF A;  5CVO B;  2XU4 A;  4DMX A;  4NV7 A;  5EGW A;  3TNX A;  5A24 A;  3QJ3 A;  1X9Y A;  1CJL A;  3HHI A;  1VJV A;  2XU1 A;  1KFU L;  1POP A;  1ME3 A;  1U9W A;  2R9O A;  1IWD A;  1NLJ A;  1AYV A;  1YVB A;  1S4V A;  3IMA A;  1F2A A;  4CZW A;  4YYR A;  1STF E;  2OP3 A;  4I05 A;  2DC6 A;  4YYW A;  3S3Q A;  2F7D A;  3MHS A;  4QRG A;  2FUD A;  2DC8 A;  3PNR A;  3H89 A;  3OVX A;  1SNK A;  3E1Z B;  2BDL A;  1F29 A;  4CDD B;  2NQI A;  1EWP A;  2FTD A;  1CV8 A;  2Y5B A;  3H7D A;  2DJF B;  4QH6 A;  1GLO A;  3HWN A;  1DF0 A;  2FQ9 A;  3KSE A;  3AI8 A;  2DC7 A;  2VFB A;  1U9X A;  4OEM A;  1YAL A;  2AIM A;  3KW9 A;  1PE6 A;  3LFY A;  4W5B A;  1ICF A;  1ITO A;  3P5X A;  1AYU A;  4MZS A;  4YVA A;  1GCB A;  2AYN A;  3GCB A;  1PPP A;  1KXR A;  2HH5 A;  2VFC A;  3H6S A;  4BS5 A;  1NB5 A;  3RVX A;  4AXM A;  1PCI A;  2JQG R;  2E03 A;  4FJC A;  4P6E A;  4W4U A;  2ARY A;  2IPP B;  1U5I A;  2JQF R;  2R9N A;  4PAD A;  4DMY A;  2AVW A;  4HWY A;  3KX1 A;  3USV A;  3KFQ A;  3PW3 A;  2B1N A;  2R9C A;  1ME4 A;  3WXE A;  2FO5 A;  4BGF A;  4YYQ A;  2HHN A;  4G54 A;  9PAP A;  4XR7 A;  4OEL A;  1CVZ A;  1XKG A;  3LTW A;  3HD3 A;  2AUX A;  4YYS A;  4P6G A;  4N79 A;  3ZUA A;  1E2T A;  3PBH A;  3V6E A;  4Q8G A;  5K16 A;  5CVN B;  4YYV A;  1PPO A;  4ZUX U;  3C9E A;  3CBK A;  1KHP A;  3MHH A;  1CPJ A;  4YYU A;  1TU6 A;  1FH0 A;  6PAD A;  3P5W A;  1EF7 A;  1PIP A;  3NHE A;  1PBH A;  3KWB X;  2AYO A;  4BS6 A;  3OF9 A;  4PP1 A;  4X6I A;  1U9Q X;  3IEJ A;  2R9F A;  5J94 A;  1W5R A;  3IV2 A;  2FT2 A;  1THE A;  1GX3 A;  1CB5 A;  1VSN A;  1GEC E;  2DC9 A;  4N8W A;  2PRE A;  2YJ9 A;  4RY2 A;  1QMY A;  1HUC B;  5FPW A;  1SP4 B;  1MS6 A;  1JQP A;  4N4Z A;  5CHT A;  1NPZ A;  3K24 A;  1PPN A;  1O0E A;  3LXS A;  1BP4 A;  3K8U A;  1Q6K A;  4MSX A;  1NB3 A;  4NV8 A;  1KHQ A;  2FRQ A;  1EWM A;  2R9M A;  2DJG B;  2AS8 A;  4QRV A;  4B55 A;  2FYE A;  4CDC B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...