2F1GA

Cathepsin s in complex with non-covalent 2-(benzoxazol-2-ylamino)-acetamide
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
220
structure length
220
Chain Sequence
NRILPDSVDWREKGCVTEVKYQGSCGACWAFSAVGALEAQLKLKTGKLVSLSAQNLVDCSTEKYGNKGCNGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYDSKYRAATCSKYTELPYGREDVLKEAVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSWGHNFGEEGYIRMARNKGNHCGIASFPSYPEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Synthesis and evaluation of arylaminoethyl amides as noncovalent inhibitors of cathepsin S. Part 3: Heterocyclic P3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Cathepsin S
total genus 68
structure length 220
sequence length 220
chains with identical sequence B
ec nomenclature ec 3.4.22.27: Cathepsin S.
pdb deposition date 2005-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2f1gA00
2GHUA 3MTNA 1CPJA 1MDWA 3H6SA 2XU1A 3OISA 3HD3A 1F2BA 4BQVA 2R9NA 4X6HA 1KHPA 4YYVA 4DMYA 3IHPA 4QRXA 2FYEA 1MIRA 3D6SA 4FJCA 2H7JA 2HXZA 4N8WA 3RVWA 2AU1A 2AVWA 4W5BA 2F7DA 2R9MA 2FRQA 3H8CA 1PE6A 4ZUXU 2E03A 5K16A 1PCIA 3OVXA 1KFXL 3IMAA 1CB5A 3BWKA 3KWZA 2PBHA 4YVAA 1BQIA 2DCCA 4P6GA 3KX1A 3K9MA 4QBBA 3HHIA 2B1NA 2PNSA 4FIPA 1NB5A 2GFOA 3P5VA 3O1GA 5JH3A 2C0YA 2AUXA 1QMYA 3I06A 3C9EA 8PCHA 2G8EA 2FUDA 1AYWA 3RVVA 3WXEA 3MHSA 4G54A 1ATKA 2BDZA 2YJCA 2PADA 1SP4B 3NHEA 1U9QX 2G8JA 3KKUA 4CZWA 3KW9A 1NPZA 1AU2A 1ICFA 2OULA 5CVOB 3PNRA 2DJGB 3BC3A 1PIPA 1JQPA 2IBIA 1CSBB 2NQGA 4Q8GA 2FRAA 1F29A 3USVA 1TLOA 1FH0A 1QOLA 1PPOA 2YJ2A 2DC7A 2HD5A 1AU3A 1SNKA 4BS5A 4BPVA 2DCBA 1YK8A 3H8BA 1POPA 2ATOA 3N4CA 1M6DA 5F02A 1CVZA 4P6EA 5J94A 1NL6A 3TNXA 1U5IA 2P86A 4WA6A 5CHVA 1YVBA 3CH2X 2O6XA 1VJVA 4QRVA 2R9FA 2FQ9A 4OELA 6PADA 1Y4HA 3DF0A 1ITOA 2HHNA 4BSQA 3QT4A 3WXFA 3AI8A 2E01A 4KLBA 1U9WA 1NLJA 2VHFA 3ZUAA 1STFE 1PPDA 3CBJA 4AXMA 4CDFB 3F5VA 1AECA 1EWMA 1HUCB 2XU5A 3HHAA 1MEMA 2DZZA 3LXSA 1BP4A 3P5UA 2P0RA 1S4VA 1AU0A 2YJBA 2P7UA 3M99A 2AIMA 2R9OA 2JQGR 4XR7A 2DZYA 1AU4A 4X6JA 2AYNA 4OEMA 5A24A 2E02A 3PW3A 7PCKA 2YJ9A 3IV2A 1QDQA 1IWDA 3OF8A 4AXLA 4MZOA 3S3QA 1EWOA 3KFQA 3K24A 3O0UA 3WXGA 1AYVA 1PBHA 3U8EA 1K3BB 3BPFA 1KXRA 5CVNB 1BGOA 2NQDB 2NQIA 3CH3X 3MHHA 1O0EA 1ME3A 1EWPA 2AS8A 4YYWA 3BCNA 2IPPB 1ZIVA 4PP2E 3P5XA 3E1ZB 3MORA 3BOWA 3P5WA 3V6CA 2B1MA 1XKGA 1TL9A 2Y5BA 2R9CA 3N3GA 3OF9A 3PDFA 1NQCA 3KSEA 1MS6A 4YYRA 1TU6A 1U9XA 3N3KA 3PBHA 2DC9A 1PXVA 1U9VA 3RVXA 3V6EA 4K7CA 2FT2A 4CDDB 4YV8A 4FK5A 1AYUA 2PREA 3QJ3A 1CS8A 2CB5A 4MSXA 1PPNA 4YYSA 2FO5A 1YT7A 2Y6EA 1THEA 4XUIA 1GLOA 2DJFB 3HWNA 1ZCMA 2E00A 1PADA 2AYOA 3H89A 4YYUA 2F1GA 5FPWA 1GECE 3CBKA 1QXPA 3I3TA 2G6DA 4YYQA 1DF0A 1A6RA 3QSDA 1ME4A 1YK7A 4I07A 1KHQA 2CIOA 1VSNA 3K8UA 2HH5A 4QRGA 1F2AA 3LFYA 1AIMA 2JQFR 3KWBX 4HWYA 5JA7A 1GMYA 3B79A 4PADA 2YJ8A 1KFUL 1BY8A 4BS6A 5EF4A 2WBFX 1Y08A 3GCBA 1YALA 2OZ2A 2ARYA 1MHWA 2BDLA 4Q8HA 1X9YA 2AUZA 3H7DA 1GCBA 4W4UA 2OP3A 9PAPA 4RY2A 2XU4A 4PI3A 4I04A 3BPMA 2XU3A 1MEGA 1CQDA 1NB3A 1CV8A 2FTDA 1CJLA 4I05A 4QH6A 4CDCB 2G7YA 3F75A 3IOQA 3S3RA 1EWLA 4X6IA 2DCDA 4CDEB 1EF7A 1DEUA 5EGWA 2ACTA 1Q6KA 2DC6A 2DCAA 4PP1A 3IUTA 5PADA 1PPPA 5CVMA 3IEJA 2DC8A 3OVZA 4DMXA 4W5CA 4N79A 1F2CA 4MZSA 2NQAA 5CHTA 4N4ZA 2R6NA 3ERVA 1CTEA 2VHSA
chains in the Genus database with same CATH superfamily
2GHUA 3MTNA 4R3DA 1CPJA 1MDWA 3H6SA 2XU1A 3OISA 3HD3A 1F2BA 3MJ5A 4BQVA 2R9NA 4X6HA 1KHPA 4YYVA 4DMYA 3IHPA 4MM3B 4QRXA 2FYEA 1MIRA 3D6SA 4FJCA 4D8EA 2H7JA 4D8IA 2HXZA 4N8WA 3RVWA 2AU1A 2AVWA 4W5BA 4BOSA 2F7DA 2R9MA 2FRQA 3H8CA 3BB7A 1PE6A 4ZUXU 2E03A 5K16A 1PCIA 3OVXA 1KFXL 4BOZA 3IMAA 4PT5A 1CB5A 3BWKA 3KWZA 2PBHA 4YVAA 1BQIA 2DCCA 4P6GA 3KX1A 4M0WA 3K9MA 4QBBA 3HHIA 3O65A 2B1NA 2PNSA 4FIPA 1NB5A 3P5VA 2GFOA 3O1GA 5JH3A 2J7QC 2C0YA 2AUXA 1QMYA 4MI7A 3I06A 4RF1A 3C9EA 8PCHA 2G8EA 2FUDA 1AYWA 3RVVA 3WXEA 3MHSA 4G54A 1ATKA 2BDZA 2YJCA 2PADA 1SP4B 3NHEA 1U9QX 2G8JA 3KKUA 4CZWA 3KW9A 1NPZA 1AU2A 1ICFA 2OULA 3ZNHA 5CVOB 3PNRA 5EZQA 2DJGB 2FE8A 3BC3A 1PIPA 1JQPA 2IBIA 2AGAA 1CSBB 2NQGA 5EZSA 4Q8GA 2FRAA 1F29A 3USVA 1TLOA 1FH0A 1QOLA 1PPOA 4D8BA 2JRIA 2YJ2A 2DC7A 2HD5A 3B21A 1AU3A 1SNKA 4BS5A 2BTWA 1YZBA 4BPVA 2DCBA 1YK8A 3H8BA 4BOUA 1POPA 2ATOA 3N4CA 1M6DA 5F02A 1CVZA 4P6EA 5J94A 1NL6A 3OQCA 4ZTBA 3TNXA 1U5IA 2P86A 4WA6A 5CHVA 1YVBA 3CH2X 2O6XA 1VJVA 4BOPA 1PVJA 4RF0A 4BOQA 4QRVA 2R9FA 2FQ9A 4OELA 6PADA 1Y4HA 3DF0A 3MP2A 1ITOA 2HHNA 2BU3A 4BSQA 3QT4A 3WXFA 3AI8A 2E01A 4KLBA 1U9WA 1NLJA 2VHFA 3ZUAA 1STFE 1PPDA 3CBJA 4AXMA 4CDFB 3F5VA 1AECA 1EWMA 1HUCB 2XU5A 3HHAA 3E9SA 1MEMA 2DZZA 3LXSA 1BP4A 2BTWB 4WURA 2DOSA 3P5UA 2P0RA 1S4VA 1AU0A 2YJBA 2J7QA 2P7UA 3M99A 2AIMA 2R9OA 1DKIA 2JQGR 4XR7A 2DZYA 1UKFA 1AU4A 4X6JA 2AYNA 4OEMA 3PRPA 2HWKA 5A24A 2E02A 3PW3A 7PCKA 2YJ9A 3IV2A 1QDQA 1IWDA 3OF8A 4AXLA 4MZOA 3PT2A 3S3QA 1EWOA 3TMPA 3KFQA 3K24A 3O0UA 3PHXA 3WXGA 1AYVA 1PBHA 4GUAA 3U8EA 1K3BB 3BPFA 1KXRA 5CVNB 1BGOA 2NQDB 3PHWA 2NQIA 3CH3X 3MHHA 4OW0A 1O0EA 1ME3A 4RKXA 1EWPA 2AS8A 4REZA 5E6JA 3BCNA 4IUMA 4YYWA 2IPPB 1ZIVA 4PP2E 3P5XA 3E1ZB 3MORA 3BOWA 3P5WA 3V6CA 2B1MA 1XKGA 1TL9A 3W30A 2Y5BA 2R9CA 3N3GA 3OF9A 3PDFA 1NQCA 3KSEA 4IP3A 1MS6A 4YYRA 1TU6A 1U9XA 3N3KA 3PBHA 2DC9A 1PXVA 1U9VA 3RVXA 3V6EA 4K7CA 2FT2A 4CDDB 4YV8A 4FK5A 1AYUA 2PREA 3QJ3A 3TRKA 1CS8A 2CB5A 4MSXA 1PPNA 4YYSA 2FO5A 1YT7A 2Y6EA 1THEA 4XUIA 1GLOA 4P16A 2DJFB 3HWNA 1ZCMA 2E00A 2Z84A 1PADA 2AYOA 3H89A 4YYUA 2F1GA 5FPWA 4OVZB 1GECE 3CBKA 1QXPA 3I3TA 2G6DA 4YYQA 1DF0A 1A6RA 3QSDA 1ME4A 3BY4A 5JZEA 1YK7A 4I07A 1KHQA 2CIOA 1VSNA 3K8UA 2HH5A 4QRGA 1F2AA 3LFYA 4A5UA 1AIMA 2JQFR 3KWBX 4HWYA 5JA7A 1GMYA 3B79A 4PADA 2JTCA 2YJ8A 1KFUL 3W31A 1BY8A 4BS6A 5EF4A 2WBFX 1Y08A 3GCBA 1YALA 3PHUA 2OZ2A 2ARYA 1MHWA 4OVZA 2BDLA 4Q8HA 1X9YA 2UZJA 2AUZA 4XZXA 3H7DA 4HXDB 1GCBA 4W4UA 2OP3A 9PAPA 4RY2A 2XU4A 4PI3A 3PRMA 4I04A 3BPMA 2XU3A 1MEGA 1CQDA 1NB3A 1CV8A 2FTDA 1CJLA 4I05A 4QH6A 4CDCB 3C0RA 3BBAA 3F75A 2G7YA 3IOQA 3S3RA 1EWLA 4X6IA 2DCDA 4CDEB 1EF7A 1DEUA 5KO3A 5EGWA 2ACTA 1Q6KA 2DC6A 2DCAA 4PP1A 3IUTA 3MTVA 5PADA 1PPPA 5CVMA 3IEJA 3IFUA 2DC8A 3OVZA 4DMXA 4W5CA 4N79A 1F2CA 4MZSA 2NQAA 4RNAA 3PSEA 3RNVA 5CHTA 4N4ZA 2R6NA 3ERVA 1CTEA 2VHSA
chains in the Genus database with same CATH topology
2GHUA 3MTNA 1CPJA 1MDWA 3H6SA 2XU1A 3OISA 3HD3A 1F2BA 4BQVA 2R9NA 4X6HA 1KHPA 4YYVA 4DMYA 3IHPA 4QRXA 2FYEA 1MIRA 3D6SA 4FJCA 2H7JA 2HXZA 4N8WA 3RVWA 2AU1A 2AVWA 4W5BA 2F7DA 2R9MA 2FRQA 3H8CA 1E2TA 1PE6A 4ZUXU 2E03A 5K16A 1PCIA 3OVXA 2BSZA 1KFXL 4NV7A 3IMAA 1CB5A 3BWKA 3KWZA 2PBHA 4YVAA 1BQIA 2DCCA 4P6GA 3KX1A 1W6FA 3K9MA 4QBBA 3LTWA 3HHIA 2B1NA 2PNSA 4FIPA 1NB5A 2GFOA 3P5VA 3O1GA 5JH3A 2C0YA 2AUXA 1QMYA 3I06A 3C9EA 8PCHA 2G8EA 2FUDA 1AYWA 3RVVA 3WXEA 3MHSA 4G54A 1ATKA 2BDZA 2YJCA 2PADA 4NV8A 1SP4B 3NHEA 1U9QX 2G8JA 3KKUA 4CZWA 3KW9A 1NPZA 1W5RA 1AU2A 1ICFA 2OULA 5CVOB 3PNRA 2DJGB 3BC3A 1PIPA 1JQPA 2IBIA 1CSBB 2NQGA 4Q8GA 2FRAA 1F29A 3USVA 1TLOA 1FH0A 1QOLA 1PPOA 2YJ2A 2DC7A 2HD5A 1AU3A 1SNKA 4BS5A 4BPVA 2DCBA 1YK8A 3H8BA 1POPA 2ATOA 3N4CA 1M6DA 5F02A 1CVZA 4P6EA 5J94A 1NL6A 3TNXA 1U5IA 2P86A 4WA6A 5CHVA 1YVBA 3CH2X 2O6XA 1VJVA 3D9WA 4QRVA 2R9FA 2FQ9A 4OELA 6PADA 1Y4HA 2VFBA 3DF0A 4BGFA 1ITOA 2HHNA 4BSQA 3QT4A 3WXFA 3AI8A 2E01A 4KLBA 1U9WA 1NLJA 2VHFA 3ZUAA 1STFE 1PPDA 3CBJA 4AXMA 4CDFB 3F5VA 1AECA 1EWMA 1HUCB 2XU5A 3HHAA 1MEMA 2DZZA 3LXSA 1BP4A 3P5UA 2P0RA 1S4VA 1AU0A 2YJBA 2P7UA 3M99A 2AIMA 2R9OA 2JQGR 4XR7A 2DZYA 1AU4A 4X6JA 2AYNA 4OEMA 5A24A 2E02A 3PW3A 7PCKA 2YJ9A 3IV2A 1QDQA 1IWDA 3OF8A 4AXLA 4MZOA 3S3QA 1EWOA 3KFQA 3K24A 3O0UA 3WXGA 1AYVA 1PBHA 3U8EA 1GX3A 1K3BB 3BPFA 1KXRA 5CVNB 1BGOA 2NQDB 2NQIA 3CH3X 1W4TA 3MHHA 1O0EA 1ME3A 1EWPA 2AS8A 4YYWA 3BCNA 2IPPB 1ZIVA 4PP2E 3P5XA 3E1ZB 3MORA 3BOWA 3P5WA 3V6CA 2B1MA 1XKGA 1TL9A 2Y5BA 2R9CA 3N3GA 3OF9A 3PDFA 1NQCA 3KSEA 1MS6A 4YYRA 1TU6A 1U9XA 3N3KA 3PBHA 2DC9A 1PXVA 4B55A 1U9VA 3RVXA 3V6EA 4K7CA 2FT2A 4CDDB 4YV8A 4FK5A 1AYUA 2PREA 3QJ3A 1CS8A 2CB5A 4MSXA 1PPNA 4YYSA 2FO5A 1YT7A 2Y6EA 1THEA 4XUIA 1GLOA 2DJFB 3HWNA 1ZCMA 2E00A 1PADA 2AYOA 3H89A 4YYUA 2F1GA 5FPWA 1GECE 3CBKA 1QXPA 3I3TA 2G6DA 4YYQA 1DF0A 1A6RA 3QSDA 1ME4A 1YK7A 2VFCA 4I07A 1KHQA 2CIOA 1VSNA 3K8UA 2HH5A 4QRGA 1F2AA 3LFYA 1AIMA 2JQFR 3KWBX 4HWYA 4C5PA 5JA7A 1GMYA 3B79A 4PADA 2YJ8A 1KFUL 1BY8A 4BS6A 5EF4A 2WBFX 1Y08A 3GCBA 1YALA 2OZ2A 2ARYA 1MHWA 2BDLA 4Q8HA 1X9YA 2AUZA 3H7DA 1GCBA 4W4UA 2OP3A 9PAPA 4RY2A 2XU4A 4PI3A 4I04A 3BPMA 2XU3A 1MEGA 1CQDA 1NB3A 1CV8A 2FTDA 1CJLA 4I05A 4QH6A 4CDCB 2G7YA 3F75A 3IOQA 3S3RA 1EWLA 4X6IA 2DCDA 4CDEB 1EF7A 1DEUA 5EGWA 2ACTA 1Q6KA 4GUZA 2DC6A 2DCAA 4PP1A 3IUTA 5PADA 1PPPA 5CVMA 3IEJA 2DC8A 3OVZA 4DMXA 4W5CA 4N79A 1F2CA 4MZSA 2NQAA 5CHTA 4N4ZA 2R6NA 3ERVA 1CTEA 2VHSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GHU A;  3MTN A;  1CPJ A;  1MDW A;  3H6S A;  2XU1 A;  3OIS A;  3HD3 A;  1F2B A;  4BQV A;  2R9N A;  4X6H A;  1KHP A;  4YYV A;  4DMY A;  3IHP A;  4QRX A;  2FYE A;  1MIR A;  3D6S A;  4FJC A;  2H7J A;  2HXZ A;  4N8W A;  3RVW A;  2AU1 A;  2AVW A;  4W5B A;  2F7D A;  2R9M A;  2FRQ A;  3H8C A;  1PE6 A;  4ZUX U;  2E03 A;  5K16 A;  1PCI A;  3OVX A;  1KFX L;  3IMA A;  1CB5 A;  3BWK A;  3KWZ A;  2PBH A;  4YVA A;  1BQI A;  2DCC A;  4P6G A;  3KX1 A;  3K9M A;  4QBB A;  3HHI A;  2B1N A;  2PNS A;  4FIP A;  1NB5 A;  2GFO A;  3P5V A;  3O1G A;  5JH3 A;  2C0Y A;  2AUX A;  1QMY A;  3I06 A;  3C9E A;  8PCH A;  2G8E A;  2FUD A;  1AYW A;  3RVV A;  3WXE A;  3MHS A;  4G54 A;  1ATK A;  2BDZ A;  2YJC A;  2PAD A;  1SP4 B;  3NHE A;  1U9Q X;  2G8J A;  3KKU A;  4CZW A;  3KW9 A;  1NPZ A;  1AU2 A;  1ICF A;  2OUL A;  5CVO B;  3PNR A;  2DJG B;  3BC3 A;  1PIP A;  1JQP A;  2IBI A;  1CSB B;  2NQG A;  4Q8G A;  2FRA A;  1F29 A;  3USV A;  1TLO A;  1FH0 A;  1QOL A;  1PPO A;  2YJ2 A;  2DC7 A;  2HD5 A;  1AU3 A;  1SNK A;  4BS5 A;  4BPV A;  2DCB A;  1YK8 A;  3H8B A;  1POP A;  2ATO A;  3N4C A;  1M6D A;  5F02 A;  1CVZ A;  4P6E A;  5J94 A;  1NL6 A;  3TNX A;  1U5I A;  2P86 A;  4WA6 A;  5CHV A;  1YVB A;  3CH2 X;  2O6X A;  1VJV A;  4QRV A;  2R9F A;  2FQ9 A;  4OEL A;  6PAD A;  1Y4H A;  3DF0 A;  1ITO A;  2HHN A;  4BSQ A;  3QT4 A;  3WXF A;  3AI8 A;  2E01 A;  4KLB A;  1U9W A;  1NLJ A;  2VHF A;  3ZUA A;  1STF E;  1PPD A;  3CBJ A;  4AXM A;  4CDF B;  3F5V A;  1AEC A;  1EWM A;  1HUC B;  2XU5 A;  3HHA A;  1MEM A;  2DZZ A;  3LXS A;  1BP4 A;  3P5U A;  2P0R A;  1S4V A;  1AU0 A;  2YJB A;  2P7U A;  3M99 A;  2AIM A;  2R9O A;  2JQG R;  4XR7 A;  2DZY A;  1AU4 A;  4X6J A;  2AYN A;  4OEM A;  5A24 A;  2E02 A;  3PW3 A;  7PCK A;  2YJ9 A;  3IV2 A;  1QDQ A;  1IWD A;  3OF8 A;  4AXL A;  4MZO A;  3S3Q A;  1EWO A;  3KFQ A;  3K24 A;  3O0U A;  3WXG A;  1AYV A;  1PBH A;  3U8E A;  1K3B B;  3BPF A;  1KXR A;  5CVN B;  1BGO A;  2NQD B;  2NQI A;  3CH3 X;  3MHH A;  1O0E A;  1ME3 A;  1EWP A;  2AS8 A;  4YYW A;  3BCN A;  2IPP B;  1ZIV A;  4PP2 E;  3P5X A;  3E1Z B;  3MOR A;  3BOW A;  3P5W A;  3V6C A;  2B1M A;  1XKG A;  1TL9 A;  2Y5B A;  2R9C A;  3N3G A;  3OF9 A;  3PDF A;  1NQC A;  3KSE A;  1MS6 A;  4YYR A;  1TU6 A;  1U9X A;  3N3K A;  3PBH A;  2DC9 A;  1PXV A;  1U9V A;  3RVX A;  3V6E A;  4K7C A;  2FT2 A;  4CDD B;  4YV8 A;  4FK5 A;  1AYU A;  2PRE A;  3QJ3 A;  1CS8 A;  2CB5 A;  4MSX A;  1PPN A;  4YYS A;  2FO5 A;  1YT7 A;  2Y6E A;  1THE A;  4XUI A;  1GLO A;  2DJF B;  3HWN A;  1ZCM A;  2E00 A;  1PAD A;  2AYO A;  3H89 A;  4YYU A;  2F1G A;  5FPW A;  1GEC E;  3CBK A;  1QXP A;  3I3T A;  2G6D A;  4YYQ A;  1DF0 A;  1A6R A;  3QSD A;  1ME4 A;  1YK7 A;  4I07 A;  1KHQ A;  2CIO A;  1VSN A;  3K8U A;  2HH5 A;  4QRG A;  1F2A A;  3LFY A;  1AIM A;  2JQF R;  3KWB X;  4HWY A;  5JA7 A;  1GMY A;  3B79 A;  4PAD A;  2YJ8 A;  1KFU L;  1BY8 A;  4BS6 A;  5EF4 A;  2WBF X;  1Y08 A;  3GCB A;  1YAL A;  2OZ2 A;  2ARY A;  1MHW A;  2BDL A;  4Q8H A;  1X9Y A;  2AUZ A;  3H7D A;  1GCB A;  4W4U A;  2OP3 A;  9PAP A;  4RY2 A;  2XU4 A;  4PI3 A;  4I04 A;  3BPM A;  2XU3 A;  1MEG A;  1CQD A;  1NB3 A;  1CV8 A;  2FTD A;  1CJL A;  4I05 A;  4QH6 A;  4CDC B;  2G7Y A;  3F75 A;  3IOQ A;  3S3R A;  1EWL A;  4X6I A;  2DCD A;  4CDE B;  1EF7 A;  1DEU A;  5EGW A;  2ACT A;  1Q6K A;  2DC6 A;  2DCA A;  4PP1 A;  3IUT A;  5PAD A;  1PPP A;  5CVM A;  3IEJ A;  2DC8 A;  3OVZ A;  4DMX A;  4W5C A;  4N79 A;  1F2C A;  4MZS A;  2NQA A;  5CHT A;  4N4Z A;  2R6N A;  3ERV A;  1CTE A;  2VHS A; 
#chains in the Genus database with same CATH topology
 2GHU A;  3MTN A;  4R3D A;  1CPJ A;  1MDW A;  3H6S A;  2XU1 A;  3OIS A;  3HD3 A;  1F2B A;  3MJ5 A;  4BQV A;  2R9N A;  4X6H A;  1KHP A;  4YYV A;  4DMY A;  3IHP A;  4MM3 B;  4QRX A;  2FYE A;  1MIR A;  3D6S A;  4FJC A;  4D8E A;  2H7J A;  4D8I A;  2HXZ A;  4N8W A;  3RVW A;  2AU1 A;  2AVW A;  4W5B A;  4BOS A;  2F7D A;  2R9M A;  2FRQ A;  3H8C A;  3BB7 A;  1PE6 A;  4ZUX U;  2E03 A;  5K16 A;  1PCI A;  3OVX A;  1KFX L;  4BOZ A;  3IMA A;  4PT5 A;  1CB5 A;  3BWK A;  3KWZ A;  2PBH A;  4YVA A;  1BQI A;  2DCC A;  4P6G A;  3KX1 A;  4M0W A;  3K9M A;  4QBB A;  3HHI A;  3O65 A;  2B1N A;  2PNS A;  4FIP A;  1NB5 A;  3P5V A;  2GFO A;  3O1G A;  5JH3 A;  2J7Q C;  2C0Y A;  2AUX A;  1QMY A;  4MI7 A;  3I06 A;  4RF1 A;  3C9E A;  8PCH A;  2G8E A;  2FUD A;  1AYW A;  3RVV A;  3WXE A;  3MHS A;  4G54 A;  1ATK A;  2BDZ A;  2YJC A;  2PAD A;  1SP4 B;  3NHE A;  1U9Q X;  2G8J A;  3KKU A;  4CZW A;  3KW9 A;  1NPZ A;  1AU2 A;  1ICF A;  2OUL A;  3ZNH A;  5CVO B;  3PNR A;  5EZQ A;  2DJG B;  2FE8 A;  3BC3 A;  1PIP A;  1JQP A;  2IBI A;  2AGA A;  1CSB B;  2NQG A;  5EZS A;  4Q8G A;  2FRA A;  1F29 A;  3USV A;  1TLO A;  1FH0 A;  1QOL A;  1PPO A;  4D8B A;  2JRI A;  2YJ2 A;  2DC7 A;  2HD5 A;  3B21 A;  1AU3 A;  1SNK A;  4BS5 A;  2BTW A;  1YZB A;  4BPV A;  2DCB A;  1YK8 A;  3H8B A;  4BOU A;  1POP A;  2ATO A;  3N4C A;  1M6D A;  5F02 A;  1CVZ A;  4P6E A;  5J94 A;  1NL6 A;  3OQC A;  4ZTB A;  3TNX A;  1U5I A;  2P86 A;  4WA6 A;  5CHV A;  1YVB A;  3CH2 X;  2O6X A;  1VJV A;  4BOP A;  1PVJ A;  4RF0 A;  4BOQ A;  4QRV A;  2R9F A;  2FQ9 A;  4OEL A;  6PAD A;  1Y4H A;  3DF0 A;  3MP2 A;  1ITO A;  2HHN A;  2BU3 A;  4BSQ A;  3QT4 A;  3WXF A;  3AI8 A;  2E01 A;  4KLB A;  1U9W A;  1NLJ A;  2VHF A;  3ZUA A;  1STF E;  1PPD A;  3CBJ A;  4AXM A;  4CDF B;  3F5V A;  1AEC A;  1EWM A;  1HUC B;  2XU5 A;  3HHA A;  3E9S A;  1MEM A;  2DZZ A;  3LXS A;  1BP4 A;  2BTW B;  4WUR A;  2DOS A;  3P5U A;  2P0R A;  1S4V A;  1AU0 A;  2YJB A;  2J7Q A;  2P7U A;  3M99 A;  2AIM A;  2R9O A;  1DKI A;  2JQG R;  4XR7 A;  2DZY A;  1UKF A;  1AU4 A;  4X6J A;  2AYN A;  4OEM A;  3PRP A;  2HWK A;  5A24 A;  2E02 A;  3PW3 A;  7PCK A;  2YJ9 A;  3IV2 A;  1QDQ A;  1IWD A;  3OF8 A;  4AXL A;  4MZO A;  3PT2 A;  3S3Q A;  1EWO A;  3TMP A;  3KFQ A;  3K24 A;  3O0U A;  3PHX A;  3WXG A;  1AYV A;  1PBH A;  4GUA A;  3U8E A;  1K3B B;  3BPF A;  1KXR A;  5CVN B;  1BGO A;  2NQD B;  3PHW A;  2NQI A;  3CH3 X;  3MHH A;  4OW0 A;  1O0E A;  1ME3 A;  4RKX A;  1EWP A;  2AS8 A;  4REZ A;  5E6J A;  3BCN A;  4IUM A;  4YYW A;  2IPP B;  1ZIV A;  4PP2 E;  3P5X A;  3E1Z B;  3MOR A;  3BOW A;  3P5W A;  3V6C A;  2B1M A;  1XKG A;  1TL9 A;  3W30 A;  2Y5B A;  2R9C A;  3N3G A;  3OF9 A;  3PDF A;  1NQC A;  3KSE A;  4IP3 A;  1MS6 A;  4YYR A;  1TU6 A;  1U9X A;  3N3K A;  3PBH A;  2DC9 A;  1PXV A;  1U9V A;  3RVX A;  3V6E A;  4K7C A;  2FT2 A;  4CDD B;  4YV8 A;  4FK5 A;  1AYU A;  2PRE A;  3QJ3 A;  3TRK A;  1CS8 A;  2CB5 A;  4MSX A;  1PPN A;  4YYS A;  2FO5 A;  1YT7 A;  2Y6E A;  1THE A;  4XUI A;  1GLO A;  4P16 A;  2DJF B;  3HWN A;  1ZCM A;  2E00 A;  2Z84 A;  1PAD A;  2AYO A;  3H89 A;  4YYU A;  2F1G A;  5FPW A;  4OVZ B;  1GEC E;  3CBK A;  1QXP A;  3I3T A;  2G6D A;  4YYQ A;  1DF0 A;  1A6R A;  3QSD A;  1ME4 A;  3BY4 A;  5JZE A;  1YK7 A;  4I07 A;  1KHQ A;  2CIO A;  1VSN A;  3K8U A;  2HH5 A;  4QRG A;  1F2A A;  3LFY A;  4A5U A;  1AIM A;  2JQF R;  3KWB X;  4HWY A;  5JA7 A;  1GMY A;  3B79 A;  4PAD A;  2JTC A;  2YJ8 A;  1KFU L;  3W31 A;  1BY8 A;  4BS6 A;  5EF4 A;  2WBF X;  1Y08 A;  3GCB A;  1YAL A;  3PHU A;  2OZ2 A;  2ARY A;  1MHW A;  4OVZ A;  2BDL A;  4Q8H A;  1X9Y A;  2UZJ A;  2AUZ A;  4XZX A;  3H7D A;  4HXD B;  1GCB A;  4W4U A;  2OP3 A;  9PAP A;  4RY2 A;  2XU4 A;  4PI3 A;  3PRM A;  4I04 A;  3BPM A;  2XU3 A;  1MEG A;  1CQD A;  1NB3 A;  1CV8 A;  2FTD A;  1CJL A;  4I05 A;  4QH6 A;  4CDC B;  3C0R A;  3BBA A;  3F75 A;  2G7Y A;  3IOQ A;  3S3R A;  1EWL A;  4X6I A;  2DCD A;  4CDE B;  1EF7 A;  1DEU A;  5KO3 A;  5EGW A;  2ACT A;  1Q6K A;  2DC6 A;  2DCA A;  4PP1 A;  3IUT A;  3MTV A;  5PAD A;  1PPP A;  5CVM A;  3IEJ A;  3IFU A;  2DC8 A;  3OVZ A;  4DMX A;  4W5C A;  4N79 A;  1F2C A;  4MZS A;  2NQA A;  4RNA A;  3PSE A;  3RNV A;  5CHT A;  4N4Z A;  2R6N A;  3ERV A;  1CTE A;  2VHS A; 
#chains in the Genus database with same CATH homology
 2GHU A;  3MTN A;  1CPJ A;  1MDW A;  3H6S A;  2XU1 A;  3OIS A;  3HD3 A;  1F2B A;  4BQV A;  2R9N A;  4X6H A;  1KHP A;  4YYV A;  4DMY A;  3IHP A;  4QRX A;  2FYE A;  1MIR A;  3D6S A;  4FJC A;  2H7J A;  2HXZ A;  4N8W A;  3RVW A;  2AU1 A;  2AVW A;  4W5B A;  2F7D A;  2R9M A;  2FRQ A;  3H8C A;  1E2T A;  1PE6 A;  4ZUX U;  2E03 A;  5K16 A;  1PCI A;  3OVX A;  2BSZ A;  1KFX L;  4NV7 A;  3IMA A;  1CB5 A;  3BWK A;  3KWZ A;  2PBH A;  4YVA A;  1BQI A;  2DCC A;  4P6G A;  3KX1 A;  1W6F A;  3K9M A;  4QBB A;  3LTW A;  3HHI A;  2B1N A;  2PNS A;  4FIP A;  1NB5 A;  2GFO A;  3P5V A;  3O1G A;  5JH3 A;  2C0Y A;  2AUX A;  1QMY A;  3I06 A;  3C9E A;  8PCH A;  2G8E A;  2FUD A;  1AYW A;  3RVV A;  3WXE A;  3MHS A;  4G54 A;  1ATK A;  2BDZ A;  2YJC A;  2PAD A;  4NV8 A;  1SP4 B;  3NHE A;  1U9Q X;  2G8J A;  3KKU A;  4CZW A;  3KW9 A;  1NPZ A;  1W5R A;  1AU2 A;  1ICF A;  2OUL A;  5CVO B;  3PNR A;  2DJG B;  3BC3 A;  1PIP A;  1JQP A;  2IBI A;  1CSB B;  2NQG A;  4Q8G A;  2FRA A;  1F29 A;  3USV A;  1TLO A;  1FH0 A;  1QOL A;  1PPO A;  2YJ2 A;  2DC7 A;  2HD5 A;  1AU3 A;  1SNK A;  4BS5 A;  4BPV A;  2DCB A;  1YK8 A;  3H8B A;  1POP A;  2ATO A;  3N4C A;  1M6D A;  5F02 A;  1CVZ A;  4P6E A;  5J94 A;  1NL6 A;  3TNX A;  1U5I A;  2P86 A;  4WA6 A;  5CHV A;  1YVB A;  3CH2 X;  2O6X A;  1VJV A;  3D9W A;  4QRV A;  2R9F A;  2FQ9 A;  4OEL A;  6PAD A;  1Y4H A;  2VFB A;  3DF0 A;  4BGF A;  1ITO A;  2HHN A;  4BSQ A;  3QT4 A;  3WXF A;  3AI8 A;  2E01 A;  4KLB A;  1U9W A;  1NLJ A;  2VHF A;  3ZUA A;  1STF E;  1PPD A;  3CBJ A;  4AXM A;  4CDF B;  3F5V A;  1AEC A;  1EWM A;  1HUC B;  2XU5 A;  3HHA A;  1MEM A;  2DZZ A;  3LXS A;  1BP4 A;  3P5U A;  2P0R A;  1S4V A;  1AU0 A;  2YJB A;  2P7U A;  3M99 A;  2AIM A;  2R9O A;  2JQG R;  4XR7 A;  2DZY A;  1AU4 A;  4X6J A;  2AYN A;  4OEM A;  5A24 A;  2E02 A;  3PW3 A;  7PCK A;  2YJ9 A;  3IV2 A;  1QDQ A;  1IWD A;  3OF8 A;  4AXL A;  4MZO A;  3S3Q A;  1EWO A;  3KFQ A;  3K24 A;  3O0U A;  3WXG A;  1AYV A;  1PBH A;  3U8E A;  1GX3 A;  1K3B B;  3BPF A;  1KXR A;  5CVN B;  1BGO A;  2NQD B;  2NQI A;  3CH3 X;  1W4T A;  3MHH A;  1O0E A;  1ME3 A;  1EWP A;  2AS8 A;  4YYW A;  3BCN A;  2IPP B;  1ZIV A;  4PP2 E;  3P5X A;  3E1Z B;  3MOR A;  3BOW A;  3P5W A;  3V6C A;  2B1M A;  1XKG A;  1TL9 A;  2Y5B A;  2R9C A;  3N3G A;  3OF9 A;  3PDF A;  1NQC A;  3KSE A;  1MS6 A;  4YYR A;  1TU6 A;  1U9X A;  3N3K A;  3PBH A;  2DC9 A;  1PXV A;  4B55 A;  1U9V A;  3RVX A;  3V6E A;  4K7C A;  2FT2 A;  4CDD B;  4YV8 A;  4FK5 A;  1AYU A;  2PRE A;  3QJ3 A;  1CS8 A;  2CB5 A;  4MSX A;  1PPN A;  4YYS A;  2FO5 A;  1YT7 A;  2Y6E A;  1THE A;  4XUI A;  1GLO A;  2DJF B;  3HWN A;  1ZCM A;  2E00 A;  1PAD A;  2AYO A;  3H89 A;  4YYU A;  2F1G A;  5FPW A;  1GEC E;  3CBK A;  1QXP A;  3I3T A;  2G6D A;  4YYQ A;  1DF0 A;  1A6R A;  3QSD A;  1ME4 A;  1YK7 A;  2VFC A;  4I07 A;  1KHQ A;  2CIO A;  1VSN A;  3K8U A;  2HH5 A;  4QRG A;  1F2A A;  3LFY A;  1AIM A;  2JQF R;  3KWB X;  4HWY A;  4C5P A;  5JA7 A;  1GMY A;  3B79 A;  4PAD A;  2YJ8 A;  1KFU L;  1BY8 A;  4BS6 A;  5EF4 A;  2WBF X;  1Y08 A;  3GCB A;  1YAL A;  2OZ2 A;  2ARY A;  1MHW A;  2BDL A;  4Q8H A;  1X9Y A;  2AUZ A;  3H7D A;  1GCB A;  4W4U A;  2OP3 A;  9PAP A;  4RY2 A;  2XU4 A;  4PI3 A;  4I04 A;  3BPM A;  2XU3 A;  1MEG A;  1CQD A;  1NB3 A;  1CV8 A;  2FTD A;  1CJL A;  4I05 A;  4QH6 A;  4CDC B;  2G7Y A;  3F75 A;  3IOQ A;  3S3R A;  1EWL A;  4X6I A;  2DCD A;  4CDE B;  1EF7 A;  1DEU A;  5EGW A;  2ACT A;  1Q6K A;  4GUZ A;  2DC6 A;  2DCA A;  4PP1 A;  3IUT A;  5PAD A;  1PPP A;  5CVM A;  3IEJ A;  2DC8 A;  3OVZ A;  4DMX A;  4W5C A;  4N79 A;  1F2C A;  4MZS A;  2NQA A;  5CHT A;  4N4Z A;  2R6N A;  3ERV A;  1CTE A;  2VHS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...