2F1GA

Cathepsin s in complex with non-covalent 2-(benzoxazol-2-ylamino)-acetamide
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
220
structure length
220
Chain Sequence
NRILPDSVDWREKGCVTEVKYQGSCGACWAFSAVGALEAQLKLKTGKLVSLSAQNLVDCSTEKYGNKGCNGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYDSKYRAATCSKYTELPYGREDVLKEAVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSWGHNFGEEGYIRMARNKGNHCGIASFPSYPEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Synthesis and evaluation of arylaminoethyl amides as noncovalent inhibitors of cathepsin S. Part 3: Heterocyclic P3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Cathepsin S
total genus 68
structure length 220
sequence length 220
chains with identical sequence B
ec nomenclature ec 3.4.22.27: Cathepsin S.
pdb deposition date 2005-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2f1gA00
4CZWA 3CH2X 2F1GA 1U9XA 2B1MA 3P5VA 3IOQA 4QH6A 1NQCA 2E03A 3RVVA 1JQPA 1PXVA 3DF0A 3OF8A 1YK7A 1TLOA 3IUTA 4BQVA 1HUCB 5JA7A 1KXRA 1NL6A 1CQDA 4XUIA 2CIOA 1ZIVA 1ME3A 2FT2A 1K3BB 1ME4A 3N3GA 1CB5A 5CVOB 3WXFA 2E02A 2FRQA 3ZUAA 2AUXA 3C9EA 1O0EA 2R9CA 2G7YA 3IV2A 3RVXA 4I04A 4BSQA 1BY8A 2P86A 4X6JA 1FH0A 2HD5A 3WXEA 3K24A 2VHFA 2IPPB 1Y08A 5CVMA 1PPDA 2FQ9A 4K7CA 4QRVA 3LFYA 1A6RA 3PW3A 1U9VA 2FUDA 3B79A 1XKGA 3IHPA 4MZSA 1QMYA 1SNKA 3H8CA 3P5UA 2R9OA 9PAPA 1MEGA 2VHSA 4YYQA 4MZOA 3F75A 4FIPA 2R9NA 1PBHA 1GLOA 1EWMA 1PCIA 3QT4A 2R9FA 4CDEB 1QOLA 1BP4A 3KW9A 3BPFA 5F02A 2DCCA 4P6GA 1BQIA 3KSEA 3O1GA 3QJ3A 1AU4A 1ATKA 4I07A 5EF4A 4BPVA 2AUZA 4DMYA 1YK8A 2P0RA 1NB3A 4YYRA 2P7UA 3BPMA 2HHNA 3OISA 2DCAA 2DC9A 2OP3A 4XR7A 3KFQA 2YJCA 2BDZA 3I06A 4AXLA 1CJLA 5CVNB 1NPZA 3CBJA 1AU0A 3H7DA 1U9WA 1IWDA 2DCBA 2GFOA 1NLJA 2DZZA 4DMXA 4Q8HA 1EF7A 5JH3A 2G8EA 2NQIA 4CDCB 1YALA 3HWNA 1U5IA 1Y4HA 1NB5A 2YJBA 3HHIA 3N3KA 3PDFA 3K8UA 1BGOA 3CH3X 3H89A 4Q8GA 4FJCA 1KHQA 2DJGB 2AIMA 1CV8A 2XU1A 2IBIA 6PADA 3OVZA 3LXSA 2GHUA 3WXGA 1CS8A 3BWKA 2BDLA 5K16A 3E1ZB 2G8JA 3O0UA 4PP1A 3KKUA 2PNSA 4QRGA 1S4VA 2DC8A 2AYNA 3OVXA 4P6EA 8PCHA 3BOWA 4W5BA 2XU3A 2JQGR 1TU6A 2ACTA 2DC6A 2PBHA 4YYVA 5FPWA 1CPJA 2WBFX 3D6SA 1GMYA 3HD3A 3M99A 3I3TA 3P5XA 1PPOA 1EWLA 4BS5A 1F29A 2H7JA 2DJFB 3OF9A 3HHAA 4OELA 1KHPA 3N4CA 2R6NA 1PPNA 3RVWA 4QBBA 2ARYA 2C0YA 1KFXL 3KX1A 1EWPA 3CBKA 1MEMA 3F5VA 4N8WA 3MORA 3ERVA 4W4UA 2AYOA 5CHVA 5PADA 2AVWA 2HH5A 1F2AA 1VJVA 4RY2A 1EWOA 1CSBB 2E01A 5A24A 5J94A 4X6HA 4QRXA 4CDFB 1VSNA 2OULA 1DF0A 1ICFA 2FRAA 2DC7A 3IMAA 4FK5A 2PADA 2AS8A 1AIMA 1AU3A 1AYVA 4N79A 1POPA 4YYWA 4PP2E 1AYUA 1F2CA 1PADA 1CVZA 4WA6A 4PI3A 2NQGA 4W5CA 4CDDB 3MHSA 4MSXA 4AXMA 4X6IA 2CB5A 1ITOA 3S3QA 2G6DA 1YT7A 1GECE 2FO5A 2DZYA 3AI8A 1STFE 1DEUA 2FTDA 4N4ZA 1MS6A 2YJ9A 3S3RA 7PCKA 1CTEA 1KFUL 4KLBA 3MHHA 2Y6EA 1MIRA 2XU5A 5CHTA 2R9MA 2JQFR 3GCBA 4BS6A 1F2BA 2OZ2A 3NHEA 1Q6KA 1GCBA 3IEJA 2E00A 1M6DA 4YVAA 3BCNA 3MTNA 1AECA 4OEMA 1AYWA 1ZCMA 3QSDA 2AU1A 2YJ2A 2NQAA 3USVA 4ZUXU 4YYUA 2PREA 4HWYA 2NQDB 3KWZA 1THEA 2HXZA 3KWBX 1YVBA 4YV8A 1PE6A 3PBHA 1PIPA 4I05A 4G54A 3P5WA 1AU2A 3H8BA 3V6CA 1MHWA 2ATOA 2O6XA 1U9QX 2F7DA 3V6EA 1SP4B 2DCDA 2XU4A 3H6SA 1TL9A 1X9YA 2B1NA 2FYEA 3U8EA 3BC3A 3TNXA 1PPPA 4YYSA 5EGWA 4PADA 1QDQA 3K9MA 1MDWA 2Y5BA 1QXPA 3PNRA 2YJ8A
chains in the Genus database with same CATH superfamily
4CZWA 3CH2X 2F1GA 2JRIA 1U9XA 2B1MA 3P5VA 3IOQA 4QH6A 1NQCA 2E03A 3RVVA 1JQPA 1PXVA 4RF1A 3DF0A 3OF8A 1YK7A 1TLOA 3IUTA 3PHWA 4MI7A 4BQVA 1HUCB 5JA7A 1KXRA 1NL6A 1CQDA 4XUIA 2CIOA 1ZIVA 1ME3A 2FT2A 1K3BB 1ME4A 3N3GA 1CB5A 4M0WA 5CVOB 3WXFA 2E02A 4D8EA 2FRQA 3ZUAA 2AUXA 3C9EA 1O0EA 4D8IA 2AGAA 2R9CA 2G7YA 3IV2A 3RVXA 2JTCA 4D8BA 4I04A 4BSQA 1BY8A 2P86A 1FH0A 4X6JA 2HD5A 3WXEA 3K24A 2VHFA 2IPPB 1Y08A 5CVMA 1PPDA 2FQ9A 4K7CA 3RNVA 4QRVA 3LFYA 1A6RA 3PW3A 4ZTBA 1U9VA 2FUDA 3B79A 1XKGA 3IHPA 4MZSA 1QMYA 1SNKA 3H8CA 3P5UA 2R9OA 9PAPA 1MEGA 2VHSA 4YYQA 4A5UA 3ZNHA 4MZOA 3F75A 3OQCA 4FIPA 2R9NA 2BTWA 1PBHA 1GLOA 1EWMA 1PCIA 1UKFA 3QT4A 3PHUA 2Z84A 1DKIA 2R9FA 4CDEB 1QOLA 1BP4A 3KW9A 3BPFA 5F02A 2J7QA 2DCCA 4P6GA 1BQIA 3KSEA 3O1GA 3QJ3A 1AU4A 1ATKA 2DOSA 4I07A 5EF4A 4BPVA 2AUZA 4RNAA 4DMYA 1YK8A 2P0RA 1NB3A 4YYRA 2P7UA 3BPMA 2HHNA 3OISA 3PRMA 2DCAA 3MTVA 4BOSA 2DC9A 2OP3A 5KO3A 4XR7A 3KFQA 2YJCA 2BDZA 3I06A 4AXLA 1CJLA 5CVNB 1NPZA 4HXDB 3W30A 3CBJA 1AU0A 3MJ5A 3H7DA 1U9WA 3O65A 1IWDA 2DCBA 2GFOA 4PT5A 1NLJA 3E9SA 2DZZA 4REZA 4DMXA 4Q8HA 1EF7A 5JH3A 2G8EA 2NQIA 4CDCB 1YALA 3HWNA 1U5IA 1Y4HA 4OVZA 1NB5A 2YJBA 3HHIA 3N3KA 3PDFA 3K8UA 1BGOA 3CH3X 3H89A 4Q8GA 4FJCA 1KHQA 2DJGB 2AIMA 4RKXA 1CV8A 2XU1A 2BTWB 2IBIA 6PADA 3OVZA 3LXSA 2GHUA 3BB7A 3PSEA 3WXGA 1CS8A 4WURA 3BWKA 2BDLA 5K16A 3E1ZB 4GUAA 2G8JA 2FE8A 3O0UA 4PP1A 3KKUA 2PNSA 4QRGA 1S4VA 2DC8A 2AYNA 3OVXA 4P6EA 8PCHA 3BOWA 4RF0A 4IP3A 4W5BA 2XU3A 4OVZB 2JQGR 1TU6A 2ACTA 4OW0A 2DC6A 2PBHA 4YYVA 5FPWA 1CPJA 2WBFX 3PT2A 2BU3A 3D6SA 1GMYA 3HD3A 3M99A 3I3TA 2J7QC 3P5XA 1PPOA 1EWLA 4BS5A 1F29A 2H7JA 2DJFB 3OF9A 3HHAA 4OELA 1KHPA 3N4CA 5EZQA 2R6NA 1PPNA 3RVWA 3B21A 4QBBA 2ARYA 2C0YA 1KFXL 3KX1A 1EWPA 3CBKA 1MEMA 3F5VA 4N8WA 3MORA 3ERVA 4W4UA 2AYOA 5CHVA 3BY4A 5PADA 2AVWA 2HH5A 1F2AA 1VJVA 4RY2A 1EWOA 1CSBB 2E01A 5A24A 3BBAA 1YZBA 5J94A 4X6HA 4QRXA 4BOPA 4CDFB 1VSNA 2OULA 1DF0A 1ICFA 2FRAA 2DC7A 3IMAA 4FK5A 2PADA 2AS8A 1AIMA 1AU3A 3PHXA 1AYVA 5EZSA 4N79A 1POPA 4YYWA 4PP2E 1AYUA 1F2CA 1PADA 1CVZA 4WA6A 4PI3A 2NQGA 4W5CA 4CDDB 3MHSA 4MSXA 3TMPA 4AXMA 4X6IA 2CB5A 1ITOA 1PVJA 3S3QA 2G6DA 1YT7A 1GECE 2FO5A 2DZYA 3AI8A 1STFE 1DEUA 2FTDA 2UZJA 4N4ZA 1MS6A 2YJ9A 3S3RA 7PCKA 1CTEA 1KFUL 4KLBA 3MHHA 2Y6EA 1MIRA 2XU5A 5CHTA 2R9MA 2JQFR 5E6JA 4BOQA 3GCBA 4BS6A 1F2BA 2OZ2A 3NHEA 4BOUA 1Q6KA 1GCBA 3IEJA 3W31A 2E00A 1M6DA 4YVAA 3BCNA 3MTNA 1AECA 4OEMA 1AYWA 1ZCMA 4XZXA 3TRKA 3QSDA 2AU1A 3C0RA 2YJ2A 3MP2A 4R3DA 2NQAA 3USVA 4ZUXU 4YYUA 2PREA 3IFUA 4MM3B 4HWYA 4P16A 4BOZA 2NQDB 3KWZA 1THEA 2HXZA 3KWBX 1YVBA 4YV8A 1PE6A 3PBHA 1PIPA 4I05A 4G54A 3P5WA 1AU2A 3H8BA 3V6CA 1MHWA 2ATOA 2O6XA 1U9QX 2F7DA 3V6EA 1SP4B 2DCDA 2XU4A 3H6SA 1TL9A 3PRPA 1X9YA 2B1NA 2FYEA 3U8EA 3BC3A 3TNXA 5JZEA 1PPPA 4IUMA 4YYSA 5EGWA 4PADA 1QDQA 3K9MA 1MDWA 2Y5BA 1QXPA 3PNRA 2YJ8A 2HWKA
chains in the Genus database with same CATH topology
4CZWA 3CH2X 2F1GA 1U9XA 2B1MA 3P5VA 3IOQA 4GUZA 4QH6A 1NQCA 2E03A 3RVVA 1JQPA 1PXVA 3DF0A 3OF8A 1YK7A 1TLOA 3IUTA 4BQVA 1HUCB 5JA7A 1KXRA 1NL6A 1CQDA 4XUIA 2CIOA 1ZIVA 1ME3A 2FT2A 1K3BB 1ME4A 3N3GA 1CB5A 5CVOB 3WXFA 2E02A 2FRQA 3ZUAA 2AUXA 3C9EA 1O0EA 2R9CA 2G7YA 3IV2A 4BGFA 3RVXA 4I04A 4BSQA 1BY8A 2P86A 4X6JA 1FH0A 2HD5A 3WXEA 3K24A 2VHFA 2IPPB 1Y08A 5CVMA 1PPDA 2FQ9A 4K7CA 4QRVA 3LFYA 1A6RA 3PW3A 1U9VA 2FUDA 3B79A 1XKGA 3IHPA 4MZSA 1QMYA 2BSZA 1SNKA 3H8CA 3P5UA 2R9OA 9PAPA 1MEGA 2VHSA 4YYQA 4MZOA 3F75A 4FIPA 2R9NA 1PBHA 1GLOA 1EWMA 1PCIA 3QT4A 2R9FA 4CDEB 1QOLA 1BP4A 3KW9A 3BPFA 5F02A 2DCCA 4P6GA 1BQIA 3KSEA 3O1GA 3QJ3A 1AU4A 1ATKA 4I07A 5EF4A 4BPVA 2AUZA 4DMYA 1YK8A 2P0RA 1NB3A 4YYRA 2P7UA 3BPMA 2HHNA 3OISA 2DCAA 2DC9A 2OP3A 4XR7A 3KFQA 2YJCA 2BDZA 3I06A 4AXLA 1CJLA 5CVNB 1NPZA 3CBJA 1AU0A 3H7DA 1U9WA 1IWDA 2DCBA 2GFOA 1NLJA 2DZZA 4DMXA 3LTWA 4Q8HA 1EF7A 2VFBA 5JH3A 2G8EA 2NQIA 4CDCB 1YALA 3HWNA 1U5IA 1Y4HA 1NB5A 1E2TA 4NV8A 2YJBA 3HHIA 3N3KA 3PDFA 4C5PA 3K8UA 1BGOA 3CH3X 3H89A 4Q8GA 4FJCA 1KHQA 1W6FA 2DJGB 2AIMA 1CV8A 2XU1A 2IBIA 6PADA 3OVZA 3LXSA 2GHUA 4NV7A 3WXGA 1CS8A 3BWKA 2BDLA 5K16A 3E1ZB 2G8JA 3O0UA 4PP1A 3KKUA 2PNSA 4QRGA 1S4VA 2DC8A 2AYNA 3OVXA 4P6EA 8PCHA 4B55A 3BOWA 4W5BA 2XU3A 2JQGR 1TU6A 2ACTA 3D9WA 2DC6A 2PBHA 4YYVA 5FPWA 1CPJA 2WBFX 3D6SA 1GMYA 3HD3A 3M99A 3I3TA 3P5XA 1PPOA 1EWLA 4BS5A 1F29A 2H7JA 2DJFB 3OF9A 3HHAA 4OELA 1KHPA 3N4CA 2R6NA 1PPNA 3RVWA 4QBBA 2ARYA 2C0YA 1KFXL 3KX1A 1EWPA 3CBKA 1MEMA 3F5VA 4N8WA 3MORA 3ERVA 4W4UA 2AYOA 5CHVA 5PADA 2AVWA 2HH5A 1F2AA 1VJVA 4RY2A 1EWOA 1CSBB 2E01A 5A24A 5J94A 4X6HA 4QRXA 4CDFB 1VSNA 2OULA 1DF0A 1ICFA 2FRAA 2DC7A 3IMAA 4FK5A 2PADA 2AS8A 1AIMA 1AU3A 1AYVA 4N79A 1POPA 4YYWA 4PP2E 1AYUA 1F2CA 1PADA 1CVZA 4WA6A 4PI3A 1GX3A 2NQGA 4W5CA 4CDDB 3MHSA 4MSXA 4AXMA 4X6IA 2CB5A 1ITOA 3S3QA 2G6DA 1YT7A 1GECE 1W5RA 2FO5A 2DZYA 3AI8A 1STFE 1DEUA 2FTDA 4N4ZA 1MS6A 2YJ9A 3S3RA 7PCKA 1CTEA 1KFUL 4KLBA 3MHHA 2Y6EA 1MIRA 2XU5A 5CHTA 2R9MA 2JQFR 3GCBA 4BS6A 1F2BA 2OZ2A 3NHEA 1Q6KA 1GCBA 3IEJA 2E00A 1M6DA 4YVAA 3BCNA 3MTNA 1AECA 4OEMA 1AYWA 1ZCMA 3QSDA 2AU1A 2YJ2A 2NQAA 3USVA 4ZUXU 4YYUA 2PREA 2VFCA 4HWYA 2NQDB 3KWZA 1THEA 2HXZA 3KWBX 1YVBA 4YV8A 1PE6A 3PBHA 1PIPA 4I05A 4G54A 3P5WA 1AU2A 3H8BA 3V6CA 1MHWA 2ATOA 2O6XA 1U9QX 2F7DA 3V6EA 1SP4B 1W4TA 2DCDA 2XU4A 3H6SA 1TL9A 1X9YA 2B1NA 2FYEA 3U8EA 3BC3A 3TNXA 1PPPA 4YYSA 5EGWA 4PADA 1QDQA 3K9MA 1MDWA 2Y5BA 1QXPA 3PNRA 2YJ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CZW A;  3CH2 X;  2F1G A;  1U9X A;  2B1M A;  3P5V A;  3IOQ A;  4QH6 A;  1NQC A;  2E03 A;  3RVV A;  1JQP A;  1PXV A;  3DF0 A;  3OF8 A;  1YK7 A;  1TLO A;  3IUT A;  4BQV A;  1HUC B;  5JA7 A;  1KXR A;  1NL6 A;  1CQD A;  4XUI A;  2CIO A;  1ZIV A;  1ME3 A;  2FT2 A;  1K3B B;  1ME4 A;  3N3G A;  1CB5 A;  5CVO B;  3WXF A;  2E02 A;  2FRQ A;  3ZUA A;  2AUX A;  3C9E A;  1O0E A;  2R9C A;  2G7Y A;  3IV2 A;  3RVX A;  4I04 A;  4BSQ A;  1BY8 A;  2P86 A;  4X6J A;  1FH0 A;  2HD5 A;  3WXE A;  3K24 A;  2VHF A;  2IPP B;  1Y08 A;  5CVM A;  1PPD A;  2FQ9 A;  4K7C A;  4QRV A;  3LFY A;  1A6R A;  3PW3 A;  1U9V A;  2FUD A;  3B79 A;  1XKG A;  3IHP A;  4MZS A;  1QMY A;  1SNK A;  3H8C A;  3P5U A;  2R9O A;  9PAP A;  1MEG A;  2VHS A;  4YYQ A;  4MZO A;  3F75 A;  4FIP A;  2R9N A;  1PBH A;  1GLO A;  1EWM A;  1PCI A;  3QT4 A;  2R9F A;  4CDE B;  1QOL A;  1BP4 A;  3KW9 A;  3BPF A;  5F02 A;  2DCC A;  4P6G A;  1BQI A;  3KSE A;  3O1G A;  3QJ3 A;  1AU4 A;  1ATK A;  4I07 A;  5EF4 A;  4BPV A;  2AUZ A;  4DMY A;  1YK8 A;  2P0R A;  1NB3 A;  4YYR A;  2P7U A;  3BPM A;  2HHN A;  3OIS A;  2DCA A;  2DC9 A;  2OP3 A;  4XR7 A;  3KFQ A;  2YJC A;  2BDZ A;  3I06 A;  4AXL A;  1CJL A;  5CVN B;  1NPZ A;  3CBJ A;  1AU0 A;  3H7D A;  1U9W A;  1IWD A;  2DCB A;  2GFO A;  1NLJ A;  2DZZ A;  4DMX A;  4Q8H A;  1EF7 A;  5JH3 A;  2G8E A;  2NQI A;  4CDC B;  1YAL A;  3HWN A;  1U5I A;  1Y4H A;  1NB5 A;  2YJB A;  3HHI A;  3N3K A;  3PDF A;  3K8U A;  1BGO A;  3CH3 X;  3H89 A;  4Q8G A;  4FJC A;  1KHQ A;  2DJG B;  2AIM A;  1CV8 A;  2XU1 A;  2IBI A;  6PAD A;  3OVZ A;  3LXS A;  2GHU A;  3WXG A;  1CS8 A;  3BWK A;  2BDL A;  5K16 A;  3E1Z B;  2G8J A;  3O0U A;  4PP1 A;  3KKU A;  2PNS A;  4QRG A;  1S4V A;  2DC8 A;  2AYN A;  3OVX A;  4P6E A;  8PCH A;  3BOW A;  4W5B A;  2XU3 A;  2JQG R;  1TU6 A;  2ACT A;  2DC6 A;  2PBH A;  4YYV A;  5FPW A;  1CPJ A;  2WBF X;  3D6S A;  1GMY A;  3HD3 A;  3M99 A;  3I3T A;  3P5X A;  1PPO A;  1EWL A;  4BS5 A;  1F29 A;  2H7J A;  2DJF B;  3OF9 A;  3HHA A;  4OEL A;  1KHP A;  3N4C A;  2R6N A;  1PPN A;  3RVW A;  4QBB A;  2ARY A;  2C0Y A;  1KFX L;  3KX1 A;  1EWP A;  3CBK A;  1MEM A;  3F5V A;  4N8W A;  3MOR A;  3ERV A;  4W4U A;  2AYO A;  5CHV A;  5PAD A;  2AVW A;  2HH5 A;  1F2A A;  1VJV A;  4RY2 A;  1EWO A;  1CSB B;  2E01 A;  5A24 A;  5J94 A;  4X6H A;  4QRX A;  4CDF B;  1VSN A;  2OUL A;  1DF0 A;  1ICF A;  2FRA A;  2DC7 A;  3IMA A;  4FK5 A;  2PAD A;  2AS8 A;  1AIM A;  1AU3 A;  1AYV A;  4N79 A;  1POP A;  4YYW A;  4PP2 E;  1AYU A;  1F2C A;  1PAD A;  1CVZ A;  4WA6 A;  4PI3 A;  2NQG A;  4W5C A;  4CDD B;  3MHS A;  4MSX A;  4AXM A;  4X6I A;  2CB5 A;  1ITO A;  3S3Q A;  2G6D A;  1YT7 A;  1GEC E;  2FO5 A;  2DZY A;  3AI8 A;  1STF E;  1DEU A;  2FTD A;  4N4Z A;  1MS6 A;  2YJ9 A;  3S3R A;  7PCK A;  1CTE A;  1KFU L;  4KLB A;  3MHH A;  2Y6E A;  1MIR A;  2XU5 A;  5CHT A;  2R9M A;  2JQF R;  3GCB A;  4BS6 A;  1F2B A;  2OZ2 A;  3NHE A;  1Q6K A;  1GCB A;  3IEJ A;  2E00 A;  1M6D A;  4YVA A;  3BCN A;  3MTN A;  1AEC A;  4OEM A;  1AYW A;  1ZCM A;  3QSD A;  2AU1 A;  2YJ2 A;  2NQA A;  3USV A;  4ZUX U;  4YYU A;  2PRE A;  4HWY A;  2NQD B;  3KWZ A;  1THE A;  2HXZ A;  3KWB X;  1YVB A;  4YV8 A;  1PE6 A;  3PBH A;  1PIP A;  4I05 A;  4G54 A;  3P5W A;  1AU2 A;  3H8B A;  3V6C A;  1MHW A;  2ATO A;  2O6X A;  1U9Q X;  2F7D A;  3V6E A;  1SP4 B;  2DCD A;  2XU4 A;  3H6S A;  1TL9 A;  1X9Y A;  2B1N A;  2FYE A;  3U8E A;  3BC3 A;  3TNX A;  1PPP A;  4YYS A;  5EGW A;  4PAD A;  1QDQ A;  3K9M A;  1MDW A;  2Y5B A;  1QXP A;  3PNR A;  2YJ8 A; 
#chains in the Genus database with same CATH topology
 4CZW A;  3CH2 X;  2F1G A;  2JRI A;  1U9X A;  2B1M A;  3P5V A;  3IOQ A;  4QH6 A;  1NQC A;  2E03 A;  3RVV A;  1JQP A;  1PXV A;  4RF1 A;  3DF0 A;  3OF8 A;  1YK7 A;  1TLO A;  3IUT A;  3PHW A;  4MI7 A;  4BQV A;  1HUC B;  5JA7 A;  1KXR A;  1NL6 A;  1CQD A;  4XUI A;  2CIO A;  1ZIV A;  1ME3 A;  2FT2 A;  1K3B B;  1ME4 A;  3N3G A;  1CB5 A;  4M0W A;  5CVO B;  3WXF A;  2E02 A;  4D8E A;  2FRQ A;  3ZUA A;  2AUX A;  3C9E A;  1O0E A;  4D8I A;  2AGA A;  2R9C A;  2G7Y A;  3IV2 A;  3RVX A;  2JTC A;  4D8B A;  4I04 A;  4BSQ A;  1BY8 A;  2P86 A;  1FH0 A;  4X6J A;  2HD5 A;  3WXE A;  3K24 A;  2VHF A;  2IPP B;  1Y08 A;  5CVM A;  1PPD A;  2FQ9 A;  4K7C A;  3RNV A;  4QRV A;  3LFY A;  1A6R A;  3PW3 A;  4ZTB A;  1U9V A;  2FUD A;  3B79 A;  1XKG A;  3IHP A;  4MZS A;  1QMY A;  1SNK A;  3H8C A;  3P5U A;  2R9O A;  9PAP A;  1MEG A;  2VHS A;  4YYQ A;  4A5U A;  3ZNH A;  4MZO A;  3F75 A;  3OQC A;  4FIP A;  2R9N A;  2BTW A;  1PBH A;  1GLO A;  1EWM A;  1PCI A;  1UKF A;  3QT4 A;  3PHU A;  2Z84 A;  1DKI A;  2R9F A;  4CDE B;  1QOL A;  1BP4 A;  3KW9 A;  3BPF A;  5F02 A;  2J7Q A;  2DCC A;  4P6G A;  1BQI A;  3KSE A;  3O1G A;  3QJ3 A;  1AU4 A;  1ATK A;  2DOS A;  4I07 A;  5EF4 A;  4BPV A;  2AUZ A;  4RNA A;  4DMY A;  1YK8 A;  2P0R A;  1NB3 A;  4YYR A;  2P7U A;  3BPM A;  2HHN A;  3OIS A;  3PRM A;  2DCA A;  3MTV A;  4BOS A;  2DC9 A;  2OP3 A;  5KO3 A;  4XR7 A;  3KFQ A;  2YJC A;  2BDZ A;  3I06 A;  4AXL A;  1CJL A;  5CVN B;  1NPZ A;  4HXD B;  3W30 A;  3CBJ A;  1AU0 A;  3MJ5 A;  3H7D A;  1U9W A;  3O65 A;  1IWD A;  2DCB A;  2GFO A;  4PT5 A;  1NLJ A;  3E9S A;  2DZZ A;  4REZ A;  4DMX A;  4Q8H A;  1EF7 A;  5JH3 A;  2G8E A;  2NQI A;  4CDC B;  1YAL A;  3HWN A;  1U5I A;  1Y4H A;  4OVZ A;  1NB5 A;  2YJB A;  3HHI A;  3N3K A;  3PDF A;  3K8U A;  1BGO A;  3CH3 X;  3H89 A;  4Q8G A;  4FJC A;  1KHQ A;  2DJG B;  2AIM A;  4RKX A;  1CV8 A;  2XU1 A;  2BTW B;  2IBI A;  6PAD A;  3OVZ A;  3LXS A;  2GHU A;  3BB7 A;  3PSE A;  3WXG A;  1CS8 A;  4WUR A;  3BWK A;  2BDL A;  5K16 A;  3E1Z B;  4GUA A;  2G8J A;  2FE8 A;  3O0U A;  4PP1 A;  3KKU A;  2PNS A;  4QRG A;  1S4V A;  2DC8 A;  2AYN A;  3OVX A;  4P6E A;  8PCH A;  3BOW A;  4RF0 A;  4IP3 A;  4W5B A;  2XU3 A;  4OVZ B;  2JQG R;  1TU6 A;  2ACT A;  4OW0 A;  2DC6 A;  2PBH A;  4YYV A;  5FPW A;  1CPJ A;  2WBF X;  3PT2 A;  2BU3 A;  3D6S A;  1GMY A;  3HD3 A;  3M99 A;  3I3T A;  2J7Q C;  3P5X A;  1PPO A;  1EWL A;  4BS5 A;  1F29 A;  2H7J A;  2DJF B;  3OF9 A;  3HHA A;  4OEL A;  1KHP A;  3N4C A;  5EZQ A;  2R6N A;  1PPN A;  3RVW A;  3B21 A;  4QBB A;  2ARY A;  2C0Y A;  1KFX L;  3KX1 A;  1EWP A;  3CBK A;  1MEM A;  3F5V A;  4N8W A;  3MOR A;  3ERV A;  4W4U A;  2AYO A;  5CHV A;  3BY4 A;  5PAD A;  2AVW A;  2HH5 A;  1F2A A;  1VJV A;  4RY2 A;  1EWO A;  1CSB B;  2E01 A;  5A24 A;  3BBA A;  1YZB A;  5J94 A;  4X6H A;  4QRX A;  4BOP A;  4CDF B;  1VSN A;  2OUL A;  1DF0 A;  1ICF A;  2FRA A;  2DC7 A;  3IMA A;  4FK5 A;  2PAD A;  2AS8 A;  1AIM A;  1AU3 A;  3PHX A;  1AYV A;  5EZS A;  4N79 A;  1POP A;  4YYW A;  4PP2 E;  1AYU A;  1F2C A;  1PAD A;  1CVZ A;  4WA6 A;  4PI3 A;  2NQG A;  4W5C A;  4CDD B;  3MHS A;  4MSX A;  3TMP A;  4AXM A;  4X6I A;  2CB5 A;  1ITO A;  1PVJ A;  3S3Q A;  2G6D A;  1YT7 A;  1GEC E;  2FO5 A;  2DZY A;  3AI8 A;  1STF E;  1DEU A;  2FTD A;  2UZJ A;  4N4Z A;  1MS6 A;  2YJ9 A;  3S3R A;  7PCK A;  1CTE A;  1KFU L;  4KLB A;  3MHH A;  2Y6E A;  1MIR A;  2XU5 A;  5CHT A;  2R9M A;  2JQF R;  5E6J A;  4BOQ A;  3GCB A;  4BS6 A;  1F2B A;  2OZ2 A;  3NHE A;  4BOU A;  1Q6K A;  1GCB A;  3IEJ A;  3W31 A;  2E00 A;  1M6D A;  4YVA A;  3BCN A;  3MTN A;  1AEC A;  4OEM A;  1AYW A;  1ZCM A;  4XZX A;  3TRK A;  3QSD A;  2AU1 A;  3C0R A;  2YJ2 A;  3MP2 A;  4R3D A;  2NQA A;  3USV A;  4ZUX U;  4YYU A;  2PRE A;  3IFU A;  4MM3 B;  4HWY A;  4P16 A;  4BOZ A;  2NQD B;  3KWZ A;  1THE A;  2HXZ A;  3KWB X;  1YVB A;  4YV8 A;  1PE6 A;  3PBH A;  1PIP A;  4I05 A;  4G54 A;  3P5W A;  1AU2 A;  3H8B A;  3V6C A;  1MHW A;  2ATO A;  2O6X A;  1U9Q X;  2F7D A;  3V6E A;  1SP4 B;  2DCD A;  2XU4 A;  3H6S A;  1TL9 A;  3PRP A;  1X9Y A;  2B1N A;  2FYE A;  3U8E A;  3BC3 A;  3TNX A;  5JZE A;  1PPP A;  4IUM A;  4YYS A;  5EGW A;  4PAD A;  1QDQ A;  3K9M A;  1MDW A;  2Y5B A;  1QXP A;  3PNR A;  2YJ8 A;  2HWK A; 
#chains in the Genus database with same CATH homology
 4CZW A;  3CH2 X;  2F1G A;  1U9X A;  2B1M A;  3P5V A;  3IOQ A;  4GUZ A;  4QH6 A;  1NQC A;  2E03 A;  3RVV A;  1JQP A;  1PXV A;  3DF0 A;  3OF8 A;  1YK7 A;  1TLO A;  3IUT A;  4BQV A;  1HUC B;  5JA7 A;  1KXR A;  1NL6 A;  1CQD A;  4XUI A;  2CIO A;  1ZIV A;  1ME3 A;  2FT2 A;  1K3B B;  1ME4 A;  3N3G A;  1CB5 A;  5CVO B;  3WXF A;  2E02 A;  2FRQ A;  3ZUA A;  2AUX A;  3C9E A;  1O0E A;  2R9C A;  2G7Y A;  3IV2 A;  4BGF A;  3RVX A;  4I04 A;  4BSQ A;  1BY8 A;  2P86 A;  4X6J A;  1FH0 A;  2HD5 A;  3WXE A;  3K24 A;  2VHF A;  2IPP B;  1Y08 A;  5CVM A;  1PPD A;  2FQ9 A;  4K7C A;  4QRV A;  3LFY A;  1A6R A;  3PW3 A;  1U9V A;  2FUD A;  3B79 A;  1XKG A;  3IHP A;  4MZS A;  1QMY A;  2BSZ A;  1SNK A;  3H8C A;  3P5U A;  2R9O A;  9PAP A;  1MEG A;  2VHS A;  4YYQ A;  4MZO A;  3F75 A;  4FIP A;  2R9N A;  1PBH A;  1GLO A;  1EWM A;  1PCI A;  3QT4 A;  2R9F A;  4CDE B;  1QOL A;  1BP4 A;  3KW9 A;  3BPF A;  5F02 A;  2DCC A;  4P6G A;  1BQI A;  3KSE A;  3O1G A;  3QJ3 A;  1AU4 A;  1ATK A;  4I07 A;  5EF4 A;  4BPV A;  2AUZ A;  4DMY A;  1YK8 A;  2P0R A;  1NB3 A;  4YYR A;  2P7U A;  3BPM A;  2HHN A;  3OIS A;  2DCA A;  2DC9 A;  2OP3 A;  4XR7 A;  3KFQ A;  2YJC A;  2BDZ A;  3I06 A;  4AXL A;  1CJL A;  5CVN B;  1NPZ A;  3CBJ A;  1AU0 A;  3H7D A;  1U9W A;  1IWD A;  2DCB A;  2GFO A;  1NLJ A;  2DZZ A;  4DMX A;  3LTW A;  4Q8H A;  1EF7 A;  2VFB A;  5JH3 A;  2G8E A;  2NQI A;  4CDC B;  1YAL A;  3HWN A;  1U5I A;  1Y4H A;  1NB5 A;  1E2T A;  4NV8 A;  2YJB A;  3HHI A;  3N3K A;  3PDF A;  4C5P A;  3K8U A;  1BGO A;  3CH3 X;  3H89 A;  4Q8G A;  4FJC A;  1KHQ A;  1W6F A;  2DJG B;  2AIM A;  1CV8 A;  2XU1 A;  2IBI A;  6PAD A;  3OVZ A;  3LXS A;  2GHU A;  4NV7 A;  3WXG A;  1CS8 A;  3BWK A;  2BDL A;  5K16 A;  3E1Z B;  2G8J A;  3O0U A;  4PP1 A;  3KKU A;  2PNS A;  4QRG A;  1S4V A;  2DC8 A;  2AYN A;  3OVX A;  4P6E A;  8PCH A;  4B55 A;  3BOW A;  4W5B A;  2XU3 A;  2JQG R;  1TU6 A;  2ACT A;  3D9W A;  2DC6 A;  2PBH A;  4YYV A;  5FPW A;  1CPJ A;  2WBF X;  3D6S A;  1GMY A;  3HD3 A;  3M99 A;  3I3T A;  3P5X A;  1PPO A;  1EWL A;  4BS5 A;  1F29 A;  2H7J A;  2DJF B;  3OF9 A;  3HHA A;  4OEL A;  1KHP A;  3N4C A;  2R6N A;  1PPN A;  3RVW A;  4QBB A;  2ARY A;  2C0Y A;  1KFX L;  3KX1 A;  1EWP A;  3CBK A;  1MEM A;  3F5V A;  4N8W A;  3MOR A;  3ERV A;  4W4U A;  2AYO A;  5CHV A;  5PAD A;  2AVW A;  2HH5 A;  1F2A A;  1VJV A;  4RY2 A;  1EWO A;  1CSB B;  2E01 A;  5A24 A;  5J94 A;  4X6H A;  4QRX A;  4CDF B;  1VSN A;  2OUL A;  1DF0 A;  1ICF A;  2FRA A;  2DC7 A;  3IMA A;  4FK5 A;  2PAD A;  2AS8 A;  1AIM A;  1AU3 A;  1AYV A;  4N79 A;  1POP A;  4YYW A;  4PP2 E;  1AYU A;  1F2C A;  1PAD A;  1CVZ A;  4WA6 A;  4PI3 A;  1GX3 A;  2NQG A;  4W5C A;  4CDD B;  3MHS A;  4MSX A;  4AXM A;  4X6I A;  2CB5 A;  1ITO A;  3S3Q A;  2G6D A;  1YT7 A;  1GEC E;  1W5R A;  2FO5 A;  2DZY A;  3AI8 A;  1STF E;  1DEU A;  2FTD A;  4N4Z A;  1MS6 A;  2YJ9 A;  3S3R A;  7PCK A;  1CTE A;  1KFU L;  4KLB A;  3MHH A;  2Y6E A;  1MIR A;  2XU5 A;  5CHT A;  2R9M A;  2JQF R;  3GCB A;  4BS6 A;  1F2B A;  2OZ2 A;  3NHE A;  1Q6K A;  1GCB A;  3IEJ A;  2E00 A;  1M6D A;  4YVA A;  3BCN A;  3MTN A;  1AEC A;  4OEM A;  1AYW A;  1ZCM A;  3QSD A;  2AU1 A;  2YJ2 A;  2NQA A;  3USV A;  4ZUX U;  4YYU A;  2PRE A;  2VFC A;  4HWY A;  2NQD B;  3KWZ A;  1THE A;  2HXZ A;  3KWB X;  1YVB A;  4YV8 A;  1PE6 A;  3PBH A;  1PIP A;  4I05 A;  4G54 A;  3P5W A;  1AU2 A;  3H8B A;  3V6C A;  1MHW A;  2ATO A;  2O6X A;  1U9Q X;  2F7D A;  3V6E A;  1SP4 B;  1W4T A;  2DCD A;  2XU4 A;  3H6S A;  1TL9 A;  1X9Y A;  2B1N A;  2FYE A;  3U8E A;  3BC3 A;  3TNX A;  1PPP A;  4YYS A;  5EGW A;  4PAD A;  1QDQ A;  3K9M A;  1MDW A;  2Y5B A;  1QXP A;  3PNR A;  2YJ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...