2F1GA

Cathepsin s in complex with non-covalent 2-(benzoxazol-2-ylamino)-acetamide
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
220
structure length
220
Chain Sequence
b'NRILPDSVDWREKGCVTEVKYQGSCGACWAFSAVGALEAQLKLKTGKLVSLSAQNLVDCSTEKYGNKGCNGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYDSKYRAATCSKYTELPYGREDVLKEAVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSWGHNFGEEGYIRMARNKGNHCGIASFPSYPEI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cathepsin S
publication title Synthesis and evaluation of arylaminoethyl amides as noncovalent inhibitors of cathepsin S. Part 3: Heterocyclic P3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 68
structure length 220
sequence length 220
chains with identical sequence B
ec nomenclature ec 3.4.22.27: Cathepsin S.
pdb deposition date 2005-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2f1gA00
3KWZA 5EGWA 4QRXA 5K16A 4AXLA 1GCBA 3MHHA 2H7JA 4Q8GA 3IEJA 4X6HA 4X6JA 2F7DA 4OEMA 1AU3A 2B1NA 2AYOA 1MIRA 2PADA 3USVA 2HD5A 2OP3A 4CDDB 1PIPA 1AU4A 3P5WA 1ZIVA 3OISA 5CVMA 1PPOA 1QXPA 4DMYA 1NB5A 2DC8A 2G7YA 3D6SA 3MORA 2P7UA 2AS8A 3PNRA 5J94A 1CJLA 4CDCB 3AI8A 3RVVA 2IPPB 4QRGA 3H89A 3LXSA 4N4ZA 3E1ZB 1NQCA 2DC7A 2DJGB 1KFXL 1O0EA 2DCBA 1ITOA 2P0RA 1U9XA 5CHVA 4W4UA 5PADA 8PCHA 1HUCB 2FTDA 4PP2E 2VHFA 3H8CA 4MSXA 2R9FA 2FUDA 2YJCA 2R9NA 4WA6A 1NB3A 3P5XA 3CH2X 1BP4A 2AU1A 4I04A 1KHPA 1MDWA 3I3TA 3IV2A 5CVNB 2DC9A 1PXVA 3K24A 3MHSA 2YJ9A 3CBKA 3GCBA 5A24A 7PCKA 3HHIA 3DF0A 1ME3A 1BY8A 4QRVA 5F02A 3BWKA 1SP4B 1CQDA 2R9OA 3F5VA 4X6IA 1DF0A 2Y6EA 1YT7A 1ME4A 3BC3A 2YJBA 1XKGA 4AXMA 2G6DA 3P5VA 3N3GA 2DCDA 1GLOA 3H7DA 3HWNA 1GECE 4DMXA 1PPNA 2R6NA 2DCCA 1POPA 2P86A 2PREA 2JQGR 4BS5A 3PBHA 1CTEA 2YJ2A 3RVXA 3H6SA 3QT4A 1EWLA 3V6CA 4Q8HA 4MZOA 3K8UA 4YYWA 2PNSA 3N3KA 1AIMA 1PCIA 4HWYA 3PW3A 2FT2A 2FYEA 1AYWA 2HH5A 4W5BA 1QMYA 3PDFA 4YYRA 2DJFB 1AU2A 4BSQA 2XU3A 1ICFA 1A6RA 1THEA 1CS8A 3HHAA 1JQPA 2ARYA 3KX1A 3QSDA 3KFQA 1DEUA 1PBHA 2FO5A 3BOWA 3KWBX 1F2CA 2ACTA 1SNKA 4BS6A 1NL6A 1TLOA 3KW9A 1TL9A 4KLBA 1MEGA 2PBHA 4FIPA 4I05A 3S3QA 1AU0A 2JQFR 4YYQA 2R9MA 4YVAA 2AUXA 4YYUA 1U9VA 1CPJA 4QH6A 9PAPA 3B79A 4XR7A 2AVWA 1F2BA 3WXFA 1U9WA 1CB5A 6PADA 3F75A 5JA7A 2O6XA 2G8EA 3ERVA 3M99A 2G8JA 3NHEA 1X9YA 4P6GA 1QOLA 1YK7A 1AYUA 1GMYA 1F2AA 3O0UA 4BPVA 3KKUA 1EWMA 1Q6KA 3BPMA 2NQIA 4PI3A 4YYVA 2FQ9A 3V6EA 3C9EA 4CDFB 2B1MA 1VJVA 2E01A 4OELA 4FK5A 1NPZA 1K3BB 3IMAA 1FH0A 1AECA 2BDZA 1CSBB 4W5CA 2CB5A 2DC6A 1ATKA 1TU6A 2DZYA 1MHWA 1S4VA 4K7CA 2VHSA 1AYVA 1PPDA 1ZCMA 3H8BA 5FPWA 3BPFA 4N8WA 2CIOA 3OVZA 3MTNA 3O1GA 2HXZA 1F29A 1EF7A 1EWOA 1U9QX 1VSNA 2NQGA 1MS6A 4PADA 2GFOA 2FRQA 4P6EA 2OULA 4G54A 4N79A 2BDLA 3KSEA 4CZWA 3OF8A 1YVBA 1PADA 1KXRA 4ZUXU 5JH3A 1CVZA 2R9CA 3N4CA 5CVOB 1QDQA 4YYSA 1STFE 3WXGA 3BCNA 3OVXA 3WXEA 2XU1A 2YJ8A 1NLJA 3LFYA 2IBIA 2DZZA 2NQDB 1YK8A 4PP1A 1PE6A 4CDEB 3S3RA 2E02A 2C0YA 3HD3A 4FJCA 2DCAA 2ATOA 4QBBA 3P5UA 2OZ2A 3OF9A 2HHNA 1PPPA 4MZSA 2E00A 2GHUA 1KFUL 3I06A 1U5IA 1CV8A 2WBFX 1KHQA 3K9MA 2Y5BA 2E03A 5CHTA 2XU5A 4BQVA 1BGOA 1M6DA 4RY2A 4YV8A 5EF4A 1IWDA 1Y4HA 3QJ3A 3CH3X 4I07A 3IOQA 4XUIA 1MEMA 3IHPA 2AUZA 2AYNA 1BQIA 3RVWA 1Y08A 3IUTA 2XU4A 2AIMA 1YALA 2FRAA 3U8EA 2NQAA 3TNXA 2F1GA 3ZUAA 3CBJA 1EWPA
chains in the Genus database with same CATH superfamily
3KWZA 5EGWA 4QRXA 5K16A 4AXLA 1GCBA 3MHHA 2H7JA 4Q8GA 3IEJA 4X6HA 4X6JA 2F7DA 4OEMA 1AU3A 2B1NA 2AYOA 1MIRA 2PADA 3USVA 2HD5A 2OP3A 4CDDB 4RKXA 1PIPA 1AU4A 3P5WA 1ZIVA 3OISA 5CVMA 1PPOA 2J7QA 1QXPA 3RNVA 3BY4A 4DMYA 1NB5A 2DC8A 1UKFA 2G7YA 3D6SA 3MORA 2P7UA 2AS8A 3OQCA 3PNRA 5J94A 1CJLA 4BOUA 4CDCB 3AI8A 3RVVA 4MM3B 2IPPB 4QRGA 3PSEA 3H89A 3LXSA 4N4ZA 3E1ZB 1NQCA 2DC7A 4BOPA 2DJGB 1KFXL 1O0EA 2DCBA 1ITOA 2P0RA 3PRMA 1U9XA 5CHVA 5E6JA 4W4UA 5PADA 4BOQA 4M0WA 8PCHA 1HUCB 2FE8A 2FTDA 4PP2E 2VHFA 3TMPA 3H8CA 4MSXA 2R9FA 2FUDA 2YJCA 2R9NA 4WA6A 1NB3A 3P5XA 3CH2X 1BP4A 2AU1A 4I04A 4BOSA 1KHPA 1MDWA 3I3TA 3IV2A 5CVNB 3B21A 2DC9A 4D8BA 3C0RA 4D8EA 1PXVA 3K24A 3MHSA 2YJ9A 3PHXA 3CBKA 3GCBA 5A24A 7PCKA 3HHIA 3MJ5A 3DF0A 1ME3A 1BY8A 4QRVA 5F02A 3PRPA 3BWKA 1SP4B 1CQDA 2R9OA 3F5VA 4X6IA 1DF0A 2Y6EA 5KO3A 1YT7A 1ME4A 3BC3A 2YJBA 3TRKA 2AGAA 1XKGA 4AXMA 2G6DA 3P5VA 3N3GA 2DCDA 1GLOA 3H7DA 3HWNA 1GECE 4DMXA 1PPNA 2R6NA 2DCCA 1POPA 4BOZA 2P86A 2PREA 2JQGR 4BS5A 3PBHA 1CTEA 2YJ2A 3RVXA 3H6SA 3PHUA 3QT4A 1EWLA 4IP3A 3V6CA 4Q8HA 4MZOA 3K8UA 3PT2A 2BTWB 4YYWA 3ZNHA 2PNSA 3N3KA 1AIMA 2Z84A 1PCIA 4D8IA 4HWYA 4RF0A 3PW3A 2FT2A 2FYEA 1AYWA 2HH5A 4W5BA 1QMYA 3PDFA 4YYRA 2DJFB 1AU2A 4MI7A 4BSQA 2XU3A 1ICFA 1A6RA 1THEA 1CS8A 3HHAA 3BBAA 1JQPA 2ARYA 3O65A 3KX1A 1DKIA 3QSDA 3KFQA 1DEUA 3W30A 1PVJA 1PBHA 2FO5A 3BOWA 3KWBX 1F2CA 2ACTA 1SNKA 4BS6A 4ZTBA 1NL6A 1TLOA 2J7QC 3KW9A 1TL9A 4KLBA 1MEGA 2PBHA 4FIPA 4I05A 3S3QA 1AU0A 2JQFR 4YYQA 2R9MA 4YVAA 2AUXA 4YYUA 1U9VA 1CPJA 4QH6A 4REZA 9PAPA 2BTWA 3B79A 2HWKA 4XR7A 3IFUA 2AVWA 1F2BA 3WXFA 1U9WA 1CB5A 6PADA 3BB7A 3F75A 5JA7A 2UZJA 2O6XA 2G8EA 3ERVA 3M99A 2JRIA 2G8JA 3NHEA 1X9YA 4P6GA 4HXDB 1QOLA 1YK7A 1AYUA 1GMYA 1F2AA 4WURA 3O0UA 4BPVA 3KKUA 1EWMA 1Q6KA 3BPMA 2NQIA 4PI3A 4YYVA 4A5UA 2FQ9A 3V6EA 3C9EA 4CDFB 2B1MA 1VJVA 2E01A 4OELA 4FK5A 1NPZA 1K3BB 3IMAA 1FH0A 1AECA 2BDZA 1CSBB 4W5CA 2CB5A 2DC6A 4IUMA 1ATKA 1TU6A 2DZYA 1MHWA 1S4VA 3E9SA 4K7CA 2VHSA 1AYVA 2DOSA 4PT5A 1PPDA 1ZCMA 4GUAA 3H8BA 4XZXA 3BPFA 4OVZB 1YZBA 4N8WA 5FPWA 4RF1A 2CIOA 3OVZA 3MTNA 3O1GA 2HXZA 1F29A 1EF7A 1EWOA 1U9QX 1VSNA 2NQGA 1MS6A 4PADA 2GFOA 5EZSA 2FRQA 4P6EA 2OULA 4G54A 4N79A 2BDLA 3KSEA 4CZWA 2JTCA 3OF8A 1YVBA 1PADA 1KXRA 3W31A 5JH3A 4ZUXU 1CVZA 2R9CA 3N4CA 2BU3A 5CVOB 1QDQA 4YYSA 1STFE 3WXGA 3BCNA 3OVXA 3WXEA 2XU1A 2YJ8A 4RNAA 1NLJA 3LFYA 2IBIA 2DZZA 2NQDB 1YK8A 4PP1A 1PE6A 4CDEB 3S3RA 2E02A 3MP2A 2C0YA 3HD3A 4FJCA 2DCAA 4R3DA 2ATOA 4P16A 4QBBA 3P5UA 2OZ2A 3OF9A 2HHNA 1PPPA 4MZSA 2E00A 2GHUA 1KFUL 3I06A 4OVZA 1U5IA 1CV8A 2WBFX 1KHQA 3K9MA 2Y5BA 2E03A 5CHTA 2XU5A 4BQVA 5EZQA 4OW0A 1BGOA 3PHWA 1M6DA 4RY2A 4YV8A 5EF4A 1IWDA 1Y4HA 3QJ3A 3CH3X 4I07A 3IOQA 4XUIA 1MEMA 3IHPA 2AUZA 2AYNA 1BQIA 3RVWA 1Y08A 3IUTA 2XU4A 2AIMA 1YALA 2FRAA 3U8EA 5JZEA 2NQAA 3MTVA 3TNXA 2F1GA 3ZUAA 3CBJA 1EWPA
chains in the Genus database with same CATH topology
3KWZA 5EGWA 4QRXA 5K16A 4AXLA 1GCBA 3MHHA 2H7JA 4Q8GA 3IEJA 4X6HA 4X6JA 2F7DA 4OEMA 1AU3A 2B1NA 2AYOA 1MIRA 2PADA 3USVA 2HD5A 2OP3A 4CDDB 1PIPA 1AU4A 3P5WA 1ZIVA 3OISA 5CVMA 1PPOA 1QXPA 4DMYA 1NB5A 2DC8A 2G7YA 3D6SA 3MORA 2P7UA 2AS8A 3PNRA 5J94A 1CJLA 4CDCB 3AI8A 3RVVA 2IPPB 4QRGA 3H89A 3LXSA 1GX3A 4N4ZA 3E1ZB 1NQCA 2DC7A 2DJGB 1KFXL 1O0EA 2DCBA 1ITOA 2P0RA 1U9XA 5CHVA 4W4UA 2BSZA 5PADA 8PCHA 1HUCB 2FTDA 4PP2E 2VHFA 3H8CA 4MSXA 2R9FA 2FUDA 2YJCA 2R9NA 4WA6A 1NB3A 3P5XA 3CH2X 1BP4A 2AU1A 4I04A 1KHPA 1MDWA 3I3TA 3IV2A 5CVNB 2DC9A 1PXVA 3K24A 3MHSA 2YJ9A 3CBKA 3GCBA 5A24A 7PCKA 3HHIA 3DF0A 1ME3A 1BY8A 4QRVA 5F02A 3BWKA 1SP4B 1CQDA 2R9OA 3F5VA 4X6IA 1DF0A 2Y6EA 1YT7A 1ME4A 3BC3A 2YJBA 1XKGA 4AXMA 2G6DA 3P5VA 3N3GA 2DCDA 1GLOA 3H7DA 3HWNA 1GECE 4DMXA 1PPNA 2R6NA 1W6FA 2DCCA 1POPA 2P86A 2PREA 2JQGR 4BS5A 3PBHA 1CTEA 2YJ2A 3RVXA 3H6SA 4BGFA 3QT4A 1EWLA 3V6CA 4Q8HA 4MZOA 3K8UA 4YYWA 2PNSA 3N3KA 1AIMA 1PCIA 4HWYA 3PW3A 2FT2A 2FYEA 1AYWA 2HH5A 4W5BA 1QMYA 3PDFA 4YYRA 2DJFB 1AU2A 3D9WA 4BSQA 2XU3A 1ICFA 1A6RA 1THEA 1CS8A 1W5RA 3HHAA 1JQPA 2ARYA 3KX1A 3LTWA 3QSDA 3KFQA 1DEUA 1PBHA 2FO5A 3BOWA 3KWBX 1F2CA 2ACTA 1SNKA 4BS6A 1NL6A 1TLOA 3KW9A 1TL9A 4KLBA 1MEGA 2PBHA 4B55A 4FIPA 4I05A 3S3QA 1AU0A 2JQFR 4YYQA 2R9MA 4YVAA 2AUXA 4YYUA 1U9VA 1CPJA 4QH6A 9PAPA 3B79A 4XR7A 2AVWA 1F2BA 3WXFA 1U9WA 1CB5A 1W4TA 6PADA 3F75A 5JA7A 2O6XA 2G8EA 3ERVA 3M99A 2G8JA 3NHEA 1X9YA 4P6GA 1QOLA 1YK7A 1AYUA 1GMYA 1F2AA 3O0UA 4BPVA 3KKUA 1EWMA 1Q6KA 3BPMA 2NQIA 4PI3A 4YYVA 2FQ9A 3V6EA 3C9EA 4CDFB 2B1MA 1VJVA 2E01A 4OELA 4FK5A 1NPZA 1K3BB 3IMAA 1FH0A 1AECA 2BDZA 1CSBB 4W5CA 2CB5A 2DC6A 1ATKA 1TU6A 2DZYA 1MHWA 1S4VA 4GUZA 4K7CA 2VHSA 1AYVA 1PPDA 1ZCMA 3H8BA 5FPWA 3BPFA 4N8WA 2CIOA 3OVZA 3MTNA 3O1GA 2HXZA 1F29A 1EF7A 1EWOA 1U9QX 1VSNA 2NQGA 1MS6A 4PADA 2GFOA 2FRQA 4P6EA 2OULA 4C5PA 4G54A 4N79A 2BDLA 3KSEA 4CZWA 3OF8A 1YVBA 1PADA 1KXRA 4ZUXU 5JH3A 1CVZA 4NV8A 2R9CA 3N4CA 5CVOB 1QDQA 4YYSA 1STFE 3WXGA 3BCNA 3OVXA 3WXEA 2XU1A 2YJ8A 1NLJA 3LFYA 2IBIA 2DZZA 2NQDB 1YK8A 4PP1A 1PE6A 4CDEB 3S3RA 2E02A 2C0YA 3HD3A 4FJCA 2DCAA 2ATOA 4QBBA 3P5UA 2OZ2A 3OF9A 2HHNA 1PPPA 4MZSA 2E00A 2GHUA 1KFUL 3I06A 1U5IA 2VFBA 1CV8A 2WBFX 1KHQA 3K9MA 2Y5BA 2E03A 5CHTA 2XU5A 4BQVA 1BGOA 2VFCA 1M6DA 4RY2A 4YV8A 5EF4A 1IWDA 1Y4HA 3QJ3A 3CH3X 4I07A 3IOQA 4XUIA 4NV7A 1MEMA 3IHPA 2AUZA 2AYNA 1BQIA 3RVWA 1Y08A 3IUTA 2XU4A 2AIMA 1YALA 1E2TA 2FRAA 3U8EA 2NQAA 3TNXA 2F1GA 3ZUAA 3CBJA 1EWPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KWZ A;  5EGW A;  4QRX A;  5K16 A;  4AXL A;  1GCB A;  3MHH A;  2H7J A;  4Q8G A;  3IEJ A;  4X6H A;  4X6J A;  2F7D A;  4OEM A;  1AU3 A;  2B1N A;  2AYO A;  1MIR A;  2PAD A;  3USV A;  2HD5 A;  2OP3 A;  4CDD B;  1PIP A;  1AU4 A;  3P5W A;  1ZIV A;  3OIS A;  5CVM A;  1PPO A;  1QXP A;  4DMY A;  1NB5 A;  2DC8 A;  2G7Y A;  3D6S A;  3MOR A;  2P7U A;  2AS8 A;  3PNR A;  5J94 A;  1CJL A;  4CDC B;  3AI8 A;  3RVV A;  2IPP B;  4QRG A;  3H89 A;  3LXS A;  4N4Z A;  3E1Z B;  1NQC A;  2DC7 A;  2DJG B;  1KFX L;  1O0E A;  2DCB A;  1ITO A;  2P0R A;  1U9X A;  5CHV A;  4W4U A;  5PAD A;  8PCH A;  1HUC B;  2FTD A;  4PP2 E;  2VHF A;  3H8C A;  4MSX A;  2R9F A;  2FUD A;  2YJC A;  2R9N A;  4WA6 A;  1NB3 A;  3P5X A;  3CH2 X;  1BP4 A;  2AU1 A;  4I04 A;  1KHP A;  1MDW A;  3I3T A;  3IV2 A;  5CVN B;  2DC9 A;  1PXV A;  3K24 A;  3MHS A;  2YJ9 A;  3CBK A;  3GCB A;  5A24 A;  7PCK A;  3HHI A;  3DF0 A;  1ME3 A;  1BY8 A;  4QRV A;  5F02 A;  3BWK A;  1SP4 B;  1CQD A;  2R9O A;  3F5V A;  4X6I A;  1DF0 A;  2Y6E A;  1YT7 A;  1ME4 A;  3BC3 A;  2YJB A;  1XKG A;  4AXM A;  2G6D A;  3P5V A;  3N3G A;  2DCD A;  1GLO A;  3H7D A;  3HWN A;  1GEC E;  4DMX A;  1PPN A;  2R6N A;  2DCC A;  1POP A;  2P86 A;  2PRE A;  2JQG R;  4BS5 A;  3PBH A;  1CTE A;  2YJ2 A;  3RVX A;  3H6S A;  3QT4 A;  1EWL A;  3V6C A;  4Q8H A;  4MZO A;  3K8U A;  4YYW A;  2PNS A;  3N3K A;  1AIM A;  1PCI A;  4HWY A;  3PW3 A;  2FT2 A;  2FYE A;  1AYW A;  2HH5 A;  4W5B A;  1QMY A;  3PDF A;  4YYR A;  2DJF B;  1AU2 A;  4BSQ A;  2XU3 A;  1ICF A;  1A6R A;  1THE A;  1CS8 A;  3HHA A;  1JQP A;  2ARY A;  3KX1 A;  3QSD A;  3KFQ A;  1DEU A;  1PBH A;  2FO5 A;  3BOW A;  3KWB X;  1F2C A;  2ACT A;  1SNK A;  4BS6 A;  1NL6 A;  1TLO A;  3KW9 A;  1TL9 A;  4KLB A;  1MEG A;  2PBH A;  4FIP A;  4I05 A;  3S3Q A;  1AU0 A;  2JQF R;  4YYQ A;  2R9M A;  4YVA A;  2AUX A;  4YYU A;  1U9V A;  1CPJ A;  4QH6 A;  9PAP A;  3B79 A;  4XR7 A;  2AVW A;  1F2B A;  3WXF A;  1U9W A;  1CB5 A;  6PAD A;  3F75 A;  5JA7 A;  2O6X A;  2G8E A;  3ERV A;  3M99 A;  2G8J A;  3NHE A;  1X9Y A;  4P6G A;  1QOL A;  1YK7 A;  1AYU A;  1GMY A;  1F2A A;  3O0U A;  4BPV A;  3KKU A;  1EWM A;  1Q6K A;  3BPM A;  2NQI A;  4PI3 A;  4YYV A;  2FQ9 A;  3V6E A;  3C9E A;  4CDF B;  2B1M A;  1VJV A;  2E01 A;  4OEL A;  4FK5 A;  1NPZ A;  1K3B B;  3IMA A;  1FH0 A;  1AEC A;  2BDZ A;  1CSB B;  4W5C A;  2CB5 A;  2DC6 A;  1ATK A;  1TU6 A;  2DZY A;  1MHW A;  1S4V A;  4K7C A;  2VHS A;  1AYV A;  1PPD A;  1ZCM A;  3H8B A;  5FPW A;  3BPF A;  4N8W A;  2CIO A;  3OVZ A;  3MTN A;  3O1G A;  2HXZ A;  1F29 A;  1EF7 A;  1EWO A;  1U9Q X;  1VSN A;  2NQG A;  1MS6 A;  4PAD A;  2GFO A;  2FRQ A;  4P6E A;  2OUL A;  4G54 A;  4N79 A;  2BDL A;  3KSE A;  4CZW A;  3OF8 A;  1YVB A;  1PAD A;  1KXR A;  4ZUX U;  5JH3 A;  1CVZ A;  2R9C A;  3N4C A;  5CVO B;  1QDQ A;  4YYS A;  1STF E;  3WXG A;  3BCN A;  3OVX A;  3WXE A;  2XU1 A;  2YJ8 A;  1NLJ A;  3LFY A;  2IBI A;  2DZZ A;  2NQD B;  1YK8 A;  4PP1 A;  1PE6 A;  4CDE B;  3S3R A;  2E02 A;  2C0Y A;  3HD3 A;  4FJC A;  2DCA A;  2ATO A;  4QBB A;  3P5U A;  2OZ2 A;  3OF9 A;  2HHN A;  1PPP A;  4MZS A;  2E00 A;  2GHU A;  1KFU L;  3I06 A;  1U5I A;  1CV8 A;  2WBF X;  1KHQ A;  3K9M A;  2Y5B A;  2E03 A;  5CHT A;  2XU5 A;  4BQV A;  1BGO A;  1M6D A;  4RY2 A;  4YV8 A;  5EF4 A;  1IWD A;  1Y4H A;  3QJ3 A;  3CH3 X;  4I07 A;  3IOQ A;  4XUI A;  1MEM A;  3IHP A;  2AUZ A;  2AYN A;  1BQI A;  3RVW A;  1Y08 A;  3IUT A;  2XU4 A;  2AIM A;  1YAL A;  2FRA A;  3U8E A;  2NQA A;  3TNX A;  2F1G A;  3ZUA A;  3CBJ A;  1EWP A; 
#chains in the Genus database with same CATH topology
 3KWZ A;  5EGW A;  4QRX A;  5K16 A;  4AXL A;  1GCB A;  3MHH A;  2H7J A;  4Q8G A;  3IEJ A;  4X6H A;  4X6J A;  2F7D A;  4OEM A;  1AU3 A;  2B1N A;  2AYO A;  1MIR A;  2PAD A;  3USV A;  2HD5 A;  2OP3 A;  4CDD B;  4RKX A;  1PIP A;  1AU4 A;  3P5W A;  1ZIV A;  3OIS A;  5CVM A;  1PPO A;  2J7Q A;  1QXP A;  3RNV A;  3BY4 A;  4DMY A;  1NB5 A;  2DC8 A;  1UKF A;  2G7Y A;  3D6S A;  3MOR A;  2P7U A;  2AS8 A;  3OQC A;  3PNR A;  5J94 A;  1CJL A;  4BOU A;  4CDC B;  3AI8 A;  3RVV A;  4MM3 B;  2IPP B;  4QRG A;  3PSE A;  3H89 A;  3LXS A;  4N4Z A;  3E1Z B;  1NQC A;  2DC7 A;  4BOP A;  2DJG B;  1KFX L;  1O0E A;  2DCB A;  1ITO A;  2P0R A;  3PRM A;  1U9X A;  5CHV A;  5E6J A;  4W4U A;  5PAD A;  4BOQ A;  4M0W A;  8PCH A;  1HUC B;  2FE8 A;  2FTD A;  4PP2 E;  2VHF A;  3TMP A;  3H8C A;  4MSX A;  2R9F A;  2FUD A;  2YJC A;  2R9N A;  4WA6 A;  1NB3 A;  3P5X A;  3CH2 X;  1BP4 A;  2AU1 A;  4I04 A;  4BOS A;  1KHP A;  1MDW A;  3I3T A;  3IV2 A;  5CVN B;  3B21 A;  2DC9 A;  4D8B A;  3C0R A;  4D8E A;  1PXV A;  3K24 A;  3MHS A;  2YJ9 A;  3PHX A;  3CBK A;  3GCB A;  5A24 A;  7PCK A;  3HHI A;  3MJ5 A;  3DF0 A;  1ME3 A;  1BY8 A;  4QRV A;  5F02 A;  3PRP A;  3BWK A;  1SP4 B;  1CQD A;  2R9O A;  3F5V A;  4X6I A;  1DF0 A;  2Y6E A;  5KO3 A;  1YT7 A;  1ME4 A;  3BC3 A;  2YJB A;  3TRK A;  2AGA A;  1XKG A;  4AXM A;  2G6D A;  3P5V A;  3N3G A;  2DCD A;  1GLO A;  3H7D A;  3HWN A;  1GEC E;  4DMX A;  1PPN A;  2R6N A;  2DCC A;  1POP A;  4BOZ A;  2P86 A;  2PRE A;  2JQG R;  4BS5 A;  3PBH A;  1CTE A;  2YJ2 A;  3RVX A;  3H6S A;  3PHU A;  3QT4 A;  1EWL A;  4IP3 A;  3V6C A;  4Q8H A;  4MZO A;  3K8U A;  3PT2 A;  2BTW B;  4YYW A;  3ZNH A;  2PNS A;  3N3K A;  1AIM A;  2Z84 A;  1PCI A;  4D8I A;  4HWY A;  4RF0 A;  3PW3 A;  2FT2 A;  2FYE A;  1AYW A;  2HH5 A;  4W5B A;  1QMY A;  3PDF A;  4YYR A;  2DJF B;  1AU2 A;  4MI7 A;  4BSQ A;  2XU3 A;  1ICF A;  1A6R A;  1THE A;  1CS8 A;  3HHA A;  3BBA A;  1JQP A;  2ARY A;  3O65 A;  3KX1 A;  1DKI A;  3QSD A;  3KFQ A;  1DEU A;  3W30 A;  1PVJ A;  1PBH A;  2FO5 A;  3BOW A;  3KWB X;  1F2C A;  2ACT A;  1SNK A;  4BS6 A;  4ZTB A;  1NL6 A;  1TLO A;  2J7Q C;  3KW9 A;  1TL9 A;  4KLB A;  1MEG A;  2PBH A;  4FIP A;  4I05 A;  3S3Q A;  1AU0 A;  2JQF R;  4YYQ A;  2R9M A;  4YVA A;  2AUX A;  4YYU A;  1U9V A;  1CPJ A;  4QH6 A;  4REZ A;  9PAP A;  2BTW A;  3B79 A;  2HWK A;  4XR7 A;  3IFU A;  2AVW A;  1F2B A;  3WXF A;  1U9W A;  1CB5 A;  6PAD A;  3BB7 A;  3F75 A;  5JA7 A;  2UZJ A;  2O6X A;  2G8E A;  3ERV A;  3M99 A;  2JRI A;  2G8J A;  3NHE A;  1X9Y A;  4P6G A;  4HXD B;  1QOL A;  1YK7 A;  1AYU A;  1GMY A;  1F2A A;  4WUR A;  3O0U A;  4BPV A;  3KKU A;  1EWM A;  1Q6K A;  3BPM A;  2NQI A;  4PI3 A;  4YYV A;  4A5U A;  2FQ9 A;  3V6E A;  3C9E A;  4CDF B;  2B1M A;  1VJV A;  2E01 A;  4OEL A;  4FK5 A;  1NPZ A;  1K3B B;  3IMA A;  1FH0 A;  1AEC A;  2BDZ A;  1CSB B;  4W5C A;  2CB5 A;  2DC6 A;  4IUM A;  1ATK A;  1TU6 A;  2DZY A;  1MHW A;  1S4V A;  3E9S A;  4K7C A;  2VHS A;  1AYV A;  2DOS A;  4PT5 A;  1PPD A;  1ZCM A;  4GUA A;  3H8B A;  4XZX A;  3BPF A;  4OVZ B;  1YZB A;  4N8W A;  5FPW A;  4RF1 A;  2CIO A;  3OVZ A;  3MTN A;  3O1G A;  2HXZ A;  1F29 A;  1EF7 A;  1EWO A;  1U9Q X;  1VSN A;  2NQG A;  1MS6 A;  4PAD A;  2GFO A;  5EZS A;  2FRQ A;  4P6E A;  2OUL A;  4G54 A;  4N79 A;  2BDL A;  3KSE A;  4CZW A;  2JTC A;  3OF8 A;  1YVB A;  1PAD A;  1KXR A;  3W31 A;  5JH3 A;  4ZUX U;  1CVZ A;  2R9C A;  3N4C A;  2BU3 A;  5CVO B;  1QDQ A;  4YYS A;  1STF E;  3WXG A;  3BCN A;  3OVX A;  3WXE A;  2XU1 A;  2YJ8 A;  4RNA A;  1NLJ A;  3LFY A;  2IBI A;  2DZZ A;  2NQD B;  1YK8 A;  4PP1 A;  1PE6 A;  4CDE B;  3S3R A;  2E02 A;  3MP2 A;  2C0Y A;  3HD3 A;  4FJC A;  2DCA A;  4R3D A;  2ATO A;  4P16 A;  4QBB A;  3P5U A;  2OZ2 A;  3OF9 A;  2HHN A;  1PPP A;  4MZS A;  2E00 A;  2GHU A;  1KFU L;  3I06 A;  4OVZ A;  1U5I A;  1CV8 A;  2WBF X;  1KHQ A;  3K9M A;  2Y5B A;  2E03 A;  5CHT A;  2XU5 A;  4BQV A;  5EZQ A;  4OW0 A;  1BGO A;  3PHW A;  1M6D A;  4RY2 A;  4YV8 A;  5EF4 A;  1IWD A;  1Y4H A;  3QJ3 A;  3CH3 X;  4I07 A;  3IOQ A;  4XUI A;  1MEM A;  3IHP A;  2AUZ A;  2AYN A;  1BQI A;  3RVW A;  1Y08 A;  3IUT A;  2XU4 A;  2AIM A;  1YAL A;  2FRA A;  3U8E A;  5JZE A;  2NQA A;  3MTV A;  3TNX A;  2F1G A;  3ZUA A;  3CBJ A;  1EWP A; 
#chains in the Genus database with same CATH homology
 3KWZ A;  5EGW A;  4QRX A;  5K16 A;  4AXL A;  1GCB A;  3MHH A;  2H7J A;  4Q8G A;  3IEJ A;  4X6H A;  4X6J A;  2F7D A;  4OEM A;  1AU3 A;  2B1N A;  2AYO A;  1MIR A;  2PAD A;  3USV A;  2HD5 A;  2OP3 A;  4CDD B;  1PIP A;  1AU4 A;  3P5W A;  1ZIV A;  3OIS A;  5CVM A;  1PPO A;  1QXP A;  4DMY A;  1NB5 A;  2DC8 A;  2G7Y A;  3D6S A;  3MOR A;  2P7U A;  2AS8 A;  3PNR A;  5J94 A;  1CJL A;  4CDC B;  3AI8 A;  3RVV A;  2IPP B;  4QRG A;  3H89 A;  3LXS A;  1GX3 A;  4N4Z A;  3E1Z B;  1NQC A;  2DC7 A;  2DJG B;  1KFX L;  1O0E A;  2DCB A;  1ITO A;  2P0R A;  1U9X A;  5CHV A;  4W4U A;  2BSZ A;  5PAD A;  8PCH A;  1HUC B;  2FTD A;  4PP2 E;  2VHF A;  3H8C A;  4MSX A;  2R9F A;  2FUD A;  2YJC A;  2R9N A;  4WA6 A;  1NB3 A;  3P5X A;  3CH2 X;  1BP4 A;  2AU1 A;  4I04 A;  1KHP A;  1MDW A;  3I3T A;  3IV2 A;  5CVN B;  2DC9 A;  1PXV A;  3K24 A;  3MHS A;  2YJ9 A;  3CBK A;  3GCB A;  5A24 A;  7PCK A;  3HHI A;  3DF0 A;  1ME3 A;  1BY8 A;  4QRV A;  5F02 A;  3BWK A;  1SP4 B;  1CQD A;  2R9O A;  3F5V A;  4X6I A;  1DF0 A;  2Y6E A;  1YT7 A;  1ME4 A;  3BC3 A;  2YJB A;  1XKG A;  4AXM A;  2G6D A;  3P5V A;  3N3G A;  2DCD A;  1GLO A;  3H7D A;  3HWN A;  1GEC E;  4DMX A;  1PPN A;  2R6N A;  1W6F A;  2DCC A;  1POP A;  2P86 A;  2PRE A;  2JQG R;  4BS5 A;  3PBH A;  1CTE A;  2YJ2 A;  3RVX A;  3H6S A;  4BGF A;  3QT4 A;  1EWL A;  3V6C A;  4Q8H A;  4MZO A;  3K8U A;  4YYW A;  2PNS A;  3N3K A;  1AIM A;  1PCI A;  4HWY A;  3PW3 A;  2FT2 A;  2FYE A;  1AYW A;  2HH5 A;  4W5B A;  1QMY A;  3PDF A;  4YYR A;  2DJF B;  1AU2 A;  3D9W A;  4BSQ A;  2XU3 A;  1ICF A;  1A6R A;  1THE A;  1CS8 A;  1W5R A;  3HHA A;  1JQP A;  2ARY A;  3KX1 A;  3LTW A;  3QSD A;  3KFQ A;  1DEU A;  1PBH A;  2FO5 A;  3BOW A;  3KWB X;  1F2C A;  2ACT A;  1SNK A;  4BS6 A;  1NL6 A;  1TLO A;  3KW9 A;  1TL9 A;  4KLB A;  1MEG A;  2PBH A;  4B55 A;  4FIP A;  4I05 A;  3S3Q A;  1AU0 A;  2JQF R;  4YYQ A;  2R9M A;  4YVA A;  2AUX A;  4YYU A;  1U9V A;  1CPJ A;  4QH6 A;  9PAP A;  3B79 A;  4XR7 A;  2AVW A;  1F2B A;  3WXF A;  1U9W A;  1CB5 A;  1W4T A;  6PAD A;  3F75 A;  5JA7 A;  2O6X A;  2G8E A;  3ERV A;  3M99 A;  2G8J A;  3NHE A;  1X9Y A;  4P6G A;  1QOL A;  1YK7 A;  1AYU A;  1GMY A;  1F2A A;  3O0U A;  4BPV A;  3KKU A;  1EWM A;  1Q6K A;  3BPM A;  2NQI A;  4PI3 A;  4YYV A;  2FQ9 A;  3V6E A;  3C9E A;  4CDF B;  2B1M A;  1VJV A;  2E01 A;  4OEL A;  4FK5 A;  1NPZ A;  1K3B B;  3IMA A;  1FH0 A;  1AEC A;  2BDZ A;  1CSB B;  4W5C A;  2CB5 A;  2DC6 A;  1ATK A;  1TU6 A;  2DZY A;  1MHW A;  1S4V A;  4GUZ A;  4K7C A;  2VHS A;  1AYV A;  1PPD A;  1ZCM A;  3H8B A;  5FPW A;  3BPF A;  4N8W A;  2CIO A;  3OVZ A;  3MTN A;  3O1G A;  2HXZ A;  1F29 A;  1EF7 A;  1EWO A;  1U9Q X;  1VSN A;  2NQG A;  1MS6 A;  4PAD A;  2GFO A;  2FRQ A;  4P6E A;  2OUL A;  4C5P A;  4G54 A;  4N79 A;  2BDL A;  3KSE A;  4CZW A;  3OF8 A;  1YVB A;  1PAD A;  1KXR A;  4ZUX U;  5JH3 A;  1CVZ A;  4NV8 A;  2R9C A;  3N4C A;  5CVO B;  1QDQ A;  4YYS A;  1STF E;  3WXG A;  3BCN A;  3OVX A;  3WXE A;  2XU1 A;  2YJ8 A;  1NLJ A;  3LFY A;  2IBI A;  2DZZ A;  2NQD B;  1YK8 A;  4PP1 A;  1PE6 A;  4CDE B;  3S3R A;  2E02 A;  2C0Y A;  3HD3 A;  4FJC A;  2DCA A;  2ATO A;  4QBB A;  3P5U A;  2OZ2 A;  3OF9 A;  2HHN A;  1PPP A;  4MZS A;  2E00 A;  2GHU A;  1KFU L;  3I06 A;  1U5I A;  2VFB A;  1CV8 A;  2WBF X;  1KHQ A;  3K9M A;  2Y5B A;  2E03 A;  5CHT A;  2XU5 A;  4BQV A;  1BGO A;  2VFC A;  1M6D A;  4RY2 A;  4YV8 A;  5EF4 A;  1IWD A;  1Y4H A;  3QJ3 A;  3CH3 X;  4I07 A;  3IOQ A;  4XUI A;  4NV7 A;  1MEM A;  3IHP A;  2AUZ A;  2AYN A;  1BQI A;  3RVW A;  1Y08 A;  3IUT A;  2XU4 A;  2AIM A;  1YAL A;  1E2T A;  2FRA A;  3U8E A;  2NQA A;  3TNX A;  2F1G A;  3ZUA A;  3CBJ A;  1EWP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...