4P6GA

Crystal structure of human cathepsin s bound to a non-covalent inhibitor.
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
219
structure length
219
Chain Sequence
b'ILPDSVDWREKGCVTEVKYQGSCGACWAFSAVGALEAQLKLKTGKLVSLSAQNLVDCSTEKYGNKGCNGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYDSKYRAATCSKYTELPYGREDVLKEAVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSWGHNFGEEGYIRMARNKGNHCGIASFPSYPEIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cathepsin S
publication title Discovery of Cathepsin S Inhibitor LY3000328 for the Treatment of Abdominal Aortic Aneurysm.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 70
structure length 219
sequence length 219
chains with identical sequence B, C, D
ec nomenclature ec 3.4.22.27: Cathepsin S.
pdb deposition date 2014-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 4p6gA00
1POPA 3I06A 2YJ8A 3IMAA 1NL6A 3IUTA 1NB3A 2ATOA 1AU4A 1F29A 1THEA 3BOWA 4Q8HA 1NPZA 2FT2A 1AYWA 4BS5A 1PCIA 2BDLA 2JQFR 1EF7A 3GCBA 1KFXL 4BS6A 1XKGA 3K8UA 1PADA 1U9VA 3ERVA 2DZZA 4I07A 1IWDA 1NLJA 2PADA 2WBFX 3P5UA 2NQDB 3HHIA 1BP4A 1PXVA 2O6XA 3S3QA 2IPPB 3H89A 2YJ2A 1YALA 5JH3A 2DC6A 4QBBA 1ZIVA 4YYVA 3P5WA 1PPDA 1YK8A 1MEGA 3IOQA 1AU2A 4QH6A 3MORA 3I3TA 3KWBX 5PADA 4PP2E 1O0EA 2DZYA 4X6IA 3KSEA 1ATKA 5FPWA 2G8EA 1TLOA 2AS8A 3H8BA 2HHNA 1DF0A 3N3KA 1GMYA 5EGWA 3O0UA 4AXMA 1STFE 1CPJA 2DJFB 2R9MA 5EF4A 2NQGA 1ZCMA 4QRGA 4FIPA 2ARYA 1AU3A 4DMXA 1MIRA 1KHPA 4W4UA 1ICFA 1PPPA 4CDFB 3QJ3A 4ZUXU 3BPFA 1CVZA 4YYWA 3QSDA 2AYNA 4CDEB 4P6EA 1AECA 5CHVA 4PADA 4AXLA 1TU6A 2BDZA 4BQVA 2HD5A 5JA7A 1FH0A 1U9XA 2P86A 3P5VA 1KXRA 4N4ZA 3C9EA 3NHEA 1VJVA 1DEUA 3DF0A 2XU3A 3BWKA 4I05A 1U9QX 3CH3X 3KKUA 1MEMA 3N3GA 1ITOA 4FK5A 2YJBA 4FJCA 1NQCA 2F1GA 3IV2A 2YJCA 3M99A 1PBHA 2HXZA 3ZUAA 1PPNA 1GLOA 1VSNA 3K9MA 2AIMA 4PP1A 3OISA 1Y08A 1U5IA 2IBIA 3E1ZB 1A6RA 3KX1A 1BGOA 2DCCA 2DC7A 1BY8A 2E00A 6PADA 2Y6EA 2AUXA 2PREA 3LXSA 2XU1A 2YJ9A 3RVXA 3H8CA 5F02A 1M6DA 2OP3A 3H7DA 1JQPA 3IHPA 1CTEA 2DJGB 3PNRA 1Q6KA 1YVBA 2F7DA 2P0RA 2G7YA 3TNXA 1F2CA 3P5XA 2B1MA 2FTDA 1GCBA 3PBHA 3MTNA 3BCNA 1CS8A 3OVXA 3KWZA 1SNKA 5K16A 2CIOA 2NQAA 4WA6A 4X6HA 3CBJA 3K24A 1S4VA 1KHQA 3QT4A 4CDDB 4K7CA 3B79A 2FO5A 3D6SA 3F75A 2G6DA 3HWNA 3RVVA 3OVZA 3V6CA 2DCBA 1CSBB 1ME3A 2DC8A 2P7UA 2R9OA 4Q8GA 3WXFA 4G54A 2DCAA 1AU0A 2FQ9A 3KW9A 4N79A 1ME4A 2FYEA 2AUZA 4QRVA 1AYUA 1QXPA 2NQIA 1NB5A 1SP4B 3USVA 1TL9A 4KLBA 4X6JA 2E01A 4W5BA 1F2BA 3F5VA 5CVOB 2DCDA 3RVWA 2R9FA 2R9NA 4XR7A 2B1NA 2C0YA 5CVMA 3V6EA 4YYQA 1EWMA 1GECE 3OF8A 3U8EA 4RY2A 3O1GA 1EWPA 4YYSA 3MHSA 4DMYA 1K3BB 2PNSA 1PIPA 2XU5A 3BC3A 1EWOA 4I04A 4YYUA 2AVWA 2FUDA 4CDCB 2OZ2A 2E03A 2GFOA 4W5CA 2XU4A 4BPVA 4CZWA 1QOLA 3HD3A 4HWYA 4BSQA 4QRXA 3AI8A 4OELA 2Y5BA 1YT7A 2FRQA 2R6NA 5A24A 3S3RA 1KFUL 4YYRA 1CJLA 4PI3A 2E02A 2PBHA 1BQIA 4YV8A 1MDWA 3H6SA 3N4CA 7PCKA 3IEJA 4MZSA 2OULA 1Y4HA 1HUCB 2VHFA 2FRAA 1PE6A 3WXEA 4P6GA 2R9CA 3CH2X 3LFYA 1X9YA 2JQGR 1F2AA 2CB5A 8PCHA 1PPOA 1CV8A 5CVNB 9PAPA 1AYVA 3WXGA 2G8JA 1U9WA 1QDQA 3BPMA 1MHWA 3MHHA 2GHUA 3HHAA 1CB5A 2VHSA 4MZOA 1EWLA 4OEMA 2ACTA 2H7JA 4XUIA 5J94A 3KFQA 3PDFA 2DC9A 1YK7A 2HH5A 3CBKA 3PW3A 4N8WA 4YVAA 1MS6A 1AIMA 4MSXA 3OF9A 2AYOA 1QMYA 2AU1A 5CHTA 1CQDA
chains in the Genus database with same CATH superfamily
1POPA 3I06A 2YJ8A 4PT5A 4RF1A 5JZEA 3IMAA 1NL6A 3IUTA 1NB3A 2ATOA 1AU4A 1F29A 4OVZB 1THEA 3BOWA 4Q8HA 3PHWA 1NPZA 2FT2A 3BBAA 1AYWA 2JRIA 1YZBA 4BS5A 1PCIA 2BDLA 2JQFR 1EF7A 3GCBA 1KFXL 4BS6A 1XKGA 3K8UA 1PADA 1U9VA 3ERVA 2DZZA 4I07A 1IWDA 1NLJA 2PADA 2WBFX 3P5UA 2NQDB 3HHIA 4HXDB 1BP4A 1PXVA 2O6XA 4GUAA 2BTWB 3S3QA 2IPPB 5EZSA 3PRMA 3H89A 2YJ2A 1YALA 5JH3A 2DC6A 3OQCA 4QBBA 1ZIVA 3MTVA 2AGAA 2HWKA 4REZA 4YYVA 3P5WA 1PPDA 1YK8A 1MEGA 3IOQA 1AU2A 4QH6A 3MORA 3I3TA 3KWBX 5PADA 4PP2E 1O0EA 2DZYA 4X6IA 3KSEA 1ATKA 5FPWA 2G8EA 4RKXA 1TLOA 2AS8A 4BOUA 3H8BA 2HHNA 3PRPA 1DF0A 3N3KA 1GMYA 5EGWA 3O0UA 4AXMA 1STFE 1CPJA 2DJFB 2R9MA 5EF4A 2NQGA 1ZCMA 4QRGA 4D8BA 4FIPA 2ARYA 1AU3A 4DMXA 1MIRA 1KHPA 4W4UA 1ICFA 1PPPA 4CDFB 3QJ3A 4ZUXU 3BPFA 1CVZA 4YYWA 3QSDA 3B21A 3ZNHA 2AYNA 4CDEB 4P6EA 1AECA 5CHVA 4PADA 5KO3A 4AXLA 1TU6A 3W30A 2BDZA 4IP3A 4BQVA 2HD5A 5JA7A 1FH0A 3IFUA 4OVZA 1U9XA 2P86A 3P5VA 1KXRA 4N4ZA 3C9EA 3NHEA 1VJVA 4MI7A 1DEUA 3DF0A 2XU3A 3BWKA 4I05A 1U9QX 3CH3X 3KKUA 1MEMA 3N3GA 1ITOA 4FK5A 2YJBA 4FJCA 1NQCA 2F1GA 3IV2A 2YJCA 3M99A 1PBHA 2HXZA 3ZUAA 1PPNA 2BTWA 1GLOA 1VSNA 3K9MA 2BU3A 2AIMA 4RNAA 4PP1A 3OISA 1Y08A 1U5IA 2IBIA 3E1ZB 4D8EA 1A6RA 3KX1A 1BGOA 2DCCA 4XZXA 2J7QA 2DC7A 1BY8A 2E00A 6PADA 2Y6EA 3RNVA 2AUXA 3C0RA 2PREA 3LXSA 2XU1A 2YJ9A 3RVXA 3H8CA 5F02A 1M6DA 2OP3A 3H7DA 1JQPA 3IHPA 1CTEA 2DJGB 3PNRA 1Q6KA 1YVBA 2F7DA 2P0RA 2G7YA 3TNXA 1F2CA 1PVJA 4BOPA 3P5XA 2FE8A 2B1MA 2FTDA 1GCBA 3PBHA 3MTNA 4WURA 3BCNA 1CS8A 3OVXA 3PHXA 4A5UA 3KWZA 1SNKA 4BOQA 5K16A 2J7QC 2CIOA 2UZJA 2NQAA 4WA6A 4X6HA 3CBJA 3K24A 1S4VA 2DOSA 1KHQA 5EZQA 3QT4A 4CDDB 4K7CA 5E6JA 3B79A 2FO5A 1UKFA 3D6SA 3F75A 2G6DA 3HWNA 3E9SA 3RVVA 3OVZA 3V6CA 2DCBA 4P16A 1CSBB 1ME3A 2DC8A 3BB7A 2P7UA 2R9OA 4Q8GA 3WXFA 4G54A 2DCAA 1AU0A 3MJ5A 2FQ9A 3KW9A 4D8IA 4OW0A 4N79A 1ME4A 2FYEA 2AUZA 4QRVA 1AYUA 1QXPA 2NQIA 1NB5A 3BY4A 1SP4B 3USVA 3PT2A 1TL9A 4KLBA 4X6JA 2E01A 4M0WA 4W5BA 1F2BA 3F5VA 5CVOB 2DCDA 3RVWA 2R9FA 2R9NA 4XR7A 4BOSA 2B1NA 2C0YA 4R3DA 5CVMA 3V6EA 3W31A 4YYQA 1EWMA 3PSEA 1GECE 3OF8A 3U8EA 4RY2A 3O1GA 1EWPA 4YYSA 3MHSA 4DMYA 1K3BB 2PNSA 1PIPA 2XU5A 3BC3A 3TMPA 1EWOA 4I04A 4YYUA 2AVWA 2FUDA 4CDCB 2OZ2A 2E03A 2GFOA 4W5CA 2XU4A 4BPVA 4CZWA 1QOLA 3HD3A 4HWYA 4BSQA 4QRXA 3AI8A 4OELA 2Y5BA 1YT7A 2FRQA 2R6NA 5A24A 3S3RA 1KFUL 4YYRA 1CJLA 4PI3A 3MP2A 2E02A 2PBHA 4ZTBA 1BQIA 4YV8A 2JTCA 1MDWA 4BOZA 3H6SA 3N4CA 7PCKA 3IEJA 4MZSA 2OULA 4MM3B 1Y4HA 1HUCB 2VHFA 2FRAA 1PE6A 3WXEA 4P6GA 2R9CA 3PHUA 3CH2X 3LFYA 1X9YA 2JQGR 1F2AA 2CB5A 2Z84A 8PCHA 1PPOA 1CV8A 5CVNB 9PAPA 1AYVA 3WXGA 2G8JA 3TRKA 1U9WA 1QDQA 3BPMA 1MHWA 3MHHA 2GHUA 3O65A 3HHAA 1CB5A 2VHSA 4MZOA 1EWLA 4OEMA 2ACTA 4RF0A 2H7JA 4XUIA 5J94A 3KFQA 3PDFA 1DKIA 2DC9A 1YK7A 2HH5A 4IUMA 3CBKA 3PW3A 4N8WA 4YVAA 1MS6A 1AIMA 4MSXA 3OF9A 2AYOA 1QMYA 2AU1A 5CHTA 1CQDA
chains in the Genus database with same CATH topology
1POPA 3I06A 2YJ8A 2VFBA 3IMAA 1NL6A 3IUTA 1NB3A 2ATOA 1AU4A 1F29A 1THEA 3BOWA 4Q8HA 1NPZA 2FT2A 1AYWA 4BS5A 1PCIA 2BDLA 2JQFR 1EF7A 3GCBA 1KFXL 4BS6A 1XKGA 3K8UA 1PADA 1U9VA 3ERVA 2DZZA 4I07A 1IWDA 1NLJA 2PADA 2WBFX 3P5UA 2NQDB 3HHIA 1BP4A 1PXVA 2O6XA 4NV8A 3S3QA 2IPPB 3H89A 2YJ2A 4BGFA 1YALA 5JH3A 2DC6A 4QBBA 1ZIVA 4YYVA 3P5WA 1PPDA 1YK8A 1MEGA 3IOQA 1AU2A 4QH6A 3MORA 3I3TA 3KWBX 5PADA 4PP2E 1O0EA 2DZYA 4X6IA 3KSEA 1ATKA 5FPWA 2G8EA 1TLOA 2AS8A 3H8BA 1W5RA 2HHNA 1DF0A 3N3KA 1GMYA 5EGWA 3O0UA 4AXMA 1STFE 1CPJA 2DJFB 2R9MA 5EF4A 2NQGA 1ZCMA 4QRGA 4FIPA 2ARYA 1AU3A 4DMXA 1MIRA 1KHPA 4W4UA 1ICFA 1PPPA 4CDFB 3QJ3A 4ZUXU 3BPFA 4GUZA 1CVZA 1GX3A 4YYWA 3QSDA 2AYNA 4CDEB 4P6EA 1AECA 5CHVA 4PADA 4AXLA 1TU6A 2BDZA 4BQVA 2HD5A 5JA7A 1FH0A 1U9XA 2P86A 3P5VA 1KXRA 4N4ZA 3C9EA 3NHEA 1VJVA 1DEUA 3DF0A 2XU3A 3BWKA 4I05A 1U9QX 3CH3X 3KKUA 1MEMA 3N3GA 1ITOA 4FK5A 4NV7A 3LTWA 2YJBA 4FJCA 1NQCA 2F1GA 3IV2A 2YJCA 3M99A 1PBHA 2HXZA 3ZUAA 1PPNA 1GLOA 1VSNA 3K9MA 2AIMA 1W6FA 4PP1A 3OISA 1Y08A 1U5IA 2IBIA 3E1ZB 1A6RA 3KX1A 1BGOA 1W4TA 2DCCA 2DC7A 1BY8A 2E00A 6PADA 2Y6EA 2AUXA 2PREA 3LXSA 2XU1A 2YJ9A 3RVXA 3H8CA 5F02A 1M6DA 2OP3A 3H7DA 1JQPA 3IHPA 1CTEA 2DJGB 3PNRA 1Q6KA 1YVBA 2F7DA 2P0RA 2G7YA 3TNXA 2BSZA 1F2CA 3P5XA 2B1MA 2FTDA 1GCBA 3PBHA 3MTNA 3BCNA 1CS8A 3OVXA 3KWZA 1SNKA 5K16A 2CIOA 2NQAA 4WA6A 4X6HA 3CBJA 3K24A 1S4VA 1KHQA 3QT4A 4CDDB 4K7CA 3B79A 2FO5A 2VFCA 3D6SA 3F75A 2G6DA 3HWNA 3RVVA 3OVZA 3V6CA 2DCBA 1CSBB 1ME3A 2DC8A 2P7UA 2R9OA 4Q8GA 3WXFA 4G54A 2DCAA 1AU0A 2FQ9A 3KW9A 4N79A 1ME4A 2FYEA 2AUZA 4QRVA 1AYUA 1QXPA 2NQIA 1NB5A 4B55A 1SP4B 3USVA 1TL9A 4KLBA 4X6JA 2E01A 4W5BA 1F2BA 3F5VA 5CVOB 2DCDA 3RVWA 2R9FA 2R9NA 4XR7A 2B1NA 2C0YA 5CVMA 3V6EA 4C5PA 4YYQA 1EWMA 1GECE 3OF8A 3U8EA 4RY2A 3O1GA 1EWPA 4YYSA 3MHSA 4DMYA 1K3BB 2PNSA 1PIPA 2XU5A 3BC3A 1EWOA 4I04A 4YYUA 2AVWA 2FUDA 4CDCB 2OZ2A 2E03A 2GFOA 4W5CA 2XU4A 4BPVA 4CZWA 1QOLA 3HD3A 4HWYA 4BSQA 4QRXA 3AI8A 4OELA 2Y5BA 1YT7A 2FRQA 2R6NA 5A24A 3S3RA 1KFUL 4YYRA 1CJLA 4PI3A 2E02A 2PBHA 1BQIA 4YV8A 1MDWA 3H6SA 3N4CA 7PCKA 3IEJA 4MZSA 2OULA 1Y4HA 1HUCB 2VHFA 2FRAA 1PE6A 3WXEA 4P6GA 2R9CA 1E2TA 3CH2X 3LFYA 1X9YA 2JQGR 1F2AA 2CB5A 8PCHA 1PPOA 1CV8A 5CVNB 9PAPA 1AYVA 3WXGA 2G8JA 1U9WA 1QDQA 3BPMA 1MHWA 3MHHA 2GHUA 3HHAA 1CB5A 2VHSA 4MZOA 1EWLA 4OEMA 2ACTA 2H7JA 4XUIA 5J94A 3KFQA 3PDFA 2DC9A 1YK7A 2HH5A 3CBKA 3PW3A 4N8WA 4YVAA 1MS6A 1AIMA 4MSXA 3OF9A 2AYOA 3D9WA 1QMYA 2AU1A 5CHTA 1CQDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1POP A;  3I06 A;  2YJ8 A;  3IMA A;  1NL6 A;  3IUT A;  1NB3 A;  2ATO A;  1AU4 A;  1F29 A;  1THE A;  3BOW A;  4Q8H A;  1NPZ A;  2FT2 A;  1AYW A;  4BS5 A;  1PCI A;  2BDL A;  2JQF R;  1EF7 A;  3GCB A;  1KFX L;  4BS6 A;  1XKG A;  3K8U A;  1PAD A;  1U9V A;  3ERV A;  2DZZ A;  4I07 A;  1IWD A;  1NLJ A;  2PAD A;  2WBF X;  3P5U A;  2NQD B;  3HHI A;  1BP4 A;  1PXV A;  2O6X A;  3S3Q A;  2IPP B;  3H89 A;  2YJ2 A;  1YAL A;  5JH3 A;  2DC6 A;  4QBB A;  1ZIV A;  4YYV A;  3P5W A;  1PPD A;  1YK8 A;  1MEG A;  3IOQ A;  1AU2 A;  4QH6 A;  3MOR A;  3I3T A;  3KWB X;  5PAD A;  4PP2 E;  1O0E A;  2DZY A;  4X6I A;  3KSE A;  1ATK A;  5FPW A;  2G8E A;  1TLO A;  2AS8 A;  3H8B A;  2HHN A;  1DF0 A;  3N3K A;  1GMY A;  5EGW A;  3O0U A;  4AXM A;  1STF E;  1CPJ A;  2DJF B;  2R9M A;  5EF4 A;  2NQG A;  1ZCM A;  4QRG A;  4FIP A;  2ARY A;  1AU3 A;  4DMX A;  1MIR A;  1KHP A;  4W4U A;  1ICF A;  1PPP A;  4CDF B;  3QJ3 A;  4ZUX U;  3BPF A;  1CVZ A;  4YYW A;  3QSD A;  2AYN A;  4CDE B;  4P6E A;  1AEC A;  5CHV A;  4PAD A;  4AXL A;  1TU6 A;  2BDZ A;  4BQV A;  2HD5 A;  5JA7 A;  1FH0 A;  1U9X A;  2P86 A;  3P5V A;  1KXR A;  4N4Z A;  3C9E A;  3NHE A;  1VJV A;  1DEU A;  3DF0 A;  2XU3 A;  3BWK A;  4I05 A;  1U9Q X;  3CH3 X;  3KKU A;  1MEM A;  3N3G A;  1ITO A;  4FK5 A;  2YJB A;  4FJC A;  1NQC A;  2F1G A;  3IV2 A;  2YJC A;  3M99 A;  1PBH A;  2HXZ A;  3ZUA A;  1PPN A;  1GLO A;  1VSN A;  3K9M A;  2AIM A;  4PP1 A;  3OIS A;  1Y08 A;  1U5I A;  2IBI A;  3E1Z B;  1A6R A;  3KX1 A;  1BGO A;  2DCC A;  2DC7 A;  1BY8 A;  2E00 A;  6PAD A;  2Y6E A;  2AUX A;  2PRE A;  3LXS A;  2XU1 A;  2YJ9 A;  3RVX A;  3H8C A;  5F02 A;  1M6D A;  2OP3 A;  3H7D A;  1JQP A;  3IHP A;  1CTE A;  2DJG B;  3PNR A;  1Q6K A;  1YVB A;  2F7D A;  2P0R A;  2G7Y A;  3TNX A;  1F2C A;  3P5X A;  2B1M A;  2FTD A;  1GCB A;  3PBH A;  3MTN A;  3BCN A;  1CS8 A;  3OVX A;  3KWZ A;  1SNK A;  5K16 A;  2CIO A;  2NQA A;  4WA6 A;  4X6H A;  3CBJ A;  3K24 A;  1S4V A;  1KHQ A;  3QT4 A;  4CDD B;  4K7C A;  3B79 A;  2FO5 A;  3D6S A;  3F75 A;  2G6D A;  3HWN A;  3RVV A;  3OVZ A;  3V6C A;  2DCB A;  1CSB B;  1ME3 A;  2DC8 A;  2P7U A;  2R9O A;  4Q8G A;  3WXF A;  4G54 A;  2DCA A;  1AU0 A;  2FQ9 A;  3KW9 A;  4N79 A;  1ME4 A;  2FYE A;  2AUZ A;  4QRV A;  1AYU A;  1QXP A;  2NQI A;  1NB5 A;  1SP4 B;  3USV A;  1TL9 A;  4KLB A;  4X6J A;  2E01 A;  4W5B A;  1F2B A;  3F5V A;  5CVO B;  2DCD A;  3RVW A;  2R9F A;  2R9N A;  4XR7 A;  2B1N A;  2C0Y A;  5CVM A;  3V6E A;  4YYQ A;  1EWM A;  1GEC E;  3OF8 A;  3U8E A;  4RY2 A;  3O1G A;  1EWP A;  4YYS A;  3MHS A;  4DMY A;  1K3B B;  2PNS A;  1PIP A;  2XU5 A;  3BC3 A;  1EWO A;  4I04 A;  4YYU A;  2AVW A;  2FUD A;  4CDC B;  2OZ2 A;  2E03 A;  2GFO A;  4W5C A;  2XU4 A;  4BPV A;  4CZW A;  1QOL A;  3HD3 A;  4HWY A;  4BSQ A;  4QRX A;  3AI8 A;  4OEL A;  2Y5B A;  1YT7 A;  2FRQ A;  2R6N A;  5A24 A;  3S3R A;  1KFU L;  4YYR A;  1CJL A;  4PI3 A;  2E02 A;  2PBH A;  1BQI A;  4YV8 A;  1MDW A;  3H6S A;  3N4C A;  7PCK A;  3IEJ A;  4MZS A;  2OUL A;  1Y4H A;  1HUC B;  2VHF A;  2FRA A;  1PE6 A;  3WXE A;  4P6G A;  2R9C A;  3CH2 X;  3LFY A;  1X9Y A;  2JQG R;  1F2A A;  2CB5 A;  8PCH A;  1PPO A;  1CV8 A;  5CVN B;  9PAP A;  1AYV A;  3WXG A;  2G8J A;  1U9W A;  1QDQ A;  3BPM A;  1MHW A;  3MHH A;  2GHU A;  3HHA A;  1CB5 A;  2VHS A;  4MZO A;  1EWL A;  4OEM A;  2ACT A;  2H7J A;  4XUI A;  5J94 A;  3KFQ A;  3PDF A;  2DC9 A;  1YK7 A;  2HH5 A;  3CBK A;  3PW3 A;  4N8W A;  4YVA A;  1MS6 A;  1AIM A;  4MSX A;  3OF9 A;  2AYO A;  1QMY A;  2AU1 A;  5CHT A;  1CQD A; 
#chains in the Genus database with same CATH topology
 1POP A;  3I06 A;  2YJ8 A;  4PT5 A;  4RF1 A;  5JZE A;  3IMA A;  1NL6 A;  3IUT A;  1NB3 A;  2ATO A;  1AU4 A;  1F29 A;  4OVZ B;  1THE A;  3BOW A;  4Q8H A;  3PHW A;  1NPZ A;  2FT2 A;  3BBA A;  1AYW A;  2JRI A;  1YZB A;  4BS5 A;  1PCI A;  2BDL A;  2JQF R;  1EF7 A;  3GCB A;  1KFX L;  4BS6 A;  1XKG A;  3K8U A;  1PAD A;  1U9V A;  3ERV A;  2DZZ A;  4I07 A;  1IWD A;  1NLJ A;  2PAD A;  2WBF X;  3P5U A;  2NQD B;  3HHI A;  4HXD B;  1BP4 A;  1PXV A;  2O6X A;  4GUA A;  2BTW B;  3S3Q A;  2IPP B;  5EZS A;  3PRM A;  3H89 A;  2YJ2 A;  1YAL A;  5JH3 A;  2DC6 A;  3OQC A;  4QBB A;  1ZIV A;  3MTV A;  2AGA A;  2HWK A;  4REZ A;  4YYV A;  3P5W A;  1PPD A;  1YK8 A;  1MEG A;  3IOQ A;  1AU2 A;  4QH6 A;  3MOR A;  3I3T A;  3KWB X;  5PAD A;  4PP2 E;  1O0E A;  2DZY A;  4X6I A;  3KSE A;  1ATK A;  5FPW A;  2G8E A;  4RKX A;  1TLO A;  2AS8 A;  4BOU A;  3H8B A;  2HHN A;  3PRP A;  1DF0 A;  3N3K A;  1GMY A;  5EGW A;  3O0U A;  4AXM A;  1STF E;  1CPJ A;  2DJF B;  2R9M A;  5EF4 A;  2NQG A;  1ZCM A;  4QRG A;  4D8B A;  4FIP A;  2ARY A;  1AU3 A;  4DMX A;  1MIR A;  1KHP A;  4W4U A;  1ICF A;  1PPP A;  4CDF B;  3QJ3 A;  4ZUX U;  3BPF A;  1CVZ A;  4YYW A;  3QSD A;  3B21 A;  3ZNH A;  2AYN A;  4CDE B;  4P6E A;  1AEC A;  5CHV A;  4PAD A;  5KO3 A;  4AXL A;  1TU6 A;  3W30 A;  2BDZ A;  4IP3 A;  4BQV A;  2HD5 A;  5JA7 A;  1FH0 A;  3IFU A;  4OVZ A;  1U9X A;  2P86 A;  3P5V A;  1KXR A;  4N4Z A;  3C9E A;  3NHE A;  1VJV A;  4MI7 A;  1DEU A;  3DF0 A;  2XU3 A;  3BWK A;  4I05 A;  1U9Q X;  3CH3 X;  3KKU A;  1MEM A;  3N3G A;  1ITO A;  4FK5 A;  2YJB A;  4FJC A;  1NQC A;  2F1G A;  3IV2 A;  2YJC A;  3M99 A;  1PBH A;  2HXZ A;  3ZUA A;  1PPN A;  2BTW A;  1GLO A;  1VSN A;  3K9M A;  2BU3 A;  2AIM A;  4RNA A;  4PP1 A;  3OIS A;  1Y08 A;  1U5I A;  2IBI A;  3E1Z B;  4D8E A;  1A6R A;  3KX1 A;  1BGO A;  2DCC A;  4XZX A;  2J7Q A;  2DC7 A;  1BY8 A;  2E00 A;  6PAD A;  2Y6E A;  3RNV A;  2AUX A;  3C0R A;  2PRE A;  3LXS A;  2XU1 A;  2YJ9 A;  3RVX A;  3H8C A;  5F02 A;  1M6D A;  2OP3 A;  3H7D A;  1JQP A;  3IHP A;  1CTE A;  2DJG B;  3PNR A;  1Q6K A;  1YVB A;  2F7D A;  2P0R A;  2G7Y A;  3TNX A;  1F2C A;  1PVJ A;  4BOP A;  3P5X A;  2FE8 A;  2B1M A;  2FTD A;  1GCB A;  3PBH A;  3MTN A;  4WUR A;  3BCN A;  1CS8 A;  3OVX A;  3PHX A;  4A5U A;  3KWZ A;  1SNK A;  4BOQ A;  5K16 A;  2J7Q C;  2CIO A;  2UZJ A;  2NQA A;  4WA6 A;  4X6H A;  3CBJ A;  3K24 A;  1S4V A;  2DOS A;  1KHQ A;  5EZQ A;  3QT4 A;  4CDD B;  4K7C A;  5E6J A;  3B79 A;  2FO5 A;  1UKF A;  3D6S A;  3F75 A;  2G6D A;  3HWN A;  3E9S A;  3RVV A;  3OVZ A;  3V6C A;  2DCB A;  4P16 A;  1CSB B;  1ME3 A;  2DC8 A;  3BB7 A;  2P7U A;  2R9O A;  4Q8G A;  3WXF A;  4G54 A;  2DCA A;  1AU0 A;  3MJ5 A;  2FQ9 A;  3KW9 A;  4D8I A;  4OW0 A;  4N79 A;  1ME4 A;  2FYE A;  2AUZ A;  4QRV A;  1AYU A;  1QXP A;  2NQI A;  1NB5 A;  3BY4 A;  1SP4 B;  3USV A;  3PT2 A;  1TL9 A;  4KLB A;  4X6J A;  2E01 A;  4M0W A;  4W5B A;  1F2B A;  3F5V A;  5CVO B;  2DCD A;  3RVW A;  2R9F A;  2R9N A;  4XR7 A;  4BOS A;  2B1N A;  2C0Y A;  4R3D A;  5CVM A;  3V6E A;  3W31 A;  4YYQ A;  1EWM A;  3PSE A;  1GEC E;  3OF8 A;  3U8E A;  4RY2 A;  3O1G A;  1EWP A;  4YYS A;  3MHS A;  4DMY A;  1K3B B;  2PNS A;  1PIP A;  2XU5 A;  3BC3 A;  3TMP A;  1EWO A;  4I04 A;  4YYU A;  2AVW A;  2FUD A;  4CDC B;  2OZ2 A;  2E03 A;  2GFO A;  4W5C A;  2XU4 A;  4BPV A;  4CZW A;  1QOL A;  3HD3 A;  4HWY A;  4BSQ A;  4QRX A;  3AI8 A;  4OEL A;  2Y5B A;  1YT7 A;  2FRQ A;  2R6N A;  5A24 A;  3S3R A;  1KFU L;  4YYR A;  1CJL A;  4PI3 A;  3MP2 A;  2E02 A;  2PBH A;  4ZTB A;  1BQI A;  4YV8 A;  2JTC A;  1MDW A;  4BOZ A;  3H6S A;  3N4C A;  7PCK A;  3IEJ A;  4MZS A;  2OUL A;  4MM3 B;  1Y4H A;  1HUC B;  2VHF A;  2FRA A;  1PE6 A;  3WXE A;  4P6G A;  2R9C A;  3PHU A;  3CH2 X;  3LFY A;  1X9Y A;  2JQG R;  1F2A A;  2CB5 A;  2Z84 A;  8PCH A;  1PPO A;  1CV8 A;  5CVN B;  9PAP A;  1AYV A;  3WXG A;  2G8J A;  3TRK A;  1U9W A;  1QDQ A;  3BPM A;  1MHW A;  3MHH A;  2GHU A;  3O65 A;  3HHA A;  1CB5 A;  2VHS A;  4MZO A;  1EWL A;  4OEM A;  2ACT A;  4RF0 A;  2H7J A;  4XUI A;  5J94 A;  3KFQ A;  3PDF A;  1DKI A;  2DC9 A;  1YK7 A;  2HH5 A;  4IUM A;  3CBK A;  3PW3 A;  4N8W A;  4YVA A;  1MS6 A;  1AIM A;  4MSX A;  3OF9 A;  2AYO A;  1QMY A;  2AU1 A;  5CHT A;  1CQD A; 
#chains in the Genus database with same CATH homology
 1POP A;  3I06 A;  2YJ8 A;  2VFB A;  3IMA A;  1NL6 A;  3IUT A;  1NB3 A;  2ATO A;  1AU4 A;  1F29 A;  1THE A;  3BOW A;  4Q8H A;  1NPZ A;  2FT2 A;  1AYW A;  4BS5 A;  1PCI A;  2BDL A;  2JQF R;  1EF7 A;  3GCB A;  1KFX L;  4BS6 A;  1XKG A;  3K8U A;  1PAD A;  1U9V A;  3ERV A;  2DZZ A;  4I07 A;  1IWD A;  1NLJ A;  2PAD A;  2WBF X;  3P5U A;  2NQD B;  3HHI A;  1BP4 A;  1PXV A;  2O6X A;  4NV8 A;  3S3Q A;  2IPP B;  3H89 A;  2YJ2 A;  4BGF A;  1YAL A;  5JH3 A;  2DC6 A;  4QBB A;  1ZIV A;  4YYV A;  3P5W A;  1PPD A;  1YK8 A;  1MEG A;  3IOQ A;  1AU2 A;  4QH6 A;  3MOR A;  3I3T A;  3KWB X;  5PAD A;  4PP2 E;  1O0E A;  2DZY A;  4X6I A;  3KSE A;  1ATK A;  5FPW A;  2G8E A;  1TLO A;  2AS8 A;  3H8B A;  1W5R A;  2HHN A;  1DF0 A;  3N3K A;  1GMY A;  5EGW A;  3O0U A;  4AXM A;  1STF E;  1CPJ A;  2DJF B;  2R9M A;  5EF4 A;  2NQG A;  1ZCM A;  4QRG A;  4FIP A;  2ARY A;  1AU3 A;  4DMX A;  1MIR A;  1KHP A;  4W4U A;  1ICF A;  1PPP A;  4CDF B;  3QJ3 A;  4ZUX U;  3BPF A;  4GUZ A;  1CVZ A;  1GX3 A;  4YYW A;  3QSD A;  2AYN A;  4CDE B;  4P6E A;  1AEC A;  5CHV A;  4PAD A;  4AXL A;  1TU6 A;  2BDZ A;  4BQV A;  2HD5 A;  5JA7 A;  1FH0 A;  1U9X A;  2P86 A;  3P5V A;  1KXR A;  4N4Z A;  3C9E A;  3NHE A;  1VJV A;  1DEU A;  3DF0 A;  2XU3 A;  3BWK A;  4I05 A;  1U9Q X;  3CH3 X;  3KKU A;  1MEM A;  3N3G A;  1ITO A;  4FK5 A;  4NV7 A;  3LTW A;  2YJB A;  4FJC A;  1NQC A;  2F1G A;  3IV2 A;  2YJC A;  3M99 A;  1PBH A;  2HXZ A;  3ZUA A;  1PPN A;  1GLO A;  1VSN A;  3K9M A;  2AIM A;  1W6F A;  4PP1 A;  3OIS A;  1Y08 A;  1U5I A;  2IBI A;  3E1Z B;  1A6R A;  3KX1 A;  1BGO A;  1W4T A;  2DCC A;  2DC7 A;  1BY8 A;  2E00 A;  6PAD A;  2Y6E A;  2AUX A;  2PRE A;  3LXS A;  2XU1 A;  2YJ9 A;  3RVX A;  3H8C A;  5F02 A;  1M6D A;  2OP3 A;  3H7D A;  1JQP A;  3IHP A;  1CTE A;  2DJG B;  3PNR A;  1Q6K A;  1YVB A;  2F7D A;  2P0R A;  2G7Y A;  3TNX A;  2BSZ A;  1F2C A;  3P5X A;  2B1M A;  2FTD A;  1GCB A;  3PBH A;  3MTN A;  3BCN A;  1CS8 A;  3OVX A;  3KWZ A;  1SNK A;  5K16 A;  2CIO A;  2NQA A;  4WA6 A;  4X6H A;  3CBJ A;  3K24 A;  1S4V A;  1KHQ A;  3QT4 A;  4CDD B;  4K7C A;  3B79 A;  2FO5 A;  2VFC A;  3D6S A;  3F75 A;  2G6D A;  3HWN A;  3RVV A;  3OVZ A;  3V6C A;  2DCB A;  1CSB B;  1ME3 A;  2DC8 A;  2P7U A;  2R9O A;  4Q8G A;  3WXF A;  4G54 A;  2DCA A;  1AU0 A;  2FQ9 A;  3KW9 A;  4N79 A;  1ME4 A;  2FYE A;  2AUZ A;  4QRV A;  1AYU A;  1QXP A;  2NQI A;  1NB5 A;  4B55 A;  1SP4 B;  3USV A;  1TL9 A;  4KLB A;  4X6J A;  2E01 A;  4W5B A;  1F2B A;  3F5V A;  5CVO B;  2DCD A;  3RVW A;  2R9F A;  2R9N A;  4XR7 A;  2B1N A;  2C0Y A;  5CVM A;  3V6E A;  4C5P A;  4YYQ A;  1EWM A;  1GEC E;  3OF8 A;  3U8E A;  4RY2 A;  3O1G A;  1EWP A;  4YYS A;  3MHS A;  4DMY A;  1K3B B;  2PNS A;  1PIP A;  2XU5 A;  3BC3 A;  1EWO A;  4I04 A;  4YYU A;  2AVW A;  2FUD A;  4CDC B;  2OZ2 A;  2E03 A;  2GFO A;  4W5C A;  2XU4 A;  4BPV A;  4CZW A;  1QOL A;  3HD3 A;  4HWY A;  4BSQ A;  4QRX A;  3AI8 A;  4OEL A;  2Y5B A;  1YT7 A;  2FRQ A;  2R6N A;  5A24 A;  3S3R A;  1KFU L;  4YYR A;  1CJL A;  4PI3 A;  2E02 A;  2PBH A;  1BQI A;  4YV8 A;  1MDW A;  3H6S A;  3N4C A;  7PCK A;  3IEJ A;  4MZS A;  2OUL A;  1Y4H A;  1HUC B;  2VHF A;  2FRA A;  1PE6 A;  3WXE A;  4P6G A;  2R9C A;  1E2T A;  3CH2 X;  3LFY A;  1X9Y A;  2JQG R;  1F2A A;  2CB5 A;  8PCH A;  1PPO A;  1CV8 A;  5CVN B;  9PAP A;  1AYV A;  3WXG A;  2G8J A;  1U9W A;  1QDQ A;  3BPM A;  1MHW A;  3MHH A;  2GHU A;  3HHA A;  1CB5 A;  2VHS A;  4MZO A;  1EWL A;  4OEM A;  2ACT A;  2H7J A;  4XUI A;  5J94 A;  3KFQ A;  3PDF A;  2DC9 A;  1YK7 A;  2HH5 A;  3CBK A;  3PW3 A;  4N8W A;  4YVA A;  1MS6 A;  1AIM A;  4MSX A;  3OF9 A;  2AYO A;  3D9W A;  1QMY A;  2AU1 A;  5CHT A;  1CQD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...