4P6GA

Crystal structure of human cathepsin s bound to a non-covalent inhibitor.
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
219
structure length
219
Chain Sequence
ILPDSVDWREKGCVTEVKYQGSCGACWAFSAVGALEAQLKLKTGKLVSLSAQNLVDCSTEKYGNKGCNGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYDSKYRAATCSKYTELPYGREDVLKEAVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSWGHNFGEEGYIRMARNKGNHCGIASFPSYPEIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Cathepsin S
publication title Discovery of Cathepsin S Inhibitor LY3000328 for the Treatment of Abdominal Aortic Aneurysm.
pubmed doi rcsb
source organism Homo sapiens
total genus 70
structure length 219
sequence length 219
chains with identical sequence B, C, D
ec nomenclature ec 3.4.22.27: Cathepsin S.
pdb deposition date 2014-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 4p6gA00
3HHIA 1X9YA 1MEMA 4X6HA 1NPZA 3PNRA 5CVMA 3IHPA 2DCAA 2E03A 2AUXA 2PNSA 2AVWA 2YJ8A 4CZWA 4YV8A 3PW3A 3P5XA 1AU3A 2FO5A 3N3KA 1STFE 4BQVA 1EWPA 1DF0A 1A6RA 1U5IA 3MORA 1PBHA 1PPDA 2R6NA 4MSXA 3H6SA 4X6JA 4XUIA 1F29A 4K7CA 2DZZA 2C0YA 2DC6A 3N4CA 2Y5BA 1F2CA 5FPWA 4DMYA 3IOQA 4BS6A 3I06A 3IMAA 2E02A 5J94A 2HHNA 3OISA 1HUCB 4YVAA 4I04A 1FH0A 3MHSA 1XKGA 4FIPA 4I07A 1SNKA 1POPA 1QXPA 3K9MA 4YYUA 1CJLA 2AYNA 2DC9A 2F7DA 3KFQA 4QBBA 1YALA 2O6XA 4DMXA 3KWZA 4MZOA 1NB5A 1EF7A 2R9CA 4N8WA 3RVVA 4AXMA 1M6DA 1AYUA 4HWYA 2OP3A 4KLBA 4CDDB 4W4UA 4Q8HA 2BDZA 1AU0A 4QH6A 1O0EA 1AYWA 2ATOA 2DJGB 2NQDB 2XU5A 3E1ZB 4N79A 1YK8A 1QMYA 1VJVA 4Q8GA 1S4VA 4PI3A 4BS5A 2FYEA 3BCNA 1PE6A 2AYOA 1AYVA 1GLOA 4FJCA 1PIPA 1ITOA 2R9FA 5CHVA 2AS8A 2XU3A 4CDFB 1IWDA 2DCCA 5CVNB 4YYVA 1BP4A 2P86A 1GCBA 1SP4B 3KKUA 3CH2X 1PPPA 2CB5A 3IV2A 4XR7A 2NQGA 3K8UA 3H89A 2G7YA 1QOLA 1CS8A 1PXVA 3HD3A 2Y6EA 1KHQA 2B1NA 4I05A 2IBIA 3WXGA 3KX1A 1GECE 3U8EA 1PCIA 3KSEA 2FQ9A 3BC3A 2FTDA 3P5UA 2E01A 3KW9A 2G8JA 3WXFA 2AU1A 3MHHA 4G54A 5F02A 1Y4HA 3F5VA 4WA6A 2DC7A 4N4ZA 3OF8A 3O1GA 3LXSA 5CVOB 1AU2A 1KFUL 3DF0A 1F2AA 3AI8A 2FRAA 2R9MA 3TNXA 3BWKA 3WXEA 1PPOA 2PADA 4OEMA 1MDWA 3BPMA 3HHAA 3OVXA 3MTNA 2E00A 1U9WA 2OULA 1JQPA 1ZIVA 2ACTA 2YJCA 2JQGR 2DZYA 1EWMA 2HD5A 3LFYA 1Q6KA 2GFOA 2FUDA 4YYSA 2YJ2A 3HWNA 1ATKA 1ICFA 2PREA 1NQCA 2P7UA 4CDCB 1KHPA 1CSBB 2XU4A 1ME4A 2G6DA 2BDLA 1AU4A 2WBFX 1ZCMA 2FRQA 3K24A 3O0UA 3V6EA 1AIMA 2PBHA 4BSQA 2F1GA 2ARYA 1NB3A 1DEUA 3IEJA 2G8EA 4YYWA 1YT7A 4QRXA 4BPVA 3BPFA 2HXZA 4PP1A 3BOWA 4ZUXU 1NLJA 1AECA 4P6EA 2AUZA 3KWBX 4W5CA 3S3RA 3CBKA 7PCKA 3C9EA 4MZSA 3USVA 2YJBA 2VHFA 3OF9A 3P5VA 4QRGA 1TLOA 2VHSA 1YK7A 4W5BA 4QRVA 3I3TA 3CBJA 2R9OA 1F2BA 5JA7A 3RVXA 2AIMA 3ERVA 4P6GA 2DJFB 1BQIA 1KXRA 2P0RA 2GHUA 4FK5A 4OELA 2OZ2A 1THEA 1EWOA 3OVZA 2CIOA 3H7DA 1TU6A 4AXLA 1MS6A 3CH3X 1CTEA 1EWLA 1MIRA 2JQFR 2DC8A 2FT2A 3PBHA 1K3BB 1GMYA 3D6SA 3H8CA 2B1MA 8PCHA 3M99A 1KFXL 2XU1A 5PADA 1NL6A 1MEGA 5EGWA 2DCDA 4YYQA 2H7JA 1BGOA 1Y08A 5JH3A 3F75A 1CB5A 1CQDA 3N3GA 1CVZA 3GCBA 3V6CA 2YJ9A 4X6IA 1QDQA 4PADA 5EF4A 1TL9A 1CPJA 2HH5A 1U9VA 1PADA 1VSNA 6PADA 5A24A 3QT4A 3ZUAA 5CHTA 3P5WA 1U9QX 1CV8A 1U9XA 3PDFA 3RVWA 2NQIA 2R9NA 3QSDA 4RY2A 3S3QA 3QJ3A 1YVBA 3NHEA 4PP2E 3IUTA 4CDEB 5K16A 2DCBA 2IPPB 2NQAA 3B79A 9PAPA 1MHWA 1ME3A 1PPNA 3H8BA 4YYRA 1BY8A
chains in the Genus database with same CATH superfamily
3OQCA 3HHIA 2JTCA 1X9YA 1MEMA 4X6HA 1NPZA 3PNRA 5CVMA 3IHPA 2DCAA 2E03A 2AUXA 2PNSA 2JRIA 3ZNHA 2AVWA 2YJ8A 4CZWA 4YV8A 3PW3A 3P5XA 1AU3A 2FO5A 3N3KA 1STFE 3C0RA 4BQVA 1EWPA 1DF0A 1A6RA 1U5IA 3MORA 1PBHA 1PPDA 2R6NA 4MSXA 3H6SA 4X6JA 4IUMA 4XUIA 3PRMA 1F29A 4K7CA 2DZZA 2C0YA 2DC6A 3N4CA 2Y5BA 1F2CA 5FPWA 3BB7A 4DMYA 3IOQA 3MJ5A 4BS6A 3I06A 3IMAA 2E02A 5J94A 5KO3A 2HHNA 3OISA 1HUCB 4YVAA 3RNVA 4I04A 1FH0A 3MHSA 1XKGA 4FIPA 3MP2A 4I07A 1SNKA 4D8EA 1POPA 1QXPA 3K9MA 2Z84A 4YYUA 1CJLA 2AYNA 2DC9A 2F7DA 3KFQA 4QBBA 3BY4A 1YALA 2O6XA 4DMXA 2DOSA 3KWZA 4MZOA 1NB5A 3B21A 1EF7A 3TRKA 2R9CA 4N8WA 3RVVA 4AXMA 1M6DA 1AYUA 4HWYA 2OP3A 4KLBA 3IFUA 4CDDB 4W4UA 4Q8HA 2AGAA 2BDZA 1AU0A 4QH6A 1O0EA 4RNAA 1AYWA 2ATOA 2DJGB 2NQDB 2XU5A 3E1ZB 4N79A 4BOQA 1YK8A 1QMYA 1VJVA 4Q8GA 1S4VA 4PI3A 4BS5A 5EZSA 2FYEA 3BCNA 1PE6A 2AYOA 1AYVA 1GLOA 4FJCA 4REZA 1PIPA 1ITOA 2UZJA 2R9FA 5CHVA 2AS8A 2FE8A 2XU3A 4CDFB 1IWDA 2DCCA 3E9SA 5CVNB 4YYVA 1BP4A 3TMPA 2P86A 1GCBA 1SP4B 3KKUA 3CH2X 1PPPA 4OVZA 2CB5A 3IV2A 4XR7A 2NQGA 4A5UA 3K8UA 3H89A 4R3DA 2G7YA 1QOLA 1CS8A 1PXVA 3HD3A 2Y6EA 1KHQA 2B1NA 4XZXA 4I05A 2IBIA 3WXGA 3KX1A 1GECE 4MI7A 3U8EA 1PCIA 3KSEA 2FQ9A 3BC3A 2FTDA 4D8IA 3P5UA 2E01A 3KW9A 2G8JA 3WXFA 2AU1A 3MHHA 4G54A 5F02A 1Y4HA 3F5VA 4WA6A 2DC7A 4N4ZA 3OF8A 3O1GA 4MM3B 3LXSA 5CVOB 1AU2A 4BOSA 1KFUL 3DF0A 1F2AA 3AI8A 2FRAA 3PRPA 2R9MA 3TNXA 3BWKA 4OVZB 3WXEA 1PPOA 2PADA 4OEMA 1MDWA 3BPMA 3PT2A 3HHAA 3OVXA 3MTNA 2E00A 1U9WA 2OULA 1JQPA 1ZIVA 2ACTA 2YJCA 2JQGR 2DZYA 1EWMA 2HD5A 3PSEA 2BU3A 3LFYA 1Q6KA 2GFOA 2FUDA 3BBAA 4YYSA 2YJ2A 3HWNA 1ATKA 1ICFA 2PREA 1NQCA 2P7UA 4CDCB 1KHPA 1CSBB 2XU4A 1ME4A 2G6DA 2BDLA 1AU4A 4P16A 2WBFX 1ZCMA 2FRQA 3K24A 4PT5A 3O0UA 3V6EA 1AIMA 2PBHA 4BSQA 2J7QC 2F1GA 2ARYA 4RKXA 1NB3A 1DEUA 3IEJA 2G8EA 4YYWA 1YT7A 3W31A 4QRXA 4BPVA 3BPFA 2HXZA 4PP1A 3BOWA 4ZUXU 1NLJA 1AECA 4P6EA 2AUZA 3KWBX 4GUAA 4W5CA 3S3RA 3CBKA 3W30A 7PCKA 3C9EA 4MZSA 3USVA 1YZBA 2YJBA 2VHFA 2BTWA 3OF9A 4D8BA 3P5VA 4QRGA 1TLOA 2VHSA 1YK7A 3PHXA 3PHUA 4W5BA 4QRVA 3I3TA 3CBJA 4M0WA 2R9OA 1F2BA 5JA7A 3RVXA 2AIMA 3ERVA 4P6GA 2DJFB 1BQIA 1KXRA 2P0RA 4RF0A 2GHUA 4FK5A 4OELA 2OZ2A 4WURA 1THEA 1EWOA 3OVZA 5JZEA 2CIOA 3H7DA 2HWKA 4ZTBA 1TU6A 4AXLA 1MS6A 3CH3X 4HXDB 1CTEA 1EWLA 1DKIA 1MIRA 2JQFR 2DC8A 2FT2A 2BTWB 3PBHA 1K3BB 1GMYA 3D6SA 3H8CA 2B1MA 8PCHA 3O65A 4BOZA 3M99A 1KFXL 2XU1A 5PADA 1NL6A 1MEGA 5EGWA 2J7QA 2DCDA 4YYQA 2H7JA 1BGOA 1Y08A 5JH3A 3F75A 1CB5A 1CQDA 3N3GA 1PVJA 1CVZA 3GCBA 3V6CA 2YJ9A 4X6IA 1QDQA 4PADA 5EF4A 5E6JA 1TL9A 4RF1A 1CPJA 2HH5A 1U9VA 1PADA 1VSNA 6PADA 4BOPA 5A24A 1UKFA 5EZQA 3QT4A 3ZUAA 5CHTA 3P5WA 4OW0A 1U9QX 1CV8A 1U9XA 3PDFA 3PHWA 4BOUA 3RVWA 2NQIA 2R9NA 3QSDA 4RY2A 3S3QA 4IP3A 3QJ3A 1YVBA 3NHEA 4PP2E 3IUTA 4CDEB 5K16A 2DCBA 2IPPB 3MTVA 2NQAA 3B79A 9PAPA 1MHWA 1ME3A 1PPNA 3H8BA 4YYRA 1BY8A
chains in the Genus database with same CATH topology
3HHIA 1X9YA 1MEMA 4X6HA 1NPZA 3PNRA 5CVMA 3IHPA 2DCAA 2E03A 2AUXA 2PNSA 1W5RA 2AVWA 2YJ8A 4CZWA 4NV7A 4YV8A 3PW3A 4C5PA 3P5XA 1AU3A 2FO5A 3N3KA 1STFE 4BQVA 1EWPA 1DF0A 1A6RA 1U5IA 3MORA 1PBHA 1PPDA 2R6NA 4MSXA 3H6SA 4X6JA 4XUIA 1F29A 4K7CA 2DZZA 2C0YA 2DC6A 3N4CA 2Y5BA 1F2CA 5FPWA 4DMYA 3IOQA 4BS6A 3I06A 3IMAA 2E02A 5J94A 2HHNA 3OISA 1HUCB 4YVAA 4I04A 1FH0A 3MHSA 1XKGA 4FIPA 4I07A 1SNKA 1POPA 1QXPA 3K9MA 1W4TA 4YYUA 1CJLA 2AYNA 2DC9A 2F7DA 3KFQA 4QBBA 1YALA 2O6XA 4DMXA 3KWZA 4MZOA 1NB5A 1EF7A 2R9CA 4N8WA 3RVVA 4AXMA 1M6DA 1AYUA 4HWYA 2OP3A 4KLBA 4CDDB 4W4UA 4Q8HA 2BDZA 1E2TA 1AU0A 4QH6A 1O0EA 3D9WA 1AYWA 2ATOA 2DJGB 2NQDB 2XU5A 3E1ZB 4B55A 4N79A 1YK8A 1QMYA 1VJVA 4Q8GA 2VFBA 1S4VA 4PI3A 4BS5A 2FYEA 3BCNA 1PE6A 2AYOA 1AYVA 1GLOA 4FJCA 1PIPA 1ITOA 2R9FA 5CHVA 2AS8A 2XU3A 4CDFB 1IWDA 2DCCA 5CVNB 4YYVA 1BP4A 4GUZA 2P86A 1GCBA 1SP4B 1W6FA 3KKUA 3CH2X 1PPPA 2CB5A 3IV2A 4XR7A 2NQGA 3K8UA 3H89A 2G7YA 1QOLA 1CS8A 1PXVA 3HD3A 2Y6EA 1KHQA 2B1NA 3LTWA 4I05A 2IBIA 3WXGA 3KX1A 1GECE 3U8EA 1PCIA 3KSEA 2FQ9A 3BC3A 2FTDA 3P5UA 2E01A 3KW9A 2G8JA 3WXFA 2AU1A 3MHHA 4G54A 5F02A 1Y4HA 3F5VA 4WA6A 2DC7A 4N4ZA 3OF8A 3O1GA 3LXSA 5CVOB 1AU2A 1KFUL 3DF0A 1F2AA 3AI8A 2FRAA 2R9MA 3TNXA 3BWKA 3WXEA 1PPOA 2PADA 4OEMA 1MDWA 3BPMA 3HHAA 3OVXA 4BGFA 3MTNA 2E00A 1U9WA 2OULA 1GX3A 1JQPA 1ZIVA 2ACTA 2VFCA 2YJCA 2JQGR 2DZYA 1EWMA 2HD5A 3LFYA 1Q6KA 2GFOA 2FUDA 4YYSA 2YJ2A 3HWNA 1ATKA 1ICFA 2PREA 1NQCA 2P7UA 4CDCB 1KHPA 1CSBB 2XU4A 1ME4A 2G6DA 2BDLA 1AU4A 2WBFX 1ZCMA 2FRQA 3K24A 3O0UA 3V6EA 1AIMA 2PBHA 4BSQA 2F1GA 2ARYA 1NB3A 1DEUA 3IEJA 2G8EA 4YYWA 1YT7A 4QRXA 4BPVA 3BPFA 2HXZA 4PP1A 3BOWA 4ZUXU 1NLJA 1AECA 4P6EA 2AUZA 3KWBX 4W5CA 3S3RA 3CBKA 7PCKA 3C9EA 4MZSA 3USVA 2YJBA 2VHFA 3OF9A 3P5VA 4QRGA 1TLOA 2VHSA 1YK7A 4W5BA 4QRVA 3I3TA 3CBJA 2R9OA 1F2BA 5JA7A 3RVXA 2AIMA 3ERVA 4P6GA 2DJFB 1BQIA 1KXRA 2P0RA 2GHUA 4FK5A 4OELA 2OZ2A 1THEA 1EWOA 3OVZA 2CIOA 3H7DA 1TU6A 4AXLA 1MS6A 3CH3X 1CTEA 4NV8A 1EWLA 1MIRA 2JQFR 2DC8A 2FT2A 3PBHA 1K3BB 1GMYA 3D6SA 3H8CA 2B1MA 8PCHA 3M99A 1KFXL 2XU1A 5PADA 1NL6A 1MEGA 2BSZA 5EGWA 2DCDA 4YYQA 2H7JA 1BGOA 1Y08A 5JH3A 3F75A 1CB5A 1CQDA 3N3GA 1CVZA 3GCBA 3V6CA 2YJ9A 4X6IA 1QDQA 4PADA 5EF4A 1TL9A 1CPJA 2HH5A 1U9VA 1PADA 1VSNA 6PADA 5A24A 3QT4A 3ZUAA 5CHTA 3P5WA 1U9QX 1CV8A 1U9XA 3PDFA 3RVWA 2NQIA 2R9NA 3QSDA 4RY2A 3S3QA 3QJ3A 1YVBA 3NHEA 4PP2E 3IUTA 4CDEB 5K16A 2DCBA 2IPPB 2NQAA 3B79A 9PAPA 1MHWA 1ME3A 1PPNA 3H8BA 4YYRA 1BY8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HHI A;  1X9Y A;  1MEM A;  4X6H A;  1NPZ A;  3PNR A;  5CVM A;  3IHP A;  2DCA A;  2E03 A;  2AUX A;  2PNS A;  2AVW A;  2YJ8 A;  4CZW A;  4YV8 A;  3PW3 A;  3P5X A;  1AU3 A;  2FO5 A;  3N3K A;  1STF E;  4BQV A;  1EWP A;  1DF0 A;  1A6R A;  1U5I A;  3MOR A;  1PBH A;  1PPD A;  2R6N A;  4MSX A;  3H6S A;  4X6J A;  4XUI A;  1F29 A;  4K7C A;  2DZZ A;  2C0Y A;  2DC6 A;  3N4C A;  2Y5B A;  1F2C A;  5FPW A;  4DMY A;  3IOQ A;  4BS6 A;  3I06 A;  3IMA A;  2E02 A;  5J94 A;  2HHN A;  3OIS A;  1HUC B;  4YVA A;  4I04 A;  1FH0 A;  3MHS A;  1XKG A;  4FIP A;  4I07 A;  1SNK A;  1POP A;  1QXP A;  3K9M A;  4YYU A;  1CJL A;  2AYN A;  2DC9 A;  2F7D A;  3KFQ A;  4QBB A;  1YAL A;  2O6X A;  4DMX A;  3KWZ A;  4MZO A;  1NB5 A;  1EF7 A;  2R9C A;  4N8W A;  3RVV A;  4AXM A;  1M6D A;  1AYU A;  4HWY A;  2OP3 A;  4KLB A;  4CDD B;  4W4U A;  4Q8H A;  2BDZ A;  1AU0 A;  4QH6 A;  1O0E A;  1AYW A;  2ATO A;  2DJG B;  2NQD B;  2XU5 A;  3E1Z B;  4N79 A;  1YK8 A;  1QMY A;  1VJV A;  4Q8G A;  1S4V A;  4PI3 A;  4BS5 A;  2FYE A;  3BCN A;  1PE6 A;  2AYO A;  1AYV A;  1GLO A;  4FJC A;  1PIP A;  1ITO A;  2R9F A;  5CHV A;  2AS8 A;  2XU3 A;  4CDF B;  1IWD A;  2DCC A;  5CVN B;  4YYV A;  1BP4 A;  2P86 A;  1GCB A;  1SP4 B;  3KKU A;  3CH2 X;  1PPP A;  2CB5 A;  3IV2 A;  4XR7 A;  2NQG A;  3K8U A;  3H89 A;  2G7Y A;  1QOL A;  1CS8 A;  1PXV A;  3HD3 A;  2Y6E A;  1KHQ A;  2B1N A;  4I05 A;  2IBI A;  3WXG A;  3KX1 A;  1GEC E;  3U8E A;  1PCI A;  3KSE A;  2FQ9 A;  3BC3 A;  2FTD A;  3P5U A;  2E01 A;  3KW9 A;  2G8J A;  3WXF A;  2AU1 A;  3MHH A;  4G54 A;  5F02 A;  1Y4H A;  3F5V A;  4WA6 A;  2DC7 A;  4N4Z A;  3OF8 A;  3O1G A;  3LXS A;  5CVO B;  1AU2 A;  1KFU L;  3DF0 A;  1F2A A;  3AI8 A;  2FRA A;  2R9M A;  3TNX A;  3BWK A;  3WXE A;  1PPO A;  2PAD A;  4OEM A;  1MDW A;  3BPM A;  3HHA A;  3OVX A;  3MTN A;  2E00 A;  1U9W A;  2OUL A;  1JQP A;  1ZIV A;  2ACT A;  2YJC A;  2JQG R;  2DZY A;  1EWM A;  2HD5 A;  3LFY A;  1Q6K A;  2GFO A;  2FUD A;  4YYS A;  2YJ2 A;  3HWN A;  1ATK A;  1ICF A;  2PRE A;  1NQC A;  2P7U A;  4CDC B;  1KHP A;  1CSB B;  2XU4 A;  1ME4 A;  2G6D A;  2BDL A;  1AU4 A;  2WBF X;  1ZCM A;  2FRQ A;  3K24 A;  3O0U A;  3V6E A;  1AIM A;  2PBH A;  4BSQ A;  2F1G A;  2ARY A;  1NB3 A;  1DEU A;  3IEJ A;  2G8E A;  4YYW A;  1YT7 A;  4QRX A;  4BPV A;  3BPF A;  2HXZ A;  4PP1 A;  3BOW A;  4ZUX U;  1NLJ A;  1AEC A;  4P6E A;  2AUZ A;  3KWB X;  4W5C A;  3S3R A;  3CBK A;  7PCK A;  3C9E A;  4MZS A;  3USV A;  2YJB A;  2VHF A;  3OF9 A;  3P5V A;  4QRG A;  1TLO A;  2VHS A;  1YK7 A;  4W5B A;  4QRV A;  3I3T A;  3CBJ A;  2R9O A;  1F2B A;  5JA7 A;  3RVX A;  2AIM A;  3ERV A;  4P6G A;  2DJF B;  1BQI A;  1KXR A;  2P0R A;  2GHU A;  4FK5 A;  4OEL A;  2OZ2 A;  1THE A;  1EWO A;  3OVZ A;  2CIO A;  3H7D A;  1TU6 A;  4AXL A;  1MS6 A;  3CH3 X;  1CTE A;  1EWL A;  1MIR A;  2JQF R;  2DC8 A;  2FT2 A;  3PBH A;  1K3B B;  1GMY A;  3D6S A;  3H8C A;  2B1M A;  8PCH A;  3M99 A;  1KFX L;  2XU1 A;  5PAD A;  1NL6 A;  1MEG A;  5EGW A;  2DCD A;  4YYQ A;  2H7J A;  1BGO A;  1Y08 A;  5JH3 A;  3F75 A;  1CB5 A;  1CQD A;  3N3G A;  1CVZ A;  3GCB A;  3V6C A;  2YJ9 A;  4X6I A;  1QDQ A;  4PAD A;  5EF4 A;  1TL9 A;  1CPJ A;  2HH5 A;  1U9V A;  1PAD A;  1VSN A;  6PAD A;  5A24 A;  3QT4 A;  3ZUA A;  5CHT A;  3P5W A;  1U9Q X;  1CV8 A;  1U9X A;  3PDF A;  3RVW A;  2NQI A;  2R9N A;  3QSD A;  4RY2 A;  3S3Q A;  3QJ3 A;  1YVB A;  3NHE A;  4PP2 E;  3IUT A;  4CDE B;  5K16 A;  2DCB A;  2IPP B;  2NQA A;  3B79 A;  9PAP A;  1MHW A;  1ME3 A;  1PPN A;  3H8B A;  4YYR A;  1BY8 A; 
#chains in the Genus database with same CATH topology
 3OQC A;  3HHI A;  2JTC A;  1X9Y A;  1MEM A;  4X6H A;  1NPZ A;  3PNR A;  5CVM A;  3IHP A;  2DCA A;  2E03 A;  2AUX A;  2PNS A;  2JRI A;  3ZNH A;  2AVW A;  2YJ8 A;  4CZW A;  4YV8 A;  3PW3 A;  3P5X A;  1AU3 A;  2FO5 A;  3N3K A;  1STF E;  3C0R A;  4BQV A;  1EWP A;  1DF0 A;  1A6R A;  1U5I A;  3MOR A;  1PBH A;  1PPD A;  2R6N A;  4MSX A;  3H6S A;  4X6J A;  4IUM A;  4XUI A;  3PRM A;  1F29 A;  4K7C A;  2DZZ A;  2C0Y A;  2DC6 A;  3N4C A;  2Y5B A;  1F2C A;  5FPW A;  3BB7 A;  4DMY A;  3IOQ A;  3MJ5 A;  4BS6 A;  3I06 A;  3IMA A;  2E02 A;  5J94 A;  5KO3 A;  2HHN A;  3OIS A;  1HUC B;  4YVA A;  3RNV A;  4I04 A;  1FH0 A;  3MHS A;  1XKG A;  4FIP A;  3MP2 A;  4I07 A;  1SNK A;  4D8E A;  1POP A;  1QXP A;  3K9M A;  2Z84 A;  4YYU A;  1CJL A;  2AYN A;  2DC9 A;  2F7D A;  3KFQ A;  4QBB A;  3BY4 A;  1YAL A;  2O6X A;  4DMX A;  2DOS A;  3KWZ A;  4MZO A;  1NB5 A;  3B21 A;  1EF7 A;  3TRK A;  2R9C A;  4N8W A;  3RVV A;  4AXM A;  1M6D A;  1AYU A;  4HWY A;  2OP3 A;  4KLB A;  3IFU A;  4CDD B;  4W4U A;  4Q8H A;  2AGA A;  2BDZ A;  1AU0 A;  4QH6 A;  1O0E A;  4RNA A;  1AYW A;  2ATO A;  2DJG B;  2NQD B;  2XU5 A;  3E1Z B;  4N79 A;  4BOQ A;  1YK8 A;  1QMY A;  1VJV A;  4Q8G A;  1S4V A;  4PI3 A;  4BS5 A;  5EZS A;  2FYE A;  3BCN A;  1PE6 A;  2AYO A;  1AYV A;  1GLO A;  4FJC A;  4REZ A;  1PIP A;  1ITO A;  2UZJ A;  2R9F A;  5CHV A;  2AS8 A;  2FE8 A;  2XU3 A;  4CDF B;  1IWD A;  2DCC A;  3E9S A;  5CVN B;  4YYV A;  1BP4 A;  3TMP A;  2P86 A;  1GCB A;  1SP4 B;  3KKU A;  3CH2 X;  1PPP A;  4OVZ A;  2CB5 A;  3IV2 A;  4XR7 A;  2NQG A;  4A5U A;  3K8U A;  3H89 A;  4R3D A;  2G7Y A;  1QOL A;  1CS8 A;  1PXV A;  3HD3 A;  2Y6E A;  1KHQ A;  2B1N A;  4XZX A;  4I05 A;  2IBI A;  3WXG A;  3KX1 A;  1GEC E;  4MI7 A;  3U8E A;  1PCI A;  3KSE A;  2FQ9 A;  3BC3 A;  2FTD A;  4D8I A;  3P5U A;  2E01 A;  3KW9 A;  2G8J A;  3WXF A;  2AU1 A;  3MHH A;  4G54 A;  5F02 A;  1Y4H A;  3F5V A;  4WA6 A;  2DC7 A;  4N4Z A;  3OF8 A;  3O1G A;  4MM3 B;  3LXS A;  5CVO B;  1AU2 A;  4BOS A;  1KFU L;  3DF0 A;  1F2A A;  3AI8 A;  2FRA A;  3PRP A;  2R9M A;  3TNX A;  3BWK A;  4OVZ B;  3WXE A;  1PPO A;  2PAD A;  4OEM A;  1MDW A;  3BPM A;  3PT2 A;  3HHA A;  3OVX A;  3MTN A;  2E00 A;  1U9W A;  2OUL A;  1JQP A;  1ZIV A;  2ACT A;  2YJC A;  2JQG R;  2DZY A;  1EWM A;  2HD5 A;  3PSE A;  2BU3 A;  3LFY A;  1Q6K A;  2GFO A;  2FUD A;  3BBA A;  4YYS A;  2YJ2 A;  3HWN A;  1ATK A;  1ICF A;  2PRE A;  1NQC A;  2P7U A;  4CDC B;  1KHP A;  1CSB B;  2XU4 A;  1ME4 A;  2G6D A;  2BDL A;  1AU4 A;  4P16 A;  2WBF X;  1ZCM A;  2FRQ A;  3K24 A;  4PT5 A;  3O0U A;  3V6E A;  1AIM A;  2PBH A;  4BSQ A;  2J7Q C;  2F1G A;  2ARY A;  4RKX A;  1NB3 A;  1DEU A;  3IEJ A;  2G8E A;  4YYW A;  1YT7 A;  3W31 A;  4QRX A;  4BPV A;  3BPF A;  2HXZ A;  4PP1 A;  3BOW A;  4ZUX U;  1NLJ A;  1AEC A;  4P6E A;  2AUZ A;  3KWB X;  4GUA A;  4W5C A;  3S3R A;  3CBK A;  3W30 A;  7PCK A;  3C9E A;  4MZS A;  3USV A;  1YZB A;  2YJB A;  2VHF A;  2BTW A;  3OF9 A;  4D8B A;  3P5V A;  4QRG A;  1TLO A;  2VHS A;  1YK7 A;  3PHX A;  3PHU A;  4W5B A;  4QRV A;  3I3T A;  3CBJ A;  4M0W A;  2R9O A;  1F2B A;  5JA7 A;  3RVX A;  2AIM A;  3ERV A;  4P6G A;  2DJF B;  1BQI A;  1KXR A;  2P0R A;  4RF0 A;  2GHU A;  4FK5 A;  4OEL A;  2OZ2 A;  4WUR A;  1THE A;  1EWO A;  3OVZ A;  5JZE A;  2CIO A;  3H7D A;  2HWK A;  4ZTB A;  1TU6 A;  4AXL A;  1MS6 A;  3CH3 X;  4HXD B;  1CTE A;  1EWL A;  1DKI A;  1MIR A;  2JQF R;  2DC8 A;  2FT2 A;  2BTW B;  3PBH A;  1K3B B;  1GMY A;  3D6S A;  3H8C A;  2B1M A;  8PCH A;  3O65 A;  4BOZ A;  3M99 A;  1KFX L;  2XU1 A;  5PAD A;  1NL6 A;  1MEG A;  5EGW A;  2J7Q A;  2DCD A;  4YYQ A;  2H7J A;  1BGO A;  1Y08 A;  5JH3 A;  3F75 A;  1CB5 A;  1CQD A;  3N3G A;  1PVJ A;  1CVZ A;  3GCB A;  3V6C A;  2YJ9 A;  4X6I A;  1QDQ A;  4PAD A;  5EF4 A;  5E6J A;  1TL9 A;  4RF1 A;  1CPJ A;  2HH5 A;  1U9V A;  1PAD A;  1VSN A;  6PAD A;  4BOP A;  5A24 A;  1UKF A;  5EZQ A;  3QT4 A;  3ZUA A;  5CHT A;  3P5W A;  4OW0 A;  1U9Q X;  1CV8 A;  1U9X A;  3PDF A;  3PHW A;  4BOU A;  3RVW A;  2NQI A;  2R9N A;  3QSD A;  4RY2 A;  3S3Q A;  4IP3 A;  3QJ3 A;  1YVB A;  3NHE A;  4PP2 E;  3IUT A;  4CDE B;  5K16 A;  2DCB A;  2IPP B;  3MTV A;  2NQA A;  3B79 A;  9PAP A;  1MHW A;  1ME3 A;  1PPN A;  3H8B A;  4YYR A;  1BY8 A; 
#chains in the Genus database with same CATH homology
 3HHI A;  1X9Y A;  1MEM A;  4X6H A;  1NPZ A;  3PNR A;  5CVM A;  3IHP A;  2DCA A;  2E03 A;  2AUX A;  2PNS A;  1W5R A;  2AVW A;  2YJ8 A;  4CZW A;  4NV7 A;  4YV8 A;  3PW3 A;  4C5P A;  3P5X A;  1AU3 A;  2FO5 A;  3N3K A;  1STF E;  4BQV A;  1EWP A;  1DF0 A;  1A6R A;  1U5I A;  3MOR A;  1PBH A;  1PPD A;  2R6N A;  4MSX A;  3H6S A;  4X6J A;  4XUI A;  1F29 A;  4K7C A;  2DZZ A;  2C0Y A;  2DC6 A;  3N4C A;  2Y5B A;  1F2C A;  5FPW A;  4DMY A;  3IOQ A;  4BS6 A;  3I06 A;  3IMA A;  2E02 A;  5J94 A;  2HHN A;  3OIS A;  1HUC B;  4YVA A;  4I04 A;  1FH0 A;  3MHS A;  1XKG A;  4FIP A;  4I07 A;  1SNK A;  1POP A;  1QXP A;  3K9M A;  1W4T A;  4YYU A;  1CJL A;  2AYN A;  2DC9 A;  2F7D A;  3KFQ A;  4QBB A;  1YAL A;  2O6X A;  4DMX A;  3KWZ A;  4MZO A;  1NB5 A;  1EF7 A;  2R9C A;  4N8W A;  3RVV A;  4AXM A;  1M6D A;  1AYU A;  4HWY A;  2OP3 A;  4KLB A;  4CDD B;  4W4U A;  4Q8H A;  2BDZ A;  1E2T A;  1AU0 A;  4QH6 A;  1O0E A;  3D9W A;  1AYW A;  2ATO A;  2DJG B;  2NQD B;  2XU5 A;  3E1Z B;  4B55 A;  4N79 A;  1YK8 A;  1QMY A;  1VJV A;  4Q8G A;  2VFB A;  1S4V A;  4PI3 A;  4BS5 A;  2FYE A;  3BCN A;  1PE6 A;  2AYO A;  1AYV A;  1GLO A;  4FJC A;  1PIP A;  1ITO A;  2R9F A;  5CHV A;  2AS8 A;  2XU3 A;  4CDF B;  1IWD A;  2DCC A;  5CVN B;  4YYV A;  1BP4 A;  4GUZ A;  2P86 A;  1GCB A;  1SP4 B;  1W6F A;  3KKU A;  3CH2 X;  1PPP A;  2CB5 A;  3IV2 A;  4XR7 A;  2NQG A;  3K8U A;  3H89 A;  2G7Y A;  1QOL A;  1CS8 A;  1PXV A;  3HD3 A;  2Y6E A;  1KHQ A;  2B1N A;  3LTW A;  4I05 A;  2IBI A;  3WXG A;  3KX1 A;  1GEC E;  3U8E A;  1PCI A;  3KSE A;  2FQ9 A;  3BC3 A;  2FTD A;  3P5U A;  2E01 A;  3KW9 A;  2G8J A;  3WXF A;  2AU1 A;  3MHH A;  4G54 A;  5F02 A;  1Y4H A;  3F5V A;  4WA6 A;  2DC7 A;  4N4Z A;  3OF8 A;  3O1G A;  3LXS A;  5CVO B;  1AU2 A;  1KFU L;  3DF0 A;  1F2A A;  3AI8 A;  2FRA A;  2R9M A;  3TNX A;  3BWK A;  3WXE A;  1PPO A;  2PAD A;  4OEM A;  1MDW A;  3BPM A;  3HHA A;  3OVX A;  4BGF A;  3MTN A;  2E00 A;  1U9W A;  2OUL A;  1GX3 A;  1JQP A;  1ZIV A;  2ACT A;  2VFC A;  2YJC A;  2JQG R;  2DZY A;  1EWM A;  2HD5 A;  3LFY A;  1Q6K A;  2GFO A;  2FUD A;  4YYS A;  2YJ2 A;  3HWN A;  1ATK A;  1ICF A;  2PRE A;  1NQC A;  2P7U A;  4CDC B;  1KHP A;  1CSB B;  2XU4 A;  1ME4 A;  2G6D A;  2BDL A;  1AU4 A;  2WBF X;  1ZCM A;  2FRQ A;  3K24 A;  3O0U A;  3V6E A;  1AIM A;  2PBH A;  4BSQ A;  2F1G A;  2ARY A;  1NB3 A;  1DEU A;  3IEJ A;  2G8E A;  4YYW A;  1YT7 A;  4QRX A;  4BPV A;  3BPF A;  2HXZ A;  4PP1 A;  3BOW A;  4ZUX U;  1NLJ A;  1AEC A;  4P6E A;  2AUZ A;  3KWB X;  4W5C A;  3S3R A;  3CBK A;  7PCK A;  3C9E A;  4MZS A;  3USV A;  2YJB A;  2VHF A;  3OF9 A;  3P5V A;  4QRG A;  1TLO A;  2VHS A;  1YK7 A;  4W5B A;  4QRV A;  3I3T A;  3CBJ A;  2R9O A;  1F2B A;  5JA7 A;  3RVX A;  2AIM A;  3ERV A;  4P6G A;  2DJF B;  1BQI A;  1KXR A;  2P0R A;  2GHU A;  4FK5 A;  4OEL A;  2OZ2 A;  1THE A;  1EWO A;  3OVZ A;  2CIO A;  3H7D A;  1TU6 A;  4AXL A;  1MS6 A;  3CH3 X;  1CTE A;  4NV8 A;  1EWL A;  1MIR A;  2JQF R;  2DC8 A;  2FT2 A;  3PBH A;  1K3B B;  1GMY A;  3D6S A;  3H8C A;  2B1M A;  8PCH A;  3M99 A;  1KFX L;  2XU1 A;  5PAD A;  1NL6 A;  1MEG A;  2BSZ A;  5EGW A;  2DCD A;  4YYQ A;  2H7J A;  1BGO A;  1Y08 A;  5JH3 A;  3F75 A;  1CB5 A;  1CQD A;  3N3G A;  1CVZ A;  3GCB A;  3V6C A;  2YJ9 A;  4X6I A;  1QDQ A;  4PAD A;  5EF4 A;  1TL9 A;  1CPJ A;  2HH5 A;  1U9V A;  1PAD A;  1VSN A;  6PAD A;  5A24 A;  3QT4 A;  3ZUA A;  5CHT A;  3P5W A;  1U9Q X;  1CV8 A;  1U9X A;  3PDF A;  3RVW A;  2NQI A;  2R9N A;  3QSD A;  4RY2 A;  3S3Q A;  3QJ3 A;  1YVB A;  3NHE A;  4PP2 E;  3IUT A;  4CDE B;  5K16 A;  2DCB A;  2IPP B;  2NQA A;  3B79 A;  9PAP A;  1MHW A;  1ME3 A;  1PPN A;  3H8B A;  4YYR A;  1BY8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...