4MI7A

Crystal structure of salmonella effector protein gtge
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
134
structure length
124
Chain Sequence
GIDIIECENLLKEMNVQKIPESSLFTNIKEALQAEVFNSTVEDDFESFISYELQNHGPLMLIRPSSECLHAECIVGYDSEVKKVLIYDSNTSPEWQSNIDVYDKLTLAFNCSICGLYYDGVYEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase, toxin
molecule keywords Bacteriophage encoded virulence factor
publication title Structural and enzymatic characterization of a host-specificity determinant from Salmonella.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium str. sl1344
total genus 35
structure length 124
sequence length 134
ec nomenclature
pdb deposition date 2013-08-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.170 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 4mi7A00
4MI7A
chains in the Genus database with same CATH superfamily
2GHUA 4M0WA 4GUAA 1AIMA 4YYWA 2F7DA 3MTNA 1S4VA 2AYOA 4W5BA 1ITOA 1MIRA 3E9SA 1DF0A 4QBBA 5E6JA 3OQCA 4I04A 3WXGA 3RVWA 1MS6A 3IMAA 2AU1A 3M99A 3C0RA 4IP3A 2NQDB 2FYEA 1KXRA 2ARYA 4P16A 3ERVA 1PVJA 1A6RA 2VHSA 3WXFA 3I06A 3KW9A 5JH3A 1U9VA 2DZYA 4I07A 3PSEA 2FE8A 4MZOA 8PCHA 1KFUL 7PCKA 2B1NA 4OEMA 4HWYA 4D8EA 2FT2A 4X6IA 1POPA 4K7CA 2YJBA 2JRIA 1QDQA 1CV8A 4I05A 2J7QA 2AUZA 5J94A 1MHWA 3PRMA 1PIPA 2BDZA 4MZSA 3LFYA 1O0EA 2FO5A 3IHPA 3KKUA 4ZTBA 3ZNHA 4QH6A 3USVA 2O6XA 1NLJA 4OELA 2E00A 3WXEA 3PDFA 3N4CA 2DC8A 1GLOA 4CDEB 1AU3A 3CBKA 3U8EA 1F29A 3P5UA 4BOSA 3BWKA 3KFQA 3H8BA 2CB5A 1TU6A 2G6DA 2NQIA 2YJ9A 2XU1A 1STFE 2JQGR 3MP2A 1EF7A 2C0YA 1U9XA 3F75A 4Q8HA 4RY2A 2PBHA 2AUXA 1AU2A 5CHTA 2NQAA 1XKGA 3S3QA 2OP3A 2B1MA 4X6JA 2DC9A 3S3RA 1CQDA 1BGOA 3MJ5A 9PAPA 1BY8A 1Y4HA 1ZCMA 3O65A 3MTVA 3BC3A 2OULA 4N4ZA 3K24A 4AXLA 3OISA 2HWKA 3BPMA 1DEUA 3H7DA 1X9YA 2E01A 2FQ9A 2ACTA 2XU4A 4WA6A 2PNSA 1NB5A 2DCDA 4P6EA 3GCBA 3PHWA 2WBFX 6PADA 3H8CA 1TLOA 5KO3A 2BDLA 5CHVA 2GFOA 3IUTA 3BCNA 4YV8A 1MDWA 3BOWA 2BTWB 1EWOA 4YYSA 4PADA 3N3KA 3IEJA 3OVZA 1MEMA 2R9CA 3V6EA 1CS8A 2HXZA 1YZBA 3P5WA 5EGWA 1THEA 2DCBA 1ME4A 2Y6EA 1AU0A 5EZSA 2DCCA 1ZIVA 3CBJA 1GCBA 1KHPA 3MHSA 1EWPA 3QJ3A 3O0UA 4D8IA 1EWLA 1PE6A 1M6DA 4MSXA 1U5IA 3B21A 4PP2E 1NPZA 2DOSA 2JQFR 3N3GA 1PPPA 1CJLA 3K8UA 3IOQA 3RVVA 3D6SA 4BSQA 3DF0A 4OVZB 4QRGA 1ATKA 3PHUA 3V6CA 4BOPA 2FRQA 3K9MA 4PT5A 4RNAA 2DCAA 3PHXA 3C9EA 1BP4A 2DC6A 1QMYA 1PCIA 4Q8GA 1BQIA 3CH3X 1AU4A 1VSNA 3MHHA 2NQGA 2YJ2A 1F2CA 5F02A 4XUIA 1KFXL 1PPDA 3B79A 4YYRA 1YK8A 1CB5A 5A24A 3QT4A 2OZ2A 1CVZA 1UKFA 4REZA 2FUDA 1IWDA 3P5XA 1CPJA 4YYUA 2P7UA 2IPPB 3KX1A 4W5CA 4YYQA 1SP4B 2YJ8A 1EWMA 4HXDB 2G8JA 4PI3A 3ZUAA 2PADA 3IFUA 3OF8A 1PADA 2R9NA 4WURA 3LXSA 2PREA 4XZXA 4BPVA 4QRXA 4BOZA 1AYUA 3HHAA 1QXPA 4BOUA 3PRPA 4FK5A 4CDDB 2DC7A 2FRAA 4IUMA 1AECA 2AVWA 4YYVA 4R3DA 1CSBB 4CZWA 2VHFA 1Q6KA 4DMYA 1MEGA 5CVOB 1PPNA 4FJCA 5CVMA 2JTCA 1VJVA 3BB7A 1AYVA 2Y5BA 4CDCB 1DKIA 2AS8A 3PT2A 4BOQA 2J7QC 2YJCA 4QRVA 1CTEA 4X6HA 2HHNA 3BBAA 1TL9A 4KLBA 4P6GA 1K3BB 3TRKA 2BU3A 3TMPA 3HHIA 2XU5A 4RF1A 5EF4A 1AYWA 3RNVA 5FPWA 3BPFA 3HD3A 1NL6A 3KWBX 1Y08A 2HD5A 1ME3A 4BS5A 3I3TA 2E02A 1F2AA 3PBHA 2DJGB 1NB3A 4A5UA 1KHQA 3RVXA 2R9FA 1PPOA 4G54A 3W31A 4BS6A 2BTWA 2Z84A 3F5VA 3KSEA 3IV2A 3MORA 3OF9A 2DJFB 5JA7A 1HUCB 1U9QX 2HH5A 2R9MA 1SNKA 2R6NA 3O1GA 3OVXA 4PP1A 2UZJA 5K16A 3H89A 3HWNA 1YVBA 2F1GA 1PBHA 3QSDA 5EZQA 4MM3B 2AGAA 3NHEA 4CDFB 1NQCA 3W30A 1GECE 2G7YA 4N79A 3PNRA 4MI7A 3H6SA 2ATOA 4OW0A 4OVZA 1YT7A 2FTDA 4N8WA 4AXMA 4ZUXU 2CIOA 1YK7A 4RKXA 1JQPA 4DMXA 4BQVA 3P5VA 4YVAA 2G8EA 3KWZA 4D8BA 3TNXA 2AIMA 1F2BA 3AI8A 5JZEA 3PW3A 2E03A 4XR7A 1FH0A 2AYNA 1ICFA 2P0RA 4RF0A 2P86A 5PADA 2XU3A 4W4UA 1U9WA 2H7JA 1YALA 2DZZA 2R9OA 5CVNB 3CH2X 1PXVA 1GMYA 1QOLA 2IBIA 3E1ZB 4FIPA 3BY4A
chains in the Genus database with same CATH topology
4M0WA 4GUAA 3E9SA 3MJ5A 5E6JA 3OQCA 3O65A 3MTVA 4A5UA 3C0RA 4IP3A 1UKFA 4REZA 2HWKA 3W31A 4P16A 2BTWA 1PVJA 2Z84A 3PSEA 2FE8A 4HXDB 3IFUA 4WURA 2UZJA 4XZXA 4D8EA 4BOZA 3PHWA 2JRIA 5KO3A 4BOUA 3PRPA 5EZQA 2J7QA 4MM3B 2AGAA 4IUMA 2BTWB 4R3DA 3PRMA 1YZBA 3W30A 5EZSA 2JTCA 4MI7A 3BB7A 4OW0A 4OVZA 4ZTBA 3ZNHA 1DKIA 4RKXA 3PT2A 4BOQA 2J7QC 4D8IA 4D8BA 3B21A 5JZEA 3BBAA 2DOSA 4RF0A 4BOSA 3TRKA 2BU3A 3TMPA 4RF1A 4OVZB 3MP2A 3PHUA 4BOPA 3RNVA 4PT5A 4RNAA 3BY4A 3PHXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MI7 A; 
#chains in the Genus database with same CATH topology
 2GHU A;  4M0W A;  4GUA A;  1AIM A;  4YYW A;  2F7D A;  3MTN A;  1S4V A;  2AYO A;  4W5B A;  1ITO A;  1MIR A;  3E9S A;  1DF0 A;  4QBB A;  5E6J A;  3OQC A;  4I04 A;  3WXG A;  3RVW A;  1MS6 A;  3IMA A;  2AU1 A;  3M99 A;  3C0R A;  4IP3 A;  2NQD B;  2FYE A;  1KXR A;  2ARY A;  4P16 A;  3ERV A;  1PVJ A;  1A6R A;  2VHS A;  3WXF A;  3I06 A;  3KW9 A;  5JH3 A;  1U9V A;  2DZY A;  4I07 A;  3PSE A;  2FE8 A;  4MZO A;  8PCH A;  1KFU L;  7PCK A;  2B1N A;  4OEM A;  4HWY A;  4D8E A;  2FT2 A;  4X6I A;  1POP A;  4K7C A;  2YJB A;  2JRI A;  1QDQ A;  1CV8 A;  4I05 A;  2J7Q A;  2AUZ A;  5J94 A;  1MHW A;  3PRM A;  1PIP A;  2BDZ A;  4MZS A;  3LFY A;  1O0E A;  2FO5 A;  3IHP A;  3KKU A;  4ZTB A;  3ZNH A;  4QH6 A;  3USV A;  2O6X A;  1NLJ A;  4OEL A;  2E00 A;  3WXE A;  3PDF A;  3N4C A;  2DC8 A;  1GLO A;  4CDE B;  1AU3 A;  3CBK A;  3U8E A;  1F29 A;  3P5U A;  4BOS A;  3BWK A;  3KFQ A;  3H8B A;  2CB5 A;  1TU6 A;  2G6D A;  2NQI A;  2YJ9 A;  2XU1 A;  1STF E;  2JQG R;  3MP2 A;  1EF7 A;  2C0Y A;  1U9X A;  3F75 A;  4Q8H A;  4RY2 A;  2PBH A;  2AUX A;  1AU2 A;  5CHT A;  2NQA A;  1XKG A;  3S3Q A;  2OP3 A;  2B1M A;  4X6J A;  2DC9 A;  3S3R A;  1CQD A;  1BGO A;  3MJ5 A;  9PAP A;  1BY8 A;  1Y4H A;  1ZCM A;  3O65 A;  3MTV A;  3BC3 A;  2OUL A;  4N4Z A;  3K24 A;  4AXL A;  3OIS A;  2HWK A;  3BPM A;  1DEU A;  3H7D A;  1X9Y A;  2E01 A;  2FQ9 A;  2ACT A;  2XU4 A;  4WA6 A;  2PNS A;  1NB5 A;  2DCD A;  4P6E A;  3GCB A;  3PHW A;  2WBF X;  6PAD A;  3H8C A;  1TLO A;  5KO3 A;  2BDL A;  5CHV A;  2GFO A;  3IUT A;  3BCN A;  4YV8 A;  1MDW A;  3BOW A;  2BTW B;  1EWO A;  4YYS A;  4PAD A;  3N3K A;  3IEJ A;  3OVZ A;  1MEM A;  2R9C A;  3V6E A;  1CS8 A;  2HXZ A;  1YZB A;  3P5W A;  5EGW A;  1THE A;  2DCB A;  1ME4 A;  2Y6E A;  1AU0 A;  5EZS A;  2DCC A;  1ZIV A;  3CBJ A;  1GCB A;  1KHP A;  3MHS A;  1EWP A;  3QJ3 A;  3O0U A;  4D8I A;  1EWL A;  1PE6 A;  1M6D A;  4MSX A;  1U5I A;  3B21 A;  4PP2 E;  1NPZ A;  2DOS A;  2JQF R;  3N3G A;  1PPP A;  1CJL A;  3K8U A;  3IOQ A;  3RVV A;  3D6S A;  4BSQ A;  3DF0 A;  4OVZ B;  4QRG A;  1ATK A;  3PHU A;  3V6C A;  4BOP A;  2FRQ A;  3K9M A;  4PT5 A;  4RNA A;  2DCA A;  3PHX A;  3C9E A;  1BP4 A;  2DC6 A;  1QMY A;  1PCI A;  4Q8G A;  1BQI A;  3CH3 X;  1AU4 A;  1VSN A;  3MHH A;  2NQG A;  2YJ2 A;  1F2C A;  5F02 A;  4XUI A;  1KFX L;  1PPD A;  3B79 A;  4YYR A;  1YK8 A;  1CB5 A;  5A24 A;  3QT4 A;  2OZ2 A;  1CVZ A;  1UKF A;  4REZ A;  2FUD A;  1IWD A;  3P5X A;  1CPJ A;  4YYU A;  2P7U A;  2IPP B;  3KX1 A;  4W5C A;  4YYQ A;  1SP4 B;  2YJ8 A;  1EWM A;  4HXD B;  2G8J A;  4PI3 A;  3ZUA A;  2PAD A;  3IFU A;  3OF8 A;  1PAD A;  2R9N A;  4WUR A;  3LXS A;  2PRE A;  4XZX A;  4BPV A;  4QRX A;  4BOZ A;  1AYU A;  3HHA A;  1QXP A;  4BOU A;  3PRP A;  4FK5 A;  4CDD B;  2DC7 A;  2FRA A;  4IUM A;  1AEC A;  2AVW A;  4YYV A;  4R3D A;  1CSB B;  4CZW A;  2VHF A;  1Q6K A;  4DMY A;  1MEG A;  5CVO B;  1PPN A;  4FJC A;  5CVM A;  2JTC A;  1VJV A;  3BB7 A;  1AYV A;  2Y5B A;  4CDC B;  1DKI A;  2AS8 A;  3PT2 A;  4BOQ A;  2J7Q C;  2YJC A;  4QRV A;  1CTE A;  4X6H A;  2HHN A;  3BBA A;  1TL9 A;  4KLB A;  4P6G A;  1K3B B;  3TRK A;  2BU3 A;  3TMP A;  3HHI A;  2XU5 A;  4RF1 A;  5EF4 A;  1AYW A;  3RNV A;  5FPW A;  3BPF A;  3HD3 A;  1NL6 A;  3KWB X;  1Y08 A;  2HD5 A;  1ME3 A;  4BS5 A;  3I3T A;  2E02 A;  1F2A A;  3PBH A;  2DJG B;  1NB3 A;  4A5U A;  1KHQ A;  3RVX A;  2R9F A;  1PPO A;  4G54 A;  3W31 A;  4BS6 A;  2BTW A;  2Z84 A;  3F5V A;  3KSE A;  3IV2 A;  3MOR A;  3OF9 A;  2DJF B;  5JA7 A;  1HUC B;  1U9Q X;  2HH5 A;  2R9M A;  1SNK A;  2R6N A;  3O1G A;  3OVX A;  4PP1 A;  2UZJ A;  5K16 A;  3H89 A;  3HWN A;  1YVB A;  2F1G A;  1PBH A;  3QSD A;  5EZQ A;  4MM3 B;  2AGA A;  3NHE A;  4CDF B;  1NQC A;  3W30 A;  1GEC E;  2G7Y A;  4N79 A;  3PNR A;  4MI7 A;  3H6S A;  2ATO A;  4OW0 A;  4OVZ A;  1YT7 A;  2FTD A;  4N8W A;  4AXM A;  4ZUX U;  2CIO A;  1YK7 A;  4RKX A;  1JQP A;  4DMX A;  4BQV A;  3P5V A;  4YVA A;  2G8E A;  3KWZ A;  4D8B A;  3TNX A;  2AIM A;  1F2B A;  3AI8 A;  5JZE A;  3PW3 A;  2E03 A;  4XR7 A;  1FH0 A;  2AYN A;  1ICF A;  2P0R A;  4RF0 A;  2P86 A;  5PAD A;  2XU3 A;  4W4U A;  1U9W A;  2H7J A;  1YAL A;  2DZZ A;  2R9O A;  5CVN B;  3CH2 X;  1PXV A;  1GMY A;  1QOL A;  2IBI A;  3E1Z B;  4FIP A;  3BY4 A; 
#chains in the Genus database with same CATH homology
 4M0W A;  4GUA A;  3E9S A;  3MJ5 A;  5E6J A;  3OQC A;  3O65 A;  3MTV A;  4A5U A;  3C0R A;  4IP3 A;  1UKF A;  4REZ A;  2HWK A;  3W31 A;  4P16 A;  2BTW A;  1PVJ A;  2Z84 A;  3PSE A;  2FE8 A;  4HXD B;  3IFU A;  4WUR A;  2UZJ A;  4XZX A;  4D8E A;  4BOZ A;  3PHW A;  2JRI A;  5KO3 A;  4BOU A;  3PRP A;  5EZQ A;  2J7Q A;  4MM3 B;  2AGA A;  4IUM A;  2BTW B;  4R3D A;  3PRM A;  1YZB A;  3W30 A;  5EZS A;  2JTC A;  4MI7 A;  3BB7 A;  4OW0 A;  4OVZ A;  4ZTB A;  3ZNH A;  1DKI A;  4RKX A;  3PT2 A;  4BOQ A;  2J7Q C;  4D8I A;  4D8B A;  3B21 A;  5JZE A;  3BBA A;  2DOS A;  4RF0 A;  4BOS A;  3TRK A;  2BU3 A;  3TMP A;  4RF1 A;  4OVZ B;  3MP2 A;  3PHU A;  4BOP A;  3RNV A;  4PT5 A;  4RNA A;  3BY4 A;  3PHX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...