4MI7A

Crystal structure of salmonella effector protein gtge
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
134
structure length
124
Chain Sequence
GIDIIECENLLKEMNVQKIPESSLFTNIKEALQAEVFNSTVEDDFESFISYELQNHGPLMLIRPSSECLHAECIVGYDSEVKKVLIYDSNTSPEWQSNIDVYDKLTLAFNCSICGLYYDGVYEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and enzymatic characterization of a host-specificity determinant from Salmonella.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium str. sl1344
molecule tags Hydrolase, toxin
molecule keywords Bacteriophage encoded virulence factor
total genus 35
structure length 124
sequence length 134
ec nomenclature
pdb deposition date 2013-08-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.170 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 4mi7A00
4MI7A
chains in the Genus database with same CATH superfamily
4YYVA 2DJGB 2BTWB 4HXDB 4YYSA 1VJVA 3W30A 5CHVA 1GECE 2DCCA 1BGOA 3S3RA 2AUXA 1CPJA 2XU5A 4OVZA 2YJCA 4D8BA 1PE6A 3MHSA 3H89A 4YV8A 1CB5A 4W5BA 1ZIVA 1PBHA 1U9QX 1PPPA 3HHAA 4REZA 1IWDA 2YJBA 3N3GA 3PDFA 4QRXA 1UKFA 1AYVA 3BCNA 2BTWA 2ARYA 2AGAA 2NQAA 1POPA 3WXGA 3PSEA 5PADA 3IUTA 6PADA 2GFOA 3IFUA 3QJ3A 3CH3X 4M0WA 3TNXA 2AYNA 4N8WA 5JA7A 3P5WA 1BY8A 2FO5A 3ERVA 2AYOA 3HHIA 2PADA 3OVZA 1F2CA 4BS6A 4MI7A 4BOUA 2IPPB 3B79A 3RVXA 2IBIA 4QRGA 3HD3A 4RF1A 2Y6EA 1YZBA 4CZWA 3H8CA 4RNAA 2DCAA 2B1MA 2FT2A 3F5VA 3OQCA 4IUMA 5J94A 4QH6A 1GMYA 2XU3A 2HD5A 2FRAA 5EF4A 4BSQA 3KWBX 2Z84A 3CBKA 1KFXL 1ATKA 2FQ9A 3RVWA 2Y5BA 1NQCA 1STFE 1MEMA 2O6XA 3QT4A 2JQFR 1MEGA 1MDWA 3BPMA 3USVA 1NB5A 3B21A 3DF0A 2R6NA 3U8EA 1CS8A 3N3KA 4XUIA 4HWYA 4G54A 2E00A 3MTVA 1EWPA 5FPWA 2CB5A 3H8BA 1AU2A 4PI3A 2FRQA 4BPVA 2DC7A 3BWKA 3IOQA 4GUAA 2YJ9A 3LXSA 3MP2A 4XZXA 1EWOA 1QOLA 1AECA 1CQDA 3IEJA 1JQPA 2DJFB 4YYWA 2XU1A 3E9SA 2HXZA 1PCIA 1YT7A 4PP1A 4PADA 4FK5A 4RF0A 2F1GA 2GHUA 3K9MA 1EF7A 1XKGA 2DCBA 4P6EA 1ICFA 3KX1A 3H7DA 3PW3A 5F02A 4DMYA 2WBFX 3TRKA 4MM3B 1AIMA 3O0UA 2R9CA 4YYRA 4PT5A 1EWMA 3I06A 4P6GA 1NPZA 4DMXA 1U9WA 1TLOA 1CSBB 2J7QC 2R9NA 1QXPA 4FJCA 5JH3A 1AYWA 3IV2A 3C0RA 3OF9A 1THEA 4K7CA 1ITOA 2YJ8A 2PREA 3OISA 3IMAA 3IHPA 4D8EA 3KW9A 4WURA 2OZ2A 3CH2X 4FIPA 3AI8A 3WXEA 1YVBA 3TMPA 2BDLA 1DKIA 3RNVA 4BOQA 2E03A 3P5XA 2BU3A 4BOSA 1CJLA 1PPNA 2JQGR 3PRMA 3PRPA 3F75A 2JRIA 4R3DA 4Q8HA 1KHQA 1YK8A 1ME4A 1PADA 3MHHA 4W4UA 2DC9A 2DZZA 3BC3A 3P5VA 1AYUA 7PCKA 5EGWA 2FUDA 5A24A 1Y08A 4Q8GA 1ME3A 1VSNA 1QMYA 3N4CA 4MSXA 1MHWA 1KHPA 2C0YA 1M6DA 1CV8A 4IP3A 1NLJA 4OELA 2YJ2A 3P5UA 2OP3A 3O65A 4W5CA 4YVAA 3BPFA 3KWZA 3KSEA 2ACTA 1GLOA 3KFQA 3D6SA 2AS8A 5CHTA 2FYEA 1GCBA 3BB7A 2G8EA 4CDFB 2FE8A 4BS5A 3MORA 1U5IA 4OW0A 1TL9A 3PHXA 2G7YA 3E1ZB 3O1GA 1X9YA 1S4VA 3M99A 1ZCMA 1MIRA 4KLBA 4PP2E 5KO3A 2H7JA 2AIMA 1Q6KA 2G6DA 1KXRA 5E6JA 8PCHA 3HWNA 2DC6A 3K8UA 3PHUA 4AXLA 3RVVA 4I05A 2NQGA 4A5UA 4BOZA 5CVNB 1BQIA 2FTDA 9PAPA 1DEUA 2HHNA 2HWKA 3K24A 3H6SA 1SNKA 4X6IA 5EZSA 1PPOA 1A6RA 3CBJA 1QDQA 1AU3A 1HUCB 4BQVA 3NHEA 1PVJA 2CIOA 4X6JA 1SP4B 1AU0A 3LFYA 1PPDA 3QSDA 4MZSA 2G8JA 2JTCA 1BP4A 1O0EA 1FH0A 2F7DA 3I3TA 4I04A 3V6CA 1K3BB 2AUZA 4OVZB 4AXMA 4CDDB 3KKUA 1F2BA 4YYQA 1AU4A 2E02A 3PHWA 3MJ5A 2PBHA 1TU6A 1EWLA 3ZUAA 5K16A 3PNRA 1CTEA 2R9MA 4RY2A 4N4ZA 1KFUL 4P16A 4WA6A 3BY4A 3V6EA 2XU4A 1U9VA 2ATOA 3PBHA 5JZEA 1NL6A 3C9EA 1NB3A 1YK7A 4XR7A 3PT2A 4CDCB 2DOSA 1PXVA 1PIPA 2P0RA 4ZTBA 3ZNHA 2DZYA 1F29A 4QBBA 3W31A 4D8IA 4I07A 2OULA 1CVZA 2UZJA 1F2AA 4BOPA 1U9XA 4MZOA 3BOWA 2HH5A 2B1NA 4ZUXU 1Y4HA 3WXFA 2PNSA 2E01A 5CVMA 2DCDA 2BDZA 2J7QA 3OVXA 2P86A 2VHFA 4N79A 4OEMA 5CVOB 1MS6A 2DC8A 3OF8A 2NQDB 2R9FA 1DF0A 5EZQA 2AU1A 2P7UA 4X6HA 2AVWA 2R9OA 3GCBA 1YALA 2NQIA 3S3QA 2VHSA 3MTNA 4CDEB 4YYUA 4RKXA 4QRVA 3BBAA
chains in the Genus database with same CATH topology
4IP3A 4RNAA 4GUAA 3O65A 3C0RA 3PRMA 3IFUA 5EZSA 2BTWB 3MP2A 5JZEA 4HXDB 3B21A 4M0WA 4XZXA 4D8EA 3OQCA 4IUMA 4OVZB 3PRPA 4D8BA 2UZJA 1PVJA 2JRIA 4R3DA 4WURA 5EZQA 4REZA 5KO3A 4BOPA 3TRKA 3W30A 3PHWA 3TMPA 1DKIA 3MJ5A 1UKFA 4MM3B 5E6JA 3PT2A 3BB7A 3RNVA 3E9SA 2Z84A 4BOQA 2DOSA 2FE8A 4PT5A 2JTCA 3PHUA 3W31A 3MTVA 2BTWA 4MI7A 4BOUA 4RF1A 2BU3A 2AGAA 2HWKA 4ZTBA 3ZNHA 4RKXA 4A5UA 4OW0A 4RF0A 4BOSA 2J7QA 4OVZA 3PSEA 4BOZA 4P16A 2J7QC 3PHXA 1YZBA 4D8IA 3BBAA 3BY4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MI7 A; 
#chains in the Genus database with same CATH topology
 4YYV A;  2DJG B;  2BTW B;  4HXD B;  4YYS A;  1VJV A;  3W30 A;  5CHV A;  1GEC E;  2DCC A;  1BGO A;  3S3R A;  2AUX A;  1CPJ A;  2XU5 A;  4OVZ A;  2YJC A;  4D8B A;  1PE6 A;  3MHS A;  3H89 A;  4YV8 A;  1CB5 A;  4W5B A;  1ZIV A;  1PBH A;  1U9Q X;  1PPP A;  3HHA A;  4REZ A;  1IWD A;  2YJB A;  3N3G A;  3PDF A;  4QRX A;  1UKF A;  1AYV A;  3BCN A;  2BTW A;  2ARY A;  2AGA A;  2NQA A;  1POP A;  3WXG A;  3PSE A;  5PAD A;  3IUT A;  6PAD A;  2GFO A;  3IFU A;  3QJ3 A;  3CH3 X;  4M0W A;  3TNX A;  2AYN A;  4N8W A;  5JA7 A;  3P5W A;  1BY8 A;  2FO5 A;  3ERV A;  2AYO A;  3HHI A;  2PAD A;  3OVZ A;  1F2C A;  4BS6 A;  4MI7 A;  4BOU A;  2IPP B;  3B79 A;  3RVX A;  2IBI A;  4QRG A;  3HD3 A;  4RF1 A;  2Y6E A;  1YZB A;  4CZW A;  3H8C A;  4RNA A;  2DCA A;  2B1M A;  2FT2 A;  3F5V A;  3OQC A;  4IUM A;  5J94 A;  4QH6 A;  1GMY A;  2XU3 A;  2HD5 A;  2FRA A;  5EF4 A;  4BSQ A;  3KWB X;  2Z84 A;  3CBK A;  1KFX L;  1ATK A;  2FQ9 A;  3RVW A;  2Y5B A;  1NQC A;  1STF E;  1MEM A;  2O6X A;  3QT4 A;  2JQF R;  1MEG A;  1MDW A;  3BPM A;  3USV A;  1NB5 A;  3B21 A;  3DF0 A;  2R6N A;  3U8E A;  1CS8 A;  3N3K A;  4XUI A;  4HWY A;  4G54 A;  2E00 A;  3MTV A;  1EWP A;  5FPW A;  2CB5 A;  3H8B A;  1AU2 A;  4PI3 A;  2FRQ A;  4BPV A;  2DC7 A;  3BWK A;  3IOQ A;  4GUA A;  2YJ9 A;  3LXS A;  3MP2 A;  4XZX A;  1EWO A;  1QOL A;  1AEC A;  1CQD A;  3IEJ A;  1JQP A;  2DJF B;  4YYW A;  2XU1 A;  3E9S A;  2HXZ A;  1PCI A;  1YT7 A;  4PP1 A;  4PAD A;  4FK5 A;  4RF0 A;  2F1G A;  2GHU A;  3K9M A;  1EF7 A;  1XKG A;  2DCB A;  4P6E A;  1ICF A;  3KX1 A;  3H7D A;  3PW3 A;  5F02 A;  4DMY A;  2WBF X;  3TRK A;  4MM3 B;  1AIM A;  3O0U A;  2R9C A;  4YYR A;  4PT5 A;  1EWM A;  3I06 A;  4P6G A;  1NPZ A;  4DMX A;  1U9W A;  1TLO A;  1CSB B;  2J7Q C;  2R9N A;  1QXP A;  4FJC A;  5JH3 A;  1AYW A;  3IV2 A;  3C0R A;  3OF9 A;  1THE A;  4K7C A;  1ITO A;  2YJ8 A;  2PRE A;  3OIS A;  3IMA A;  3IHP A;  4D8E A;  3KW9 A;  4WUR A;  2OZ2 A;  3CH2 X;  4FIP A;  3AI8 A;  3WXE A;  1YVB A;  3TMP A;  2BDL A;  1DKI A;  3RNV A;  4BOQ A;  2E03 A;  3P5X A;  2BU3 A;  4BOS A;  1CJL A;  1PPN A;  2JQG R;  3PRM A;  3PRP A;  3F75 A;  2JRI A;  4R3D A;  4Q8H A;  1KHQ A;  1YK8 A;  1ME4 A;  1PAD A;  3MHH A;  4W4U A;  2DC9 A;  2DZZ A;  3BC3 A;  3P5V A;  1AYU A;  7PCK A;  5EGW A;  2FUD A;  5A24 A;  1Y08 A;  4Q8G A;  1ME3 A;  1VSN A;  1QMY A;  3N4C A;  4MSX A;  1MHW A;  1KHP A;  2C0Y A;  1M6D A;  1CV8 A;  4IP3 A;  1NLJ A;  4OEL A;  2YJ2 A;  3P5U A;  2OP3 A;  3O65 A;  4W5C A;  4YVA A;  3BPF A;  3KWZ A;  3KSE A;  2ACT A;  1GLO A;  3KFQ A;  3D6S A;  2AS8 A;  5CHT A;  2FYE A;  1GCB A;  3BB7 A;  2G8E A;  4CDF B;  2FE8 A;  4BS5 A;  3MOR A;  1U5I A;  4OW0 A;  1TL9 A;  3PHX A;  2G7Y A;  3E1Z B;  3O1G A;  1X9Y A;  1S4V A;  3M99 A;  1ZCM A;  1MIR A;  4KLB A;  4PP2 E;  5KO3 A;  2H7J A;  2AIM A;  1Q6K A;  2G6D A;  1KXR A;  5E6J A;  8PCH A;  3HWN A;  2DC6 A;  3K8U A;  3PHU A;  4AXL A;  3RVV A;  4I05 A;  2NQG A;  4A5U A;  4BOZ A;  5CVN B;  1BQI A;  2FTD A;  9PAP A;  1DEU A;  2HHN A;  2HWK A;  3K24 A;  3H6S A;  1SNK A;  4X6I A;  5EZS A;  1PPO A;  1A6R A;  3CBJ A;  1QDQ A;  1AU3 A;  1HUC B;  4BQV A;  3NHE A;  1PVJ A;  2CIO A;  4X6J A;  1SP4 B;  1AU0 A;  3LFY A;  1PPD A;  3QSD A;  4MZS A;  2G8J A;  2JTC A;  1BP4 A;  1O0E A;  1FH0 A;  2F7D A;  3I3T A;  4I04 A;  3V6C A;  1K3B B;  2AUZ A;  4OVZ B;  4AXM A;  4CDD B;  3KKU A;  1F2B A;  4YYQ A;  1AU4 A;  2E02 A;  3PHW A;  3MJ5 A;  2PBH A;  1TU6 A;  1EWL A;  3ZUA A;  5K16 A;  3PNR A;  1CTE A;  2R9M A;  4RY2 A;  4N4Z A;  1KFU L;  4P16 A;  4WA6 A;  3BY4 A;  3V6E A;  2XU4 A;  1U9V A;  2ATO A;  3PBH A;  5JZE A;  1NL6 A;  3C9E A;  1NB3 A;  1YK7 A;  4XR7 A;  3PT2 A;  4CDC B;  2DOS A;  1PXV A;  1PIP A;  2P0R A;  4ZTB A;  3ZNH A;  2DZY A;  1F29 A;  4QBB A;  3W31 A;  4D8I A;  4I07 A;  2OUL A;  1CVZ A;  2UZJ A;  1F2A A;  4BOP A;  1U9X A;  4MZO A;  3BOW A;  2HH5 A;  2B1N A;  4ZUX U;  1Y4H A;  3WXF A;  2PNS A;  2E01 A;  5CVM A;  2DCD A;  2BDZ A;  2J7Q A;  3OVX A;  2P86 A;  2VHF A;  4N79 A;  4OEM A;  5CVO B;  1MS6 A;  2DC8 A;  3OF8 A;  2NQD B;  2R9F A;  1DF0 A;  5EZQ A;  2AU1 A;  2P7U A;  4X6H A;  2AVW A;  2R9O A;  3GCB A;  1YAL A;  2NQI A;  3S3Q A;  2VHS A;  3MTN A;  4CDE B;  4YYU A;  4RKX A;  4QRV A;  3BBA A; 
#chains in the Genus database with same CATH homology
 4IP3 A;  4RNA A;  4GUA A;  3O65 A;  3C0R A;  3PRM A;  3IFU A;  5EZS A;  2BTW B;  3MP2 A;  5JZE A;  4HXD B;  3B21 A;  4M0W A;  4XZX A;  4D8E A;  3OQC A;  4IUM A;  4OVZ B;  3PRP A;  4D8B A;  2UZJ A;  1PVJ A;  2JRI A;  4R3D A;  4WUR A;  5EZQ A;  4REZ A;  5KO3 A;  4BOP A;  3TRK A;  3W30 A;  3PHW A;  3TMP A;  1DKI A;  3MJ5 A;  1UKF A;  4MM3 B;  5E6J A;  3PT2 A;  3BB7 A;  3RNV A;  3E9S A;  2Z84 A;  4BOQ A;  2DOS A;  2FE8 A;  4PT5 A;  2JTC A;  3PHU A;  3W31 A;  3MTV A;  2BTW A;  4MI7 A;  4BOU A;  4RF1 A;  2BU3 A;  2AGA A;  2HWK A;  4ZTB A;  3ZNH A;  4RKX A;  4A5U A;  4OW0 A;  4RF0 A;  4BOS A;  2J7Q A;  4OVZ A;  3PSE A;  4BOZ A;  4P16 A;  2J7Q C;  3PHX A;  1YZB A;  4D8I A;  3BBA A;  3BY4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...