5JH3A

Human cathepsin k mutant c25s
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
214
structure length
214
Chain Sequence
PDSVDYRKKGYVTPVKNQGQCGSSWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Cathepsin K
publication title An allosteric site enables fine-tuning of cathepsin K by diverse effectors.
pubmed doi rcsb
source organism Homo sapiens
total genus 62
structure length 214
sequence length 214
ec nomenclature ec 3.4.22.38: Cathepsin K.
pdb deposition date 2016-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 5jh3A00
4CZWA 1ME3A 3F75A 4AXMA 1Y08A 2F7DA 2XU5A 4HWYA 4QRVA 3PBHA 3HD3A 4YYRA 1ICFA 4BPVA 2ACTA 2R6NA 1QMYA 2NQGA 4BS5A 4CDFB 3QT4A 3CBKA 2XU3A 2ARYA 1F2BA 1MEGA 2FQ9A 9PAPA 4X6IA 1K3BB 3H7DA 3OVXA 3P5VA 4X6HA 1IWDA 2DJFB 2FTDA 1CSBB 3P5UA 1CVZA 5EF4A 4N79A 3H89A 4YYSA 4ZUXU 2NQDB 6PADA 2DC9A 3I3TA 2G8EA 4YV8A 2DC7A 4DMYA 5JH3A 4N8WA 2DCBA 4W5CA 3CH3X 4QBBA 2P7UA 1ME4A 1PPNA 5F02A 4QRGA 1CPJA 3HHAA 2DZYA 4W5BA 4YVAA 2YJ9A 2JQGR 3MORA 3KW9A 3N3KA 3P5WA 2AS8A 2PREA 1A6RA 1S4VA 2DC8A 2VHSA 5K16A 1PCIA 4XR7A 4N4ZA 3IMAA 4Q8HA 4OELA 2E00A 3BCNA 4DMXA 1QXPA 2YJ8A 2E03A 2R9CA 1PPDA 2CB5A 1PE6A 1AU0A 2AU1A 1AYWA 3NHEA 3H6SA 1AYUA 1YK8A 3K8UA 4Q8GA 7PCKA 3WXFA 4QH6A 3BPFA 1ATKA 3K24A 1F2AA 2HXZA 1MEMA 3H8CA 1U5IA 1QDQA 2PADA 2PNSA 4CDCB 1ITOA 1PXVA 4BSQA 1AU3A 3BC3A 1KHPA 2JQFR 1HUCB 3CH2X 3RVXA 2B1MA 1AU4A 2AIMA 4RY2A 1CQDA 2FYEA 1NQCA 1U9QX 1PBHA 2CIOA 2IBIA 3U8EA 3IOQA 3N3GA 4CDEB 4FJCA 2B1NA 3M99A 3MHHA 1CTEA 3RVVA 3KX1A 3IHPA 1CB5A 3IV2A 3DF0A 3IUTA 2E02A 1NB3A 3IEJA 4G54A 1KFXL 4MZOA 4I07A 3QJ3A 2G7YA 2P86A 2DCDA 3MHSA 2HHNA 3HWNA 1MIRA 1SNKA 1CS8A 4KLBA 1YK7A 1XKGA 2OZ2A 3KWBX 1STFE 4CDDB 4YYUA 4MZSA 4OEMA 5CVMA 2NQAA 2R9NA 3WXEA 2AYOA 2AUZA 2O6XA 3PNRA 4PP2E 4FK5A 1VSNA 2R9OA 3S3RA 2HH5A 1U9VA 1VJVA 2XU1A 3I06A 1Q6KA 1BGOA 1BP4A 4PI3A 2FO5A 1TLOA 4XUIA 1O0EA 3OF9A 4FIPA 1MHWA 3TNXA 1ZIVA 3F5VA 4P6EA 3KKUA 1TL9A 1AU2A 1NB5A 2ATOA 2R9MA 1CV8A 3C9EA 1BQIA 3E1ZB 2OP3A 1EF7A 3KSEA 5CVNB 1QOLA 8PCHA 3BOWA 3USVA 1NL6A 3AI8A 1TU6A 3PDFA 1NLJA 2R9FA 1MDWA 2IPPB 1EWPA 2FUDA 4I04A 2Y6EA 5A24A 3N4CA 3OISA 2AVWA 1CJLA 5PADA 1YVBA 1PADA 2VHFA 4I05A 1JQPA 1PPPA 3S3QA 1EWLA 1YT7A 1POPA 1M6DA 3WXGA 2BDZA 3P5XA 3PW3A 1AYVA 3LXSA 4AXLA 2C0YA 1Y4HA 3BPMA 5JA7A 1EWMA 1GMYA 2G6DA 1KFUL 1FH0A 2DJGB 4PP1A 3RVWA 2YJBA 2DZZA 3H8BA 2GFOA 4BS6A 3O1GA 4YYQA 4BQVA 3CBJA 4WA6A 1AIMA 3ERVA 1ZCMA 1GCBA 4X6JA 4YYVA 2Y5BA 5EGWA 2AUXA 5CHVA 1AECA 3V6EA 1PPOA 3O0UA 3K9MA 5J94A 4W4UA 5FPWA 1F29A 2YJCA 1DF0A 1KXRA 1GECE 1GLOA 2HD5A 4MSXA 3LFYA 3HHIA 2FRQA 2AYNA 3GCBA 1SP4B 2YJ2A 1MS6A 1YALA 1DEUA 4K7CA 1KHQA 4PADA 3OVZA 2F1GA 2BDLA 2G8JA 2GHUA 1NPZA 2FRAA 3B79A 2DC6A 3D6SA 4QRXA 1BY8A 2WBFX 1U9WA 2E01A 1PIPA 2P0RA 3OF8A 1F2CA 3ZUAA 4YYWA 4P6GA 2NQIA 2H7JA 2DCCA 3MTNA 3KFQA 2XU4A 3KWZA 2PBHA 5CVOB 1X9YA 1U9XA 5CHTA 2FT2A 1EWOA 1THEA 3V6CA 2OULA 3BWKA 2DCAA 3QSDA
chains in the Genus database with same CATH superfamily
4CZWA 1ME3A 5E6JA 3F75A 4AXMA 1Y08A 2F7DA 2XU5A 4HWYA 4QRVA 3PBHA 3HD3A 4YYRA 1ICFA 3C0RA 4BPVA 2ACTA 2R6NA 1QMYA 2NQGA 4BS5A 4CDFB 3QT4A 1UKFA 3CBKA 2XU3A 2ARYA 1F2BA 1MEGA 2FQ9A 3RNVA 3PSEA 5KO3A 9PAPA 4X6IA 1K3BB 3H7DA 3OVXA 3P5VA 3E9SA 4X6HA 1IWDA 2DJFB 2FTDA 1CSBB 3P5UA 1CVZA 2BU3A 5EF4A 4N79A 3H89A 4REZA 4YYSA 4ZUXU 2NQDB 4BOPA 6PADA 2DC9A 3I3TA 2G8EA 5EZSA 4YV8A 2DC7A 4DMYA 5JH3A 4N8WA 2DCBA 4W5CA 3CH3X 4QBBA 2P7UA 1ME4A 1PPNA 5F02A 4QRGA 1CPJA 3HHAA 2DZYA 4RNAA 4W5BA 4YVAA 2YJ9A 2JQGR 3MORA 4WURA 3KW9A 3N3KA 3P5WA 2AS8A 4D8BA 3MP2A 2PREA 4D8EA 1A6RA 1S4VA 2DC8A 2VHSA 5K16A 1PCIA 4GUAA 1YZBA 4XR7A 4N4ZA 3IMAA 4Q8HA 4OELA 2E00A 3ZNHA 4RKXA 3BCNA 3BBAA 4DMXA 1QXPA 2YJ8A 2E03A 2R9CA 1PPDA 2CB5A 4HXDB 1PE6A 1AU0A 2AU1A 1AYWA 3NHEA 3H6SA 1AYUA 1YK8A 3K8UA 4Q8GA 7PCKA 3WXFA 4QH6A 3BPFA 1ATKA 3K24A 1F2AA 2HXZA 1MEMA 3H8CA 1U5IA 1QDQA 2JRIA 2PADA 2PNSA 4CDCB 1ITOA 1PXVA 4BSQA 4OVZB 1AU3A 3BC3A 4R3DA 1KHPA 2JQFR 1HUCB 3CH2X 3RVXA 2B1MA 1AU4A 2AIMA 4RY2A 4PT5A 1CQDA 2FYEA 1NQCA 4ZTBA 1U9QX 1PBHA 2CIOA 2IBIA 3U8EA 3IOQA 3N3GA 4CDEB 4FJCA 2B1NA 3M99A 3MHHA 2J7QA 4XZXA 1CTEA 3RVVA 3KX1A 3IHPA 1CB5A 3IV2A 3DF0A 3IUTA 2E02A 1NB3A 3IEJA 4G54A 1DKIA 1KFXL 3BY4A 4MZOA 4I07A 3QJ3A 2G7YA 2P86A 2DCDA 3MHSA 2HHNA 3MTVA 3HWNA 1MIRA 1SNKA 1CS8A 4KLBA 1YK7A 1XKGA 2OZ2A 3KWBX 1STFE 3MJ5A 2Z84A 4CDDB 4YYUA 4MZSA 4OEMA 5CVMA 2NQAA 2R9NA 3WXEA 2AYOA 4P16A 2AUZA 2O6XA 3PNRA 4PP2E 3PRMA 2FE8A 4FK5A 2AGAA 1VSNA 2R9OA 3S3RA 2HH5A 1U9VA 1VJVA 2XU1A 3I06A 1Q6KA 1BGOA 1BP4A 4PI3A 2FO5A 2BTWB 1TLOA 2JTCA 3BB7A 4XUIA 1O0EA 3OF9A 4FIPA 1MHWA 3TNXA 3PRPA 1ZIVA 3F5VA 4P6EA 5JZEA 3KKUA 1TL9A 1AU2A 1NB5A 2ATOA 2R9MA 1CV8A 3C9EA 1BQIA 3E1ZB 4MM3B 2OP3A 1EF7A 3KSEA 5CVNB 3W31A 1QOLA 8PCHA 3BOWA 3USVA 1NL6A 4BOQA 3AI8A 1TU6A 3PDFA 1NLJA 2R9FA 1MDWA 2IPPB 1EWPA 2FUDA 4I04A 2Y6EA 3PT2A 4RF1A 4A5UA 5A24A 3N4CA 3OISA 2AVWA 4IP3A 1CJLA 3IFUA 4BOZA 2HWKA 5PADA 1YVBA 1PADA 2VHFA 4I05A 1JQPA 5EZQA 1PPPA 4OVZA 3S3QA 1EWLA 1YT7A 1POPA 1M6DA 3WXGA 2BDZA 3P5XA 3PW3A 1AYVA 3LXSA 4AXLA 2C0YA 1Y4HA 3BPMA 5JA7A 1EWMA 1GMYA 3B21A 2G6DA 1KFUL 1FH0A 2DJGB 4PP1A 2DOSA 3RVWA 1PVJA 2YJBA 2DZZA 3H8BA 2GFOA 3PHXA 4BS6A 3O1GA 4YYQA 4BOUA 4BQVA 3CBJA 4WA6A 1AIMA 3ERVA 1ZCMA 1GCBA 4X6JA 4YYVA 2Y5BA 5EGWA 2AUXA 5CHVA 1AECA 3V6EA 1PPOA 4M0WA 3O0UA 4BOSA 3K9MA 5J94A 2UZJA 4W4UA 5FPWA 1F29A 2YJCA 1DF0A 1KXRA 1GECE 1GLOA 2HD5A 3PHWA 4MSXA 3LFYA 3HHIA 2FRQA 2AYNA 3GCBA 3TRKA 1SP4B 2YJ2A 3OQCA 1MS6A 1YALA 1DEUA 4D8IA 4OW0A 4K7CA 1KHQA 4PADA 3W30A 3OVZA 2F1GA 2BDLA 2G8JA 2GHUA 1NPZA 2FRAA 3B79A 2DC6A 3D6SA 4QRXA 1BY8A 2BTWA 1U9WA 2E01A 2WBFX 1PIPA 4MI7A 2P0RA 3OF8A 1F2CA 3ZUAA 4YYWA 2J7QC 4P6GA 4RF0A 3O65A 2NQIA 2H7JA 2DCCA 3MTNA 3KFQA 2XU4A 3KWZA 2PBHA 5CVOB 1X9YA 1U9XA 5CHTA 3PHUA 2FT2A 1EWOA 1THEA 3TMPA 3V6CA 2OULA 3BWKA 2DCAA 4IUMA 3QSDA
chains in the Genus database with same CATH topology
4CZWA 1ME3A 3F75A 4AXMA 1Y08A 2F7DA 2XU5A 4HWYA 4QRVA 3PBHA 3HD3A 4YYRA 1ICFA 4BPVA 2ACTA 2R6NA 1QMYA 2NQGA 4BS5A 4CDFB 3QT4A 3CBKA 2XU3A 2ARYA 1F2BA 1MEGA 2FQ9A 9PAPA 4X6IA 1K3BB 3H7DA 3OVXA 3P5VA 4X6HA 1IWDA 2DJFB 2FTDA 1CSBB 3P5UA 1CVZA 5EF4A 4N79A 3H89A 4YYSA 4ZUXU 2NQDB 6PADA 2DC9A 3I3TA 2G8EA 4BGFA 4YV8A 2DC7A 4DMYA 5JH3A 4N8WA 2DCBA 4W5CA 3CH3X 4QBBA 2P7UA 1ME4A 1PPNA 5F02A 4QRGA 1CPJA 3HHAA 2DZYA 4W5BA 4YVAA 2YJ9A 2JQGR 3MORA 3KW9A 3N3KA 3P5WA 2AS8A 2PREA 1A6RA 1S4VA 2DC8A 2VHSA 5K16A 1PCIA 4XR7A 4N4ZA 3IMAA 4Q8HA 4OELA 2E00A 3BCNA 4DMXA 1QXPA 2YJ8A 2E03A 2R9CA 1PPDA 2CB5A 1PE6A 1AU0A 2AU1A 1AYWA 3NHEA 3H6SA 1AYUA 1YK8A 3K8UA 4Q8GA 7PCKA 3WXFA 4QH6A 3BPFA 1ATKA 3K24A 1F2AA 2HXZA 1MEMA 3H8CA 1U5IA 1QDQA 2PADA 2PNSA 4CDCB 1ITOA 1PXVA 4BSQA 1AU3A 3BC3A 1KHPA 2JQFR 1HUCB 3CH2X 3RVXA 2B1MA 1AU4A 2AIMA 4RY2A 1CQDA 2FYEA 4NV7A 1NQCA 1U9QX 1PBHA 2CIOA 2IBIA 3U8EA 3IOQA 3N3GA 4CDEB 4FJCA 2B1NA 3M99A 3MHHA 1CTEA 3RVVA 3KX1A 3IHPA 1CB5A 3IV2A 3DF0A 3IUTA 2E02A 1NB3A 3IEJA 4G54A 1KFXL 4MZOA 4I07A 3QJ3A 2G7YA 2P86A 2DCDA 4B55A 3MHSA 2HHNA 3HWNA 1MIRA 1SNKA 1CS8A 4KLBA 1YK7A 1XKGA 2OZ2A 3KWBX 1STFE 4CDDB 4YYUA 4MZSA 4OEMA 5CVMA 2NQAA 2R9NA 3WXEA 2AYOA 2AUZA 2O6XA 3PNRA 4PP2E 4FK5A 1W6FA 2VFBA 1VSNA 2R9OA 3S3RA 2HH5A 1U9VA 1VJVA 2XU1A 3I06A 1Q6KA 1BGOA 1BP4A 4PI3A 2FO5A 4C5PA 1TLOA 4XUIA 1O0EA 3OF9A 4FIPA 1MHWA 3TNXA 1ZIVA 3F5VA 4P6EA 3KKUA 1TL9A 1AU2A 3LTWA 1NB5A 2ATOA 2R9MA 1CV8A 3C9EA 1BQIA 3E1ZB 2OP3A 1EF7A 3KSEA 5CVNB 1QOLA 8PCHA 3BOWA 3USVA 1NL6A 3AI8A 1TU6A 3PDFA 1NLJA 2R9FA 1MDWA 2IPPB 1EWPA 2FUDA 4I04A 2Y6EA 5A24A 3N4CA 3OISA 2AVWA 1CJLA 4NV8A 5PADA 1YVBA 1PADA 2VHFA 4I05A 1JQPA 1PPPA 3S3QA 1EWLA 1YT7A 1POPA 1M6DA 3WXGA 2BDZA 3P5XA 3PW3A 1AYVA 3LXSA 4AXLA 2C0YA 1Y4HA 3BPMA 5JA7A 1EWMA 1GMYA 2G6DA 1KFUL 1FH0A 2DJGB 4PP1A 3RVWA 2YJBA 2DZZA 3H8BA 2GFOA 4BS6A 3O1GA 4YYQA 4BQVA 3CBJA 4WA6A 1AIMA 3ERVA 1GX3A 1ZCMA 1GCBA 4X6JA 4YYVA 2Y5BA 5EGWA 2AUXA 5CHVA 1AECA 3V6EA 1PPOA 3O0UA 3K9MA 5J94A 4W4UA 5FPWA 1F29A 2YJCA 1DF0A 1KXRA 1GECE 1GLOA 2HD5A 4MSXA 4GUZA 3LFYA 3HHIA 2FRQA 2AYNA 3GCBA 1SP4B 2YJ2A 1MS6A 1YALA 1DEUA 4K7CA 1KHQA 4PADA 3OVZA 2F1GA 2BDLA 2G8JA 2GHUA 2BSZA 1NPZA 2FRAA 3B79A 3D9WA 2DC6A 2VFCA 3D6SA 4QRXA 1BY8A 2WBFX 1U9WA 2E01A 1E2TA 1PIPA 2P0RA 3OF8A 1F2CA 3ZUAA 4YYWA 1W5RA 4P6GA 2NQIA 2H7JA 1W4TA 2DCCA 3MTNA 3KFQA 2XU4A 3KWZA 2PBHA 5CVOB 1X9YA 1U9XA 5CHTA 2FT2A 1EWOA 1THEA 3V6CA 2OULA 3BWKA 2DCAA 3QSDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CZW A;  1ME3 A;  3F75 A;  4AXM A;  1Y08 A;  2F7D A;  2XU5 A;  4HWY A;  4QRV A;  3PBH A;  3HD3 A;  4YYR A;  1ICF A;  4BPV A;  2ACT A;  2R6N A;  1QMY A;  2NQG A;  4BS5 A;  4CDF B;  3QT4 A;  3CBK A;  2XU3 A;  2ARY A;  1F2B A;  1MEG A;  2FQ9 A;  9PAP A;  4X6I A;  1K3B B;  3H7D A;  3OVX A;  3P5V A;  4X6H A;  1IWD A;  2DJF B;  2FTD A;  1CSB B;  3P5U A;  1CVZ A;  5EF4 A;  4N79 A;  3H89 A;  4YYS A;  4ZUX U;  2NQD B;  6PAD A;  2DC9 A;  3I3T A;  2G8E A;  4YV8 A;  2DC7 A;  4DMY A;  5JH3 A;  4N8W A;  2DCB A;  4W5C A;  3CH3 X;  4QBB A;  2P7U A;  1ME4 A;  1PPN A;  5F02 A;  4QRG A;  1CPJ A;  3HHA A;  2DZY A;  4W5B A;  4YVA A;  2YJ9 A;  2JQG R;  3MOR A;  3KW9 A;  3N3K A;  3P5W A;  2AS8 A;  2PRE A;  1A6R A;  1S4V A;  2DC8 A;  2VHS A;  5K16 A;  1PCI A;  4XR7 A;  4N4Z A;  3IMA A;  4Q8H A;  4OEL A;  2E00 A;  3BCN A;  4DMX A;  1QXP A;  2YJ8 A;  2E03 A;  2R9C A;  1PPD A;  2CB5 A;  1PE6 A;  1AU0 A;  2AU1 A;  1AYW A;  3NHE A;  3H6S A;  1AYU A;  1YK8 A;  3K8U A;  4Q8G A;  7PCK A;  3WXF A;  4QH6 A;  3BPF A;  1ATK A;  3K24 A;  1F2A A;  2HXZ A;  1MEM A;  3H8C A;  1U5I A;  1QDQ A;  2PAD A;  2PNS A;  4CDC B;  1ITO A;  1PXV A;  4BSQ A;  1AU3 A;  3BC3 A;  1KHP A;  2JQF R;  1HUC B;  3CH2 X;  3RVX A;  2B1M A;  1AU4 A;  2AIM A;  4RY2 A;  1CQD A;  2FYE A;  1NQC A;  1U9Q X;  1PBH A;  2CIO A;  2IBI A;  3U8E A;  3IOQ A;  3N3G A;  4CDE B;  4FJC A;  2B1N A;  3M99 A;  3MHH A;  1CTE A;  3RVV A;  3KX1 A;  3IHP A;  1CB5 A;  3IV2 A;  3DF0 A;  3IUT A;  2E02 A;  1NB3 A;  3IEJ A;  4G54 A;  1KFX L;  4MZO A;  4I07 A;  3QJ3 A;  2G7Y A;  2P86 A;  2DCD A;  3MHS A;  2HHN A;  3HWN A;  1MIR A;  1SNK A;  1CS8 A;  4KLB A;  1YK7 A;  1XKG A;  2OZ2 A;  3KWB X;  1STF E;  4CDD B;  4YYU A;  4MZS A;  4OEM A;  5CVM A;  2NQA A;  2R9N A;  3WXE A;  2AYO A;  2AUZ A;  2O6X A;  3PNR A;  4PP2 E;  4FK5 A;  1VSN A;  2R9O A;  3S3R A;  2HH5 A;  1U9V A;  1VJV A;  2XU1 A;  3I06 A;  1Q6K A;  1BGO A;  1BP4 A;  4PI3 A;  2FO5 A;  1TLO A;  4XUI A;  1O0E A;  3OF9 A;  4FIP A;  1MHW A;  3TNX A;  1ZIV A;  3F5V A;  4P6E A;  3KKU A;  1TL9 A;  1AU2 A;  1NB5 A;  2ATO A;  2R9M A;  1CV8 A;  3C9E A;  1BQI A;  3E1Z B;  2OP3 A;  1EF7 A;  3KSE A;  5CVN B;  1QOL A;  8PCH A;  3BOW A;  3USV A;  1NL6 A;  3AI8 A;  1TU6 A;  3PDF A;  1NLJ A;  2R9F A;  1MDW A;  2IPP B;  1EWP A;  2FUD A;  4I04 A;  2Y6E A;  5A24 A;  3N4C A;  3OIS A;  2AVW A;  1CJL A;  5PAD A;  1YVB A;  1PAD A;  2VHF A;  4I05 A;  1JQP A;  1PPP A;  3S3Q A;  1EWL A;  1YT7 A;  1POP A;  1M6D A;  3WXG A;  2BDZ A;  3P5X A;  3PW3 A;  1AYV A;  3LXS A;  4AXL A;  2C0Y A;  1Y4H A;  3BPM A;  5JA7 A;  1EWM A;  1GMY A;  2G6D A;  1KFU L;  1FH0 A;  2DJG B;  4PP1 A;  3RVW A;  2YJB A;  2DZZ A;  3H8B A;  2GFO A;  4BS6 A;  3O1G A;  4YYQ A;  4BQV A;  3CBJ A;  4WA6 A;  1AIM A;  3ERV A;  1ZCM A;  1GCB A;  4X6J A;  4YYV A;  2Y5B A;  5EGW A;  2AUX A;  5CHV A;  1AEC A;  3V6E A;  1PPO A;  3O0U A;  3K9M A;  5J94 A;  4W4U A;  5FPW A;  1F29 A;  2YJC A;  1DF0 A;  1KXR A;  1GEC E;  1GLO A;  2HD5 A;  4MSX A;  3LFY A;  3HHI A;  2FRQ A;  2AYN A;  3GCB A;  1SP4 B;  2YJ2 A;  1MS6 A;  1YAL A;  1DEU A;  4K7C A;  1KHQ A;  4PAD A;  3OVZ A;  2F1G A;  2BDL A;  2G8J A;  2GHU A;  1NPZ A;  2FRA A;  3B79 A;  2DC6 A;  3D6S A;  4QRX A;  1BY8 A;  2WBF X;  1U9W A;  2E01 A;  1PIP A;  2P0R A;  3OF8 A;  1F2C A;  3ZUA A;  4YYW A;  4P6G A;  2NQI A;  2H7J A;  2DCC A;  3MTN A;  3KFQ A;  2XU4 A;  3KWZ A;  2PBH A;  5CVO B;  1X9Y A;  1U9X A;  5CHT A;  2FT2 A;  1EWO A;  1THE A;  3V6C A;  2OUL A;  3BWK A;  2DCA A;  3QSD A; 
#chains in the Genus database with same CATH topology
 4CZW A;  1ME3 A;  5E6J A;  3F75 A;  4AXM A;  1Y08 A;  2F7D A;  2XU5 A;  4HWY A;  4QRV A;  3PBH A;  3HD3 A;  4YYR A;  1ICF A;  3C0R A;  4BPV A;  2ACT A;  2R6N A;  1QMY A;  2NQG A;  4BS5 A;  4CDF B;  3QT4 A;  1UKF A;  3CBK A;  2XU3 A;  2ARY A;  1F2B A;  1MEG A;  2FQ9 A;  3RNV A;  3PSE A;  5KO3 A;  9PAP A;  4X6I A;  1K3B B;  3H7D A;  3OVX A;  3P5V A;  3E9S A;  4X6H A;  1IWD A;  2DJF B;  2FTD A;  1CSB B;  3P5U A;  1CVZ A;  2BU3 A;  5EF4 A;  4N79 A;  3H89 A;  4REZ A;  4YYS A;  4ZUX U;  2NQD B;  4BOP A;  6PAD A;  2DC9 A;  3I3T A;  2G8E A;  5EZS A;  4YV8 A;  2DC7 A;  4DMY A;  5JH3 A;  4N8W A;  2DCB A;  4W5C A;  3CH3 X;  4QBB A;  2P7U A;  1ME4 A;  1PPN A;  5F02 A;  4QRG A;  1CPJ A;  3HHA A;  2DZY A;  4RNA A;  4W5B A;  4YVA A;  2YJ9 A;  2JQG R;  3MOR A;  4WUR A;  3KW9 A;  3N3K A;  3P5W A;  2AS8 A;  4D8B A;  3MP2 A;  2PRE A;  4D8E A;  1A6R A;  1S4V A;  2DC8 A;  2VHS A;  5K16 A;  1PCI A;  4GUA A;  1YZB A;  4XR7 A;  4N4Z A;  3IMA A;  4Q8H A;  4OEL A;  2E00 A;  3ZNH A;  4RKX A;  3BCN A;  3BBA A;  4DMX A;  1QXP A;  2YJ8 A;  2E03 A;  2R9C A;  1PPD A;  2CB5 A;  4HXD B;  1PE6 A;  1AU0 A;  2AU1 A;  1AYW A;  3NHE A;  3H6S A;  1AYU A;  1YK8 A;  3K8U A;  4Q8G A;  7PCK A;  3WXF A;  4QH6 A;  3BPF A;  1ATK A;  3K24 A;  1F2A A;  2HXZ A;  1MEM A;  3H8C A;  1U5I A;  1QDQ A;  2JRI A;  2PAD A;  2PNS A;  4CDC B;  1ITO A;  1PXV A;  4BSQ A;  4OVZ B;  1AU3 A;  3BC3 A;  4R3D A;  1KHP A;  2JQF R;  1HUC B;  3CH2 X;  3RVX A;  2B1M A;  1AU4 A;  2AIM A;  4RY2 A;  4PT5 A;  1CQD A;  2FYE A;  1NQC A;  4ZTB A;  1U9Q X;  1PBH A;  2CIO A;  2IBI A;  3U8E A;  3IOQ A;  3N3G A;  4CDE B;  4FJC A;  2B1N A;  3M99 A;  3MHH A;  2J7Q A;  4XZX A;  1CTE A;  3RVV A;  3KX1 A;  3IHP A;  1CB5 A;  3IV2 A;  3DF0 A;  3IUT A;  2E02 A;  1NB3 A;  3IEJ A;  4G54 A;  1DKI A;  1KFX L;  3BY4 A;  4MZO A;  4I07 A;  3QJ3 A;  2G7Y A;  2P86 A;  2DCD A;  3MHS A;  2HHN A;  3MTV A;  3HWN A;  1MIR A;  1SNK A;  1CS8 A;  4KLB A;  1YK7 A;  1XKG A;  2OZ2 A;  3KWB X;  1STF E;  3MJ5 A;  2Z84 A;  4CDD B;  4YYU A;  4MZS A;  4OEM A;  5CVM A;  2NQA A;  2R9N A;  3WXE A;  2AYO A;  4P16 A;  2AUZ A;  2O6X A;  3PNR A;  4PP2 E;  3PRM A;  2FE8 A;  4FK5 A;  2AGA A;  1VSN A;  2R9O A;  3S3R A;  2HH5 A;  1U9V A;  1VJV A;  2XU1 A;  3I06 A;  1Q6K A;  1BGO A;  1BP4 A;  4PI3 A;  2FO5 A;  2BTW B;  1TLO A;  2JTC A;  3BB7 A;  4XUI A;  1O0E A;  3OF9 A;  4FIP A;  1MHW A;  3TNX A;  3PRP A;  1ZIV A;  3F5V A;  4P6E A;  5JZE A;  3KKU A;  1TL9 A;  1AU2 A;  1NB5 A;  2ATO A;  2R9M A;  1CV8 A;  3C9E A;  1BQI A;  3E1Z B;  4MM3 B;  2OP3 A;  1EF7 A;  3KSE A;  5CVN B;  3W31 A;  1QOL A;  8PCH A;  3BOW A;  3USV A;  1NL6 A;  4BOQ A;  3AI8 A;  1TU6 A;  3PDF A;  1NLJ A;  2R9F A;  1MDW A;  2IPP B;  1EWP A;  2FUD A;  4I04 A;  2Y6E A;  3PT2 A;  4RF1 A;  4A5U A;  5A24 A;  3N4C A;  3OIS A;  2AVW A;  4IP3 A;  1CJL A;  3IFU A;  4BOZ A;  2HWK A;  5PAD A;  1YVB A;  1PAD A;  2VHF A;  4I05 A;  1JQP A;  5EZQ A;  1PPP A;  4OVZ A;  3S3Q A;  1EWL A;  1YT7 A;  1POP A;  1M6D A;  3WXG A;  2BDZ A;  3P5X A;  3PW3 A;  1AYV A;  3LXS A;  4AXL A;  2C0Y A;  1Y4H A;  3BPM A;  5JA7 A;  1EWM A;  1GMY A;  3B21 A;  2G6D A;  1KFU L;  1FH0 A;  2DJG B;  4PP1 A;  2DOS A;  3RVW A;  1PVJ A;  2YJB A;  2DZZ A;  3H8B A;  2GFO A;  3PHX A;  4BS6 A;  3O1G A;  4YYQ A;  4BOU A;  4BQV A;  3CBJ A;  4WA6 A;  1AIM A;  3ERV A;  1ZCM A;  1GCB A;  4X6J A;  4YYV A;  2Y5B A;  5EGW A;  2AUX A;  5CHV A;  1AEC A;  3V6E A;  1PPO A;  4M0W A;  3O0U A;  4BOS A;  3K9M A;  5J94 A;  2UZJ A;  4W4U A;  5FPW A;  1F29 A;  2YJC A;  1DF0 A;  1KXR A;  1GEC E;  1GLO A;  2HD5 A;  3PHW A;  4MSX A;  3LFY A;  3HHI A;  2FRQ A;  2AYN A;  3GCB A;  3TRK A;  1SP4 B;  2YJ2 A;  3OQC A;  1MS6 A;  1YAL A;  1DEU A;  4D8I A;  4OW0 A;  4K7C A;  1KHQ A;  4PAD A;  3W30 A;  3OVZ A;  2F1G A;  2BDL A;  2G8J A;  2GHU A;  1NPZ A;  2FRA A;  3B79 A;  2DC6 A;  3D6S A;  4QRX A;  1BY8 A;  2BTW A;  1U9W A;  2E01 A;  2WBF X;  1PIP A;  4MI7 A;  2P0R A;  3OF8 A;  1F2C A;  3ZUA A;  4YYW A;  2J7Q C;  4P6G A;  4RF0 A;  3O65 A;  2NQI A;  2H7J A;  2DCC A;  3MTN A;  3KFQ A;  2XU4 A;  3KWZ A;  2PBH A;  5CVO B;  1X9Y A;  1U9X A;  5CHT A;  3PHU A;  2FT2 A;  1EWO A;  1THE A;  3TMP A;  3V6C A;  2OUL A;  3BWK A;  2DCA A;  4IUM A;  3QSD A; 
#chains in the Genus database with same CATH homology
 4CZW A;  1ME3 A;  3F75 A;  4AXM A;  1Y08 A;  2F7D A;  2XU5 A;  4HWY A;  4QRV A;  3PBH A;  3HD3 A;  4YYR A;  1ICF A;  4BPV A;  2ACT A;  2R6N A;  1QMY A;  2NQG A;  4BS5 A;  4CDF B;  3QT4 A;  3CBK A;  2XU3 A;  2ARY A;  1F2B A;  1MEG A;  2FQ9 A;  9PAP A;  4X6I A;  1K3B B;  3H7D A;  3OVX A;  3P5V A;  4X6H A;  1IWD A;  2DJF B;  2FTD A;  1CSB B;  3P5U A;  1CVZ A;  5EF4 A;  4N79 A;  3H89 A;  4YYS A;  4ZUX U;  2NQD B;  6PAD A;  2DC9 A;  3I3T A;  2G8E A;  4BGF A;  4YV8 A;  2DC7 A;  4DMY A;  5JH3 A;  4N8W A;  2DCB A;  4W5C A;  3CH3 X;  4QBB A;  2P7U A;  1ME4 A;  1PPN A;  5F02 A;  4QRG A;  1CPJ A;  3HHA A;  2DZY A;  4W5B A;  4YVA A;  2YJ9 A;  2JQG R;  3MOR A;  3KW9 A;  3N3K A;  3P5W A;  2AS8 A;  2PRE A;  1A6R A;  1S4V A;  2DC8 A;  2VHS A;  5K16 A;  1PCI A;  4XR7 A;  4N4Z A;  3IMA A;  4Q8H A;  4OEL A;  2E00 A;  3BCN A;  4DMX A;  1QXP A;  2YJ8 A;  2E03 A;  2R9C A;  1PPD A;  2CB5 A;  1PE6 A;  1AU0 A;  2AU1 A;  1AYW A;  3NHE A;  3H6S A;  1AYU A;  1YK8 A;  3K8U A;  4Q8G A;  7PCK A;  3WXF A;  4QH6 A;  3BPF A;  1ATK A;  3K24 A;  1F2A A;  2HXZ A;  1MEM A;  3H8C A;  1U5I A;  1QDQ A;  2PAD A;  2PNS A;  4CDC B;  1ITO A;  1PXV A;  4BSQ A;  1AU3 A;  3BC3 A;  1KHP A;  2JQF R;  1HUC B;  3CH2 X;  3RVX A;  2B1M A;  1AU4 A;  2AIM A;  4RY2 A;  1CQD A;  2FYE A;  4NV7 A;  1NQC A;  1U9Q X;  1PBH A;  2CIO A;  2IBI A;  3U8E A;  3IOQ A;  3N3G A;  4CDE B;  4FJC A;  2B1N A;  3M99 A;  3MHH A;  1CTE A;  3RVV A;  3KX1 A;  3IHP A;  1CB5 A;  3IV2 A;  3DF0 A;  3IUT A;  2E02 A;  1NB3 A;  3IEJ A;  4G54 A;  1KFX L;  4MZO A;  4I07 A;  3QJ3 A;  2G7Y A;  2P86 A;  2DCD A;  4B55 A;  3MHS A;  2HHN A;  3HWN A;  1MIR A;  1SNK A;  1CS8 A;  4KLB A;  1YK7 A;  1XKG A;  2OZ2 A;  3KWB X;  1STF E;  4CDD B;  4YYU A;  4MZS A;  4OEM A;  5CVM A;  2NQA A;  2R9N A;  3WXE A;  2AYO A;  2AUZ A;  2O6X A;  3PNR A;  4PP2 E;  4FK5 A;  1W6F A;  2VFB A;  1VSN A;  2R9O A;  3S3R A;  2HH5 A;  1U9V A;  1VJV A;  2XU1 A;  3I06 A;  1Q6K A;  1BGO A;  1BP4 A;  4PI3 A;  2FO5 A;  4C5P A;  1TLO A;  4XUI A;  1O0E A;  3OF9 A;  4FIP A;  1MHW A;  3TNX A;  1ZIV A;  3F5V A;  4P6E A;  3KKU A;  1TL9 A;  1AU2 A;  3LTW A;  1NB5 A;  2ATO A;  2R9M A;  1CV8 A;  3C9E A;  1BQI A;  3E1Z B;  2OP3 A;  1EF7 A;  3KSE A;  5CVN B;  1QOL A;  8PCH A;  3BOW A;  3USV A;  1NL6 A;  3AI8 A;  1TU6 A;  3PDF A;  1NLJ A;  2R9F A;  1MDW A;  2IPP B;  1EWP A;  2FUD A;  4I04 A;  2Y6E A;  5A24 A;  3N4C A;  3OIS A;  2AVW A;  1CJL A;  4NV8 A;  5PAD A;  1YVB A;  1PAD A;  2VHF A;  4I05 A;  1JQP A;  1PPP A;  3S3Q A;  1EWL A;  1YT7 A;  1POP A;  1M6D A;  3WXG A;  2BDZ A;  3P5X A;  3PW3 A;  1AYV A;  3LXS A;  4AXL A;  2C0Y A;  1Y4H A;  3BPM A;  5JA7 A;  1EWM A;  1GMY A;  2G6D A;  1KFU L;  1FH0 A;  2DJG B;  4PP1 A;  3RVW A;  2YJB A;  2DZZ A;  3H8B A;  2GFO A;  4BS6 A;  3O1G A;  4YYQ A;  4BQV A;  3CBJ A;  4WA6 A;  1AIM A;  3ERV A;  1GX3 A;  1ZCM A;  1GCB A;  4X6J A;  4YYV A;  2Y5B A;  5EGW A;  2AUX A;  5CHV A;  1AEC A;  3V6E A;  1PPO A;  3O0U A;  3K9M A;  5J94 A;  4W4U A;  5FPW A;  1F29 A;  2YJC A;  1DF0 A;  1KXR A;  1GEC E;  1GLO A;  2HD5 A;  4MSX A;  4GUZ A;  3LFY A;  3HHI A;  2FRQ A;  2AYN A;  3GCB A;  1SP4 B;  2YJ2 A;  1MS6 A;  1YAL A;  1DEU A;  4K7C A;  1KHQ A;  4PAD A;  3OVZ A;  2F1G A;  2BDL A;  2G8J A;  2GHU A;  2BSZ A;  1NPZ A;  2FRA A;  3B79 A;  3D9W A;  2DC6 A;  2VFC A;  3D6S A;  4QRX A;  1BY8 A;  2WBF X;  1U9W A;  2E01 A;  1E2T A;  1PIP A;  2P0R A;  3OF8 A;  1F2C A;  3ZUA A;  4YYW A;  1W5R A;  4P6G A;  2NQI A;  2H7J A;  1W4T A;  2DCC A;  3MTN A;  3KFQ A;  2XU4 A;  3KWZ A;  2PBH A;  5CVO B;  1X9Y A;  1U9X A;  5CHT A;  2FT2 A;  1EWO A;  1THE A;  3V6C A;  2OUL A;  3BWK A;  2DCA A;  3QSD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...