5JH3A

Human cathepsin k mutant c25s
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
214
structure length
214
Chain Sequence
PDSVDYRKKGYVTPVKNQGQCGSSWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An allosteric site enables fine-tuning of cathepsin K by diverse effectors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Cathepsin K
total genus 62
structure length 214
sequence length 214
ec nomenclature ec 3.4.22.38: Cathepsin K.
pdb deposition date 2016-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 5jh3A00
1AECA 4BQVA 4RY2A 2P86A 2C0YA 4BPVA 1QOLA 3MHHA 3OVZA 1TL9A 3QSDA 4X6JA 1GECE 2DC7A 1BP4A 2G7YA 1MIRA 2AU1A 2HD5A 4DMXA 2B1MA 3I06A 3V6EA 1BY8A 1U9QX 2AUXA 1F2CA 2P0RA 5EF4A 3H89A 3WXFA 4YYUA 1CPJA 2F7DA 1X9YA 1GLOA 3P5VA 2AVWA 3D6SA 3HHIA 1MS6A 3QT4A 3KW9A 1BQIA 1PPDA 3O0UA 1CQDA 4YYWA 1Y4HA 1CJLA 1F2BA 3TNXA 1AYVA 3PNRA 3WXEA 1ME3A 1YK8A 1YVBA 1K3BB 1ME4A 3QJ3A 1F29A 2DZZA 2G8JA 3B79A 5J94A 1NB5A 4PI3A 1IWDA 2G6DA 3CBKA 3PDFA 1M6DA 2YJ8A 1NQCA 2FQ9A 1MEGA 4XR7A 3LXSA 5CVNB 3K24A 1ZCMA 4N79A 4OEMA 1PPOA 1NPZA 3S3QA 1HUCB 2PNSA 3MTNA 3HWNA 3OISA 3N4CA 3USVA 3OVXA 2OP3A 2VHSA 2JQFR 1PPNA 1NLJA 1U5IA 1VSNA 4PP1A 1KHPA 4FJCA 3IV2A 2Y6EA 3IHPA 4XUIA 3E1ZB 4DMYA 1QMYA 4W4UA 1AU4A 2VHFA 2HHNA 2YJBA 3O1GA 1A6RA 3OF9A 1CVZA 3KSEA 1XKGA 4QRXA 1TU6A 2XU3A 2ARYA 1AU3A 3KWZA 2DC9A 1CS8A 1KFUL 5EGWA 1MDWA 5CHTA 4MSXA 1TLOA 5CHVA 2OULA 3RVVA 4G54A 4AXMA 3BCNA 2NQGA 3N3GA 1EWOA 2CIOA 1EWMA 3H6SA 2JQGR 3P5WA 1FH0A 4QH6A 2DC6A 4Q8HA 1AYUA 1BGOA 4N4ZA 1PXVA 1S4VA 2E02A 1ICFA 1CB5A 1PE6A 3GCBA 3OF8A 6PADA 5A24A 1ATKA 1EWLA 2PBHA 4PP2E 2ATOA 4W5BA 4BS5A 1DF0A 1VJVA 2BDLA 4W5CA 3PW3A 3I3TA 3MORA 2DC8A 2NQIA 1QDQA 1YT7A 4N8WA 2HXZA 8PCHA 4QRGA 2E00A 2NQDB 1KXRA 3WXGA 2WBFX 2BDZA 3K9MA 2XU5A 4P6GA 1AIMA 1QXPA 4X6HA 3K8UA 4CZWA 2R9NA 2FRAA 3IMAA 1ITOA 2DCDA 2IPPB 3F75A 4CDDB 3F5VA 4WA6A 3HD3A 4AXLA 2FTDA 4YVAA 3KX1A 3N3KA 1U9VA 3LFYA 3H8BA 3KWBX 2AYNA 2H7JA 5CVMA 2XU4A 1O0EA 5JA7A 2ACTA 1AU0A 3BC3A 2R9CA 3H7DA 2DJFB 3P5XA 3ERVA 4CDCB 2CB5A 2NQAA 1EF7A 1U9WA 3CBJA 1KHQA 4X6IA 1Y08A 1NL6A 4OELA 2R9OA 5K16A 3KFQA 3DF0A 9PAPA 2AIMA 2B1NA 2GFOA 1U9XA 4QBBA 4KLBA 1GMYA 4YYRA 3P5UA 3IUTA 2FT2A 1PIPA 7PCKA 4PADA 4Q8GA 1MHWA 2YJ9A 5JH3A 4HWYA 3PBHA 4YV8A 2F1GA 1THEA 4BS6A 3M99A 3C9EA 4K7CA 4YYVA 2PREA 3KKUA 1YK7A 3RVXA 1STFE 2R9FA 4QRVA 5F02A 2HH5A 4YYQA 2E03A 4BSQA 1F2AA 3MHSA 2DJGB 2FRQA 3BOWA 1Q6KA 4CDFB 2DCBA 4CDEB 1GCBA 1AU2A 3U8EA 3HHAA 2DZYA 1CV8A 1KFXL 2AS8A 1PCIA 1EWPA 2PADA 3IEJA 2E01A 3H8CA 1MEMA 1CSBB 2FUDA 4YYSA 2G8EA 3AI8A 2YJCA 2FO5A 4I07A 1POPA 3CH3X 1SNKA 3V6CA 4P6EA 1SP4B 2Y5BA 4MZSA 1DEUA 2DCCA 4I05A 2GHUA 3NHEA 1PBHA 5CVOB 3S3RA 3BPFA 2R6NA 1NB3A 3CH2X 2OZ2A 2DCAA 1CTEA 1JQPA 1ZIVA 2AYOA 3IOQA 5PADA 3RVWA 2O6XA 2YJ2A 3BPMA 1PPPA 3BWKA 5FPWA 2AUZA 4FIPA 1AYWA 2IBIA 2FYEA 3ZUAA 2XU1A 4I04A 2P7UA 4FK5A 4ZUXU 4MZOA 2R9MA 1YALA 1PADA
chains in the Genus database with same CATH superfamily
1AECA 4BQVA 4RY2A 2P86A 3PSEA 2C0YA 4BPVA 1QOLA 3MHHA 3OVZA 1TL9A 4XZXA 3QSDA 4X6JA 4R3DA 1GECE 2DC7A 1BP4A 2G7YA 1MIRA 2AU1A 2HD5A 4DMXA 2B1MA 3I06A 3V6EA 1BY8A 1U9QX 2BTWB 3PHXA 2AUXA 1F2CA 2P0RA 5EF4A 3H89A 3WXFA 4YYUA 1CPJA 2F7DA 1X9YA 1GLOA 3P5VA 2AVWA 3D6SA 3HHIA 1MS6A 3QT4A 3KW9A 1BQIA 5EZQA 1PPDA 3O0UA 1CQDA 4YYWA 4P16A 1Y4HA 1CJLA 1DKIA 1F2BA 4OVZB 3TNXA 1AYVA 3PNRA 2DOSA 3WXEA 1ME3A 1YK8A 3BB7A 1YVBA 1K3BB 1ME4A 3QJ3A 4M0WA 1F29A 4BOPA 2DZZA 2G8JA 3B79A 5J94A 1NB5A 4PI3A 1IWDA 2G6DA 3CBKA 3PDFA 1M6DA 2YJ8A 1NQCA 2FQ9A 1MEGA 4XR7A 4BOQA 3LXSA 5CVNB 3K24A 1ZCMA 4N79A 4OEMA 1PPOA 1NPZA 3S3QA 1HUCB 2PNSA 3MTNA 3HWNA 3PHWA 3OISA 4IUMA 3N4CA 3USVA 3OVXA 2OP3A 3TRKA 2VHSA 2JQFR 2JTCA 1PPNA 1NLJA 1U5IA 1VSNA 4PP1A 1KHPA 4FJCA 3IV2A 2Y6EA 3IHPA 4XUIA 4D8EA 3E1ZB 4DMYA 4HXDB 1QMYA 4W4UA 1AU4A 2VHFA 4OVZA 2HHNA 2YJBA 3O1GA 1A6RA 3OF9A 1CVZA 3KSEA 3MTVA 3IFUA 4WURA 1XKGA 3PT2A 3C0RA 3PHUA 1TU6A 4QRXA 2XU3A 2ARYA 3MP2A 1AU3A 1YZBA 3KWZA 2DC9A 4D8BA 1CS8A 1KFUL 5EGWA 1MDWA 2HWKA 5CHTA 3B21A 4MSXA 1TLOA 5CHVA 2OULA 2J7QC 3RVVA 4G54A 4AXMA 3BCNA 2NQGA 3N3GA 1EWOA 2CIOA 1EWMA 3BBAA 3H6SA 2JQGR 3OQCA 4REZA 3P5WA 1FH0A 4QH6A 2DC6A 4Q8HA 1AYUA 1BGOA 4N4ZA 1PXVA 1S4VA 2E02A 4A5UA 1ICFA 1CB5A 1PE6A 3GCBA 3OF8A 6PADA 5A24A 1ATKA 1EWLA 2PBHA 4PP2E 2ATOA 4W5BA 4BS5A 1DF0A 1VJVA 2BDLA 4RKXA 4W5CA 2JRIA 3PW3A 3I3TA 4ZTBA 3MORA 2DC8A 2NQIA 5E6JA 1QDQA 3E9SA 1YT7A 4N8WA 4RF1A 2HXZA 4RF0A 4D8IA 5KO3A 2J7QA 8PCHA 4QRGA 2E00A 2NQDB 1KXRA 3WXGA 2WBFX 2BDZA 3RNVA 3K9MA 2XU5A 4P6GA 1AIMA 1QXPA 4X6HA 3K8UA 4CZWA 2R9NA 2FRAA 3IMAA 1ITOA 2DCDA 2IPPB 3F75A 4CDDB 3F5VA 4WA6A 3HD3A 4AXLA 2FTDA 4YVAA 3KX1A 4GUAA 3N3KA 1U9VA 3LFYA 4PT5A 2BTWA 3H8BA 4BOSA 3KWBX 2AYNA 2H7JA 5CVMA 2UZJA 1O0EA 2XU4A 5JA7A 2ACTA 1AU0A 3BC3A 3PRPA 2R9CA 3O65A 2BU3A 3H7DA 2DJFB 3P5XA 3ERVA 4CDCB 2CB5A 2NQAA 1EF7A 1U9WA 1PVJA 3CBJA 1KHQA 4X6IA 1Y08A 1NL6A 4OELA 2R9OA 5K16A 3KFQA 4BOZA 3DF0A 9PAPA 2AIMA 2B1NA 2GFOA 3TMPA 1U9XA 4QBBA 4KLBA 1GMYA 4YYRA 3P5UA 3IUTA 2FT2A 1PIPA 7PCKA 4PADA 4Q8GA 1MHWA 2YJ9A 2AGAA 5JH3A 4HWYA 3PBHA 4YV8A 2F1GA 1THEA 4BS6A 3M99A 3C9EA 4K7CA 4YYVA 2PREA 3KKUA 2Z84A 1YK7A 3RVXA 1STFE 2R9FA 4QRVA 5F02A 2HH5A 4YYQA 5EZSA 1UKFA 4MI7A 2FE8A 2E03A 4BSQA 1F2AA 3ZNHA 3W31A 3MHSA 2DJGB 2FRQA 3BOWA 1Q6KA 4CDFB 2DCBA 4CDEB 1GCBA 4RNAA 1AU2A 3U8EA 3HHAA 2DZYA 1CV8A 1KFXL 2AS8A 1PCIA 1EWPA 2PADA 3IEJA 2E01A 3H8CA 4MM3B 1MEMA 1CSBB 2FUDA 4YYSA 2G8EA 3AI8A 2YJCA 4OW0A 2FO5A 4I07A 1POPA 3PRMA 3CH3X 4IP3A 1SNKA 3V6CA 4P6EA 1SP4B 2Y5BA 4MZSA 1DEUA 2DCCA 4I05A 2GHUA 3NHEA 1PBHA 4BOUA 5CVOB 3S3RA 3BPFA 2R6NA 1NB3A 3CH2X 2OZ2A 2DCAA 5JZEA 1CTEA 1JQPA 1ZIVA 2AYOA 3BY4A 3IOQA 5PADA 3RVWA 2O6XA 2YJ2A 3BPMA 1PPPA 3BWKA 5FPWA 3W30A 2AUZA 4FIPA 1AYWA 2IBIA 2FYEA 3ZUAA 3MJ5A 2XU1A 4I04A 2P7UA 4FK5A 4ZUXU 4MZOA 2R9MA 1YALA 1PADA
chains in the Genus database with same CATH topology
1AECA 4BQVA 4RY2A 2BSZA 2P86A 2C0YA 4BPVA 1QOLA 3MHHA 3OVZA 1TL9A 3QSDA 4X6JA 1GECE 2DC7A 1BP4A 2G7YA 1MIRA 2AU1A 2HD5A 4DMXA 2B1MA 3I06A 3V6EA 4NV8A 1BY8A 1U9QX 2AUXA 1F2CA 2P0RA 5EF4A 3H89A 3WXFA 4YYUA 1CPJA 2F7DA 1X9YA 1GLOA 3P5VA 2AVWA 3D6SA 3HHIA 1MS6A 3QT4A 3KW9A 1BQIA 1PPDA 3O0UA 1CQDA 4YYWA 1Y4HA 1CJLA 4B55A 4C5PA 1F2BA 3TNXA 1AYVA 3PNRA 3WXEA 1ME3A 1YK8A 1YVBA 1K3BB 1ME4A 3QJ3A 1F29A 2DZZA 2G8JA 3B79A 5J94A 1NB5A 4PI3A 1IWDA 2G6DA 3CBKA 3PDFA 1M6DA 2YJ8A 1NQCA 2FQ9A 1MEGA 4XR7A 2VFBA 5CVNB 3LXSA 3K24A 1ZCMA 4N79A 4OEMA 1PPOA 1NPZA 3LTWA 3S3QA 1HUCB 2PNSA 3MTNA 3HWNA 3OISA 3N4CA 3USVA 3OVXA 2OP3A 2VHSA 2JQFR 1PPNA 1NLJA 1U5IA 1VSNA 4PP1A 1KHPA 4FJCA 3IV2A 2Y6EA 3IHPA 4XUIA 3E1ZB 4DMYA 4BGFA 1QMYA 4W4UA 1AU4A 2VHFA 2HHNA 2YJBA 3O1GA 1A6RA 3OF9A 1CVZA 3KSEA 1XKGA 4QRXA 1TU6A 2XU3A 2ARYA 1AU3A 3KWZA 2DC9A 1CS8A 1KFUL 5EGWA 1MDWA 5CHTA 4MSXA 1TLOA 5CHVA 2OULA 4NV7A 3RVVA 4G54A 4AXMA 3BCNA 2NQGA 3N3GA 1EWOA 2CIOA 1EWMA 3H6SA 2JQGR 3P5WA 1FH0A 4QH6A 2DC6A 4Q8HA 1W6FA 1AYUA 1BGOA 4N4ZA 1PXVA 1S4VA 2E02A 1ICFA 1CB5A 1PE6A 2VFCA 3GCBA 3OF8A 6PADA 5A24A 1ATKA 1EWLA 1W5RA 2PBHA 4PP2E 2ATOA 4W5BA 4BS5A 1DF0A 1VJVA 2BDLA 4W5CA 3PW3A 3I3TA 3MORA 2DC8A 2NQIA 1QDQA 1YT7A 4N8WA 2HXZA 8PCHA 4QRGA 2E00A 2NQDB 1KXRA 3WXGA 2WBFX 2BDZA 3K9MA 2XU5A 4P6GA 1AIMA 1QXPA 4X6HA 3K8UA 4CZWA 2R9NA 2FRAA 3IMAA 1ITOA 1E2TA 2DCDA 2IPPB 3F75A 4CDDB 3F5VA 4WA6A 3HD3A 4AXLA 2FTDA 4YVAA 3KX1A 3N3KA 1U9VA 3LFYA 3H8BA 3KWBX 2AYNA 2H7JA 5CVMA 2XU4A 1O0EA 5JA7A 2ACTA 1AU0A 3BC3A 2R9CA 3H7DA 2DJFB 3P5XA 3ERVA 4CDCB 2CB5A 2NQAA 1EF7A 1U9WA 3CBJA 1KHQA 4X6IA 1Y08A 1NL6A 4OELA 2R9OA 5K16A 3KFQA 3DF0A 9PAPA 2AIMA 2B1NA 2GFOA 1U9XA 4QBBA 4KLBA 1GMYA 4YYRA 3P5UA 3IUTA 2FT2A 1PIPA 7PCKA 4PADA 4Q8GA 1MHWA 2YJ9A 5JH3A 4HWYA 3PBHA 4YV8A 2F1GA 1THEA 4BS6A 3M99A 3C9EA 4K7CA 4YYVA 2PREA 3KKUA 1YK7A 3RVXA 1STFE 2R9FA 4QRVA 5F02A 2HH5A 4YYQA 2E03A 4BSQA 1F2AA 3MHSA 2DJGB 2FRQA 3BOWA 1Q6KA 4CDFB 2DCBA 4CDEB 1GCBA 1AU2A 3U8EA 3HHAA 2DZYA 1CV8A 1KFXL 2AS8A 1PCIA 1EWPA 2PADA 3IEJA 2E01A 3H8CA 1GX3A 1MEMA 1CSBB 2FUDA 3D9WA 4YYSA 2G8EA 3AI8A 2YJCA 2FO5A 4I07A 1POPA 3CH3X 1SNKA 3V6CA 4P6EA 1SP4B 2Y5BA 4MZSA 1DEUA 2DCCA 4I05A 2GHUA 3NHEA 1PBHA 5CVOB 3S3RA 3BPFA 4GUZA 2R6NA 1NB3A 3CH2X 2OZ2A 2DCAA 1CTEA 1JQPA 1ZIVA 2AYOA 3IOQA 5PADA 3RVWA 2O6XA 2YJ2A 3BPMA 1PPPA 1W4TA 3BWKA 5FPWA 2AUZA 4FIPA 1AYWA 2IBIA 2FYEA 3ZUAA 2XU1A 4I04A 2P7UA 4FK5A 4ZUXU 4MZOA 2R9MA 1YALA 1PADA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AEC A;  4BQV A;  4RY2 A;  2P86 A;  2C0Y A;  4BPV A;  1QOL A;  3MHH A;  3OVZ A;  1TL9 A;  3QSD A;  4X6J A;  1GEC E;  2DC7 A;  1BP4 A;  2G7Y A;  1MIR A;  2AU1 A;  2HD5 A;  4DMX A;  2B1M A;  3I06 A;  3V6E A;  1BY8 A;  1U9Q X;  2AUX A;  1F2C A;  2P0R A;  5EF4 A;  3H89 A;  3WXF A;  4YYU A;  1CPJ A;  2F7D A;  1X9Y A;  1GLO A;  3P5V A;  2AVW A;  3D6S A;  3HHI A;  1MS6 A;  3QT4 A;  3KW9 A;  1BQI A;  1PPD A;  3O0U A;  1CQD A;  4YYW A;  1Y4H A;  1CJL A;  1F2B A;  3TNX A;  1AYV A;  3PNR A;  3WXE A;  1ME3 A;  1YK8 A;  1YVB A;  1K3B B;  1ME4 A;  3QJ3 A;  1F29 A;  2DZZ A;  2G8J A;  3B79 A;  5J94 A;  1NB5 A;  4PI3 A;  1IWD A;  2G6D A;  3CBK A;  3PDF A;  1M6D A;  2YJ8 A;  1NQC A;  2FQ9 A;  1MEG A;  4XR7 A;  3LXS A;  5CVN B;  3K24 A;  1ZCM A;  4N79 A;  4OEM A;  1PPO A;  1NPZ A;  3S3Q A;  1HUC B;  2PNS A;  3MTN A;  3HWN A;  3OIS A;  3N4C A;  3USV A;  3OVX A;  2OP3 A;  2VHS A;  2JQF R;  1PPN A;  1NLJ A;  1U5I A;  1VSN A;  4PP1 A;  1KHP A;  4FJC A;  3IV2 A;  2Y6E A;  3IHP A;  4XUI A;  3E1Z B;  4DMY A;  1QMY A;  4W4U A;  1AU4 A;  2VHF A;  2HHN A;  2YJB A;  3O1G A;  1A6R A;  3OF9 A;  1CVZ A;  3KSE A;  1XKG A;  4QRX A;  1TU6 A;  2XU3 A;  2ARY A;  1AU3 A;  3KWZ A;  2DC9 A;  1CS8 A;  1KFU L;  5EGW A;  1MDW A;  5CHT A;  4MSX A;  1TLO A;  5CHV A;  2OUL A;  3RVV A;  4G54 A;  4AXM A;  3BCN A;  2NQG A;  3N3G A;  1EWO A;  2CIO A;  1EWM A;  3H6S A;  2JQG R;  3P5W A;  1FH0 A;  4QH6 A;  2DC6 A;  4Q8H A;  1AYU A;  1BGO A;  4N4Z A;  1PXV A;  1S4V A;  2E02 A;  1ICF A;  1CB5 A;  1PE6 A;  3GCB A;  3OF8 A;  6PAD A;  5A24 A;  1ATK A;  1EWL A;  2PBH A;  4PP2 E;  2ATO A;  4W5B A;  4BS5 A;  1DF0 A;  1VJV A;  2BDL A;  4W5C A;  3PW3 A;  3I3T A;  3MOR A;  2DC8 A;  2NQI A;  1QDQ A;  1YT7 A;  4N8W A;  2HXZ A;  8PCH A;  4QRG A;  2E00 A;  2NQD B;  1KXR A;  3WXG A;  2WBF X;  2BDZ A;  3K9M A;  2XU5 A;  4P6G A;  1AIM A;  1QXP A;  4X6H A;  3K8U A;  4CZW A;  2R9N A;  2FRA A;  3IMA A;  1ITO A;  2DCD A;  2IPP B;  3F75 A;  4CDD B;  3F5V A;  4WA6 A;  3HD3 A;  4AXL A;  2FTD A;  4YVA A;  3KX1 A;  3N3K A;  1U9V A;  3LFY A;  3H8B A;  3KWB X;  2AYN A;  2H7J A;  5CVM A;  2XU4 A;  1O0E A;  5JA7 A;  2ACT A;  1AU0 A;  3BC3 A;  2R9C A;  3H7D A;  2DJF B;  3P5X A;  3ERV A;  4CDC B;  2CB5 A;  2NQA A;  1EF7 A;  1U9W A;  3CBJ A;  1KHQ A;  4X6I A;  1Y08 A;  1NL6 A;  4OEL A;  2R9O A;  5K16 A;  3KFQ A;  3DF0 A;  9PAP A;  2AIM A;  2B1N A;  2GFO A;  1U9X A;  4QBB A;  4KLB A;  1GMY A;  4YYR A;  3P5U A;  3IUT A;  2FT2 A;  1PIP A;  7PCK A;  4PAD A;  4Q8G A;  1MHW A;  2YJ9 A;  5JH3 A;  4HWY A;  3PBH A;  4YV8 A;  2F1G A;  1THE A;  4BS6 A;  3M99 A;  3C9E A;  4K7C A;  4YYV A;  2PRE A;  3KKU A;  1YK7 A;  3RVX A;  1STF E;  2R9F A;  4QRV A;  5F02 A;  2HH5 A;  4YYQ A;  2E03 A;  4BSQ A;  1F2A A;  3MHS A;  2DJG B;  2FRQ A;  3BOW A;  1Q6K A;  4CDF B;  2DCB A;  4CDE B;  1GCB A;  1AU2 A;  3U8E A;  3HHA A;  2DZY A;  1CV8 A;  1KFX L;  2AS8 A;  1PCI A;  1EWP A;  2PAD A;  3IEJ A;  2E01 A;  3H8C A;  1MEM A;  1CSB B;  2FUD A;  4YYS A;  2G8E A;  3AI8 A;  2YJC A;  2FO5 A;  4I07 A;  1POP A;  3CH3 X;  1SNK A;  3V6C A;  4P6E A;  1SP4 B;  2Y5B A;  4MZS A;  1DEU A;  2DCC A;  4I05 A;  2GHU A;  3NHE A;  1PBH A;  5CVO B;  3S3R A;  3BPF A;  2R6N A;  1NB3 A;  3CH2 X;  2OZ2 A;  2DCA A;  1CTE A;  1JQP A;  1ZIV A;  2AYO A;  3IOQ A;  5PAD A;  3RVW A;  2O6X A;  2YJ2 A;  3BPM A;  1PPP A;  3BWK A;  5FPW A;  2AUZ A;  4FIP A;  1AYW A;  2IBI A;  2FYE A;  3ZUA A;  2XU1 A;  4I04 A;  2P7U A;  4FK5 A;  4ZUX U;  4MZO A;  2R9M A;  1YAL A;  1PAD A; 
#chains in the Genus database with same CATH topology
 1AEC A;  4BQV A;  4RY2 A;  2P86 A;  3PSE A;  2C0Y A;  4BPV A;  1QOL A;  3MHH A;  3OVZ A;  1TL9 A;  4XZX A;  3QSD A;  4X6J A;  4R3D A;  1GEC E;  2DC7 A;  1BP4 A;  2G7Y A;  1MIR A;  2AU1 A;  2HD5 A;  4DMX A;  2B1M A;  3I06 A;  3V6E A;  1BY8 A;  1U9Q X;  2BTW B;  3PHX A;  2AUX A;  1F2C A;  2P0R A;  5EF4 A;  3H89 A;  3WXF A;  4YYU A;  1CPJ A;  2F7D A;  1X9Y A;  1GLO A;  3P5V A;  2AVW A;  3D6S A;  3HHI A;  1MS6 A;  3QT4 A;  3KW9 A;  1BQI A;  5EZQ A;  1PPD A;  3O0U A;  1CQD A;  4YYW A;  4P16 A;  1Y4H A;  1CJL A;  1DKI A;  1F2B A;  4OVZ B;  3TNX A;  1AYV A;  3PNR A;  2DOS A;  3WXE A;  1ME3 A;  1YK8 A;  3BB7 A;  1YVB A;  1K3B B;  1ME4 A;  3QJ3 A;  4M0W A;  1F29 A;  4BOP A;  2DZZ A;  2G8J A;  3B79 A;  5J94 A;  1NB5 A;  4PI3 A;  1IWD A;  2G6D A;  3CBK A;  3PDF A;  1M6D A;  2YJ8 A;  1NQC A;  2FQ9 A;  1MEG A;  4XR7 A;  4BOQ A;  3LXS A;  5CVN B;  3K24 A;  1ZCM A;  4N79 A;  4OEM A;  1PPO A;  1NPZ A;  3S3Q A;  1HUC B;  2PNS A;  3MTN A;  3HWN A;  3PHW A;  3OIS A;  4IUM A;  3N4C A;  3USV A;  3OVX A;  2OP3 A;  3TRK A;  2VHS A;  2JQF R;  2JTC A;  1PPN A;  1NLJ A;  1U5I A;  1VSN A;  4PP1 A;  1KHP A;  4FJC A;  3IV2 A;  2Y6E A;  3IHP A;  4XUI A;  4D8E A;  3E1Z B;  4DMY A;  4HXD B;  1QMY A;  4W4U A;  1AU4 A;  2VHF A;  4OVZ A;  2HHN A;  2YJB A;  3O1G A;  1A6R A;  3OF9 A;  1CVZ A;  3KSE A;  3MTV A;  3IFU A;  4WUR A;  1XKG A;  3PT2 A;  3C0R A;  3PHU A;  1TU6 A;  4QRX A;  2XU3 A;  2ARY A;  3MP2 A;  1AU3 A;  1YZB A;  3KWZ A;  2DC9 A;  4D8B A;  1CS8 A;  1KFU L;  5EGW A;  1MDW A;  2HWK A;  5CHT A;  3B21 A;  4MSX A;  1TLO A;  5CHV A;  2OUL A;  2J7Q C;  3RVV A;  4G54 A;  4AXM A;  3BCN A;  2NQG A;  3N3G A;  1EWO A;  2CIO A;  1EWM A;  3BBA A;  3H6S A;  2JQG R;  3OQC A;  4REZ A;  3P5W A;  1FH0 A;  4QH6 A;  2DC6 A;  4Q8H A;  1AYU A;  1BGO A;  4N4Z A;  1PXV A;  1S4V A;  2E02 A;  4A5U A;  1ICF A;  1CB5 A;  1PE6 A;  3GCB A;  3OF8 A;  6PAD A;  5A24 A;  1ATK A;  1EWL A;  2PBH A;  4PP2 E;  2ATO A;  4W5B A;  4BS5 A;  1DF0 A;  1VJV A;  2BDL A;  4RKX A;  4W5C A;  2JRI A;  3PW3 A;  3I3T A;  4ZTB A;  3MOR A;  2DC8 A;  2NQI A;  5E6J A;  1QDQ A;  3E9S A;  1YT7 A;  4N8W A;  4RF1 A;  2HXZ A;  4RF0 A;  4D8I A;  5KO3 A;  2J7Q A;  8PCH A;  4QRG A;  2E00 A;  2NQD B;  1KXR A;  3WXG A;  2WBF X;  2BDZ A;  3RNV A;  3K9M A;  2XU5 A;  4P6G A;  1AIM A;  1QXP A;  4X6H A;  3K8U A;  4CZW A;  2R9N A;  2FRA A;  3IMA A;  1ITO A;  2DCD A;  2IPP B;  3F75 A;  4CDD B;  3F5V A;  4WA6 A;  3HD3 A;  4AXL A;  2FTD A;  4YVA A;  3KX1 A;  4GUA A;  3N3K A;  1U9V A;  3LFY A;  4PT5 A;  2BTW A;  3H8B A;  4BOS A;  3KWB X;  2AYN A;  2H7J A;  5CVM A;  2UZJ A;  1O0E A;  2XU4 A;  5JA7 A;  2ACT A;  1AU0 A;  3BC3 A;  3PRP A;  2R9C A;  3O65 A;  2BU3 A;  3H7D A;  2DJF B;  3P5X A;  3ERV A;  4CDC B;  2CB5 A;  2NQA A;  1EF7 A;  1U9W A;  1PVJ A;  3CBJ A;  1KHQ A;  4X6I A;  1Y08 A;  1NL6 A;  4OEL A;  2R9O A;  5K16 A;  3KFQ A;  4BOZ A;  3DF0 A;  9PAP A;  2AIM A;  2B1N A;  2GFO A;  3TMP A;  1U9X A;  4QBB A;  4KLB A;  1GMY A;  4YYR A;  3P5U A;  3IUT A;  2FT2 A;  1PIP A;  7PCK A;  4PAD A;  4Q8G A;  1MHW A;  2YJ9 A;  2AGA A;  5JH3 A;  4HWY A;  3PBH A;  4YV8 A;  2F1G A;  1THE A;  4BS6 A;  3M99 A;  3C9E A;  4K7C A;  4YYV A;  2PRE A;  3KKU A;  2Z84 A;  1YK7 A;  3RVX A;  1STF E;  2R9F A;  4QRV A;  5F02 A;  2HH5 A;  4YYQ A;  5EZS A;  1UKF A;  4MI7 A;  2FE8 A;  2E03 A;  4BSQ A;  1F2A A;  3ZNH A;  3W31 A;  3MHS A;  2DJG B;  2FRQ A;  3BOW A;  1Q6K A;  4CDF B;  2DCB A;  4CDE B;  1GCB A;  4RNA A;  1AU2 A;  3U8E A;  3HHA A;  2DZY A;  1CV8 A;  1KFX L;  2AS8 A;  1PCI A;  1EWP A;  2PAD A;  3IEJ A;  2E01 A;  3H8C A;  4MM3 B;  1MEM A;  1CSB B;  2FUD A;  4YYS A;  2G8E A;  3AI8 A;  2YJC A;  4OW0 A;  2FO5 A;  4I07 A;  1POP A;  3PRM A;  3CH3 X;  4IP3 A;  1SNK A;  3V6C A;  4P6E A;  1SP4 B;  2Y5B A;  4MZS A;  1DEU A;  2DCC A;  4I05 A;  2GHU A;  3NHE A;  1PBH A;  4BOU A;  5CVO B;  3S3R A;  3BPF A;  2R6N A;  1NB3 A;  3CH2 X;  2OZ2 A;  2DCA A;  5JZE A;  1CTE A;  1JQP A;  1ZIV A;  2AYO A;  3BY4 A;  3IOQ A;  5PAD A;  3RVW A;  2O6X A;  2YJ2 A;  3BPM A;  1PPP A;  3BWK A;  5FPW A;  3W30 A;  2AUZ A;  4FIP A;  1AYW A;  2IBI A;  2FYE A;  3ZUA A;  3MJ5 A;  2XU1 A;  4I04 A;  2P7U A;  4FK5 A;  4ZUX U;  4MZO A;  2R9M A;  1YAL A;  1PAD A; 
#chains in the Genus database with same CATH homology
 1AEC A;  4BQV A;  4RY2 A;  2BSZ A;  2P86 A;  2C0Y A;  4BPV A;  1QOL A;  3MHH A;  3OVZ A;  1TL9 A;  3QSD A;  4X6J A;  1GEC E;  2DC7 A;  1BP4 A;  2G7Y A;  1MIR A;  2AU1 A;  2HD5 A;  4DMX A;  2B1M A;  3I06 A;  3V6E A;  4NV8 A;  1BY8 A;  1U9Q X;  2AUX A;  1F2C A;  2P0R A;  5EF4 A;  3H89 A;  3WXF A;  4YYU A;  1CPJ A;  2F7D A;  1X9Y A;  1GLO A;  3P5V A;  2AVW A;  3D6S A;  3HHI A;  1MS6 A;  3QT4 A;  3KW9 A;  1BQI A;  1PPD A;  3O0U A;  1CQD A;  4YYW A;  1Y4H A;  1CJL A;  4B55 A;  4C5P A;  1F2B A;  3TNX A;  1AYV A;  3PNR A;  3WXE A;  1ME3 A;  1YK8 A;  1YVB A;  1K3B B;  1ME4 A;  3QJ3 A;  1F29 A;  2DZZ A;  2G8J A;  3B79 A;  5J94 A;  1NB5 A;  4PI3 A;  1IWD A;  2G6D A;  3CBK A;  3PDF A;  1M6D A;  2YJ8 A;  1NQC A;  2FQ9 A;  1MEG A;  4XR7 A;  2VFB A;  5CVN B;  3LXS A;  3K24 A;  1ZCM A;  4N79 A;  4OEM A;  1PPO A;  1NPZ A;  3LTW A;  3S3Q A;  1HUC B;  2PNS A;  3MTN A;  3HWN A;  3OIS A;  3N4C A;  3USV A;  3OVX A;  2OP3 A;  2VHS A;  2JQF R;  1PPN A;  1NLJ A;  1U5I A;  1VSN A;  4PP1 A;  1KHP A;  4FJC A;  3IV2 A;  2Y6E A;  3IHP A;  4XUI A;  3E1Z B;  4DMY A;  4BGF A;  1QMY A;  4W4U A;  1AU4 A;  2VHF A;  2HHN A;  2YJB A;  3O1G A;  1A6R A;  3OF9 A;  1CVZ A;  3KSE A;  1XKG A;  4QRX A;  1TU6 A;  2XU3 A;  2ARY A;  1AU3 A;  3KWZ A;  2DC9 A;  1CS8 A;  1KFU L;  5EGW A;  1MDW A;  5CHT A;  4MSX A;  1TLO A;  5CHV A;  2OUL A;  4NV7 A;  3RVV A;  4G54 A;  4AXM A;  3BCN A;  2NQG A;  3N3G A;  1EWO A;  2CIO A;  1EWM A;  3H6S A;  2JQG R;  3P5W A;  1FH0 A;  4QH6 A;  2DC6 A;  4Q8H A;  1W6F A;  1AYU A;  1BGO A;  4N4Z A;  1PXV A;  1S4V A;  2E02 A;  1ICF A;  1CB5 A;  1PE6 A;  2VFC A;  3GCB A;  3OF8 A;  6PAD A;  5A24 A;  1ATK A;  1EWL A;  1W5R A;  2PBH A;  4PP2 E;  2ATO A;  4W5B A;  4BS5 A;  1DF0 A;  1VJV A;  2BDL A;  4W5C A;  3PW3 A;  3I3T A;  3MOR A;  2DC8 A;  2NQI A;  1QDQ A;  1YT7 A;  4N8W A;  2HXZ A;  8PCH A;  4QRG A;  2E00 A;  2NQD B;  1KXR A;  3WXG A;  2WBF X;  2BDZ A;  3K9M A;  2XU5 A;  4P6G A;  1AIM A;  1QXP A;  4X6H A;  3K8U A;  4CZW A;  2R9N A;  2FRA A;  3IMA A;  1ITO A;  1E2T A;  2DCD A;  2IPP B;  3F75 A;  4CDD B;  3F5V A;  4WA6 A;  3HD3 A;  4AXL A;  2FTD A;  4YVA A;  3KX1 A;  3N3K A;  1U9V A;  3LFY A;  3H8B A;  3KWB X;  2AYN A;  2H7J A;  5CVM A;  2XU4 A;  1O0E A;  5JA7 A;  2ACT A;  1AU0 A;  3BC3 A;  2R9C A;  3H7D A;  2DJF B;  3P5X A;  3ERV A;  4CDC B;  2CB5 A;  2NQA A;  1EF7 A;  1U9W A;  3CBJ A;  1KHQ A;  4X6I A;  1Y08 A;  1NL6 A;  4OEL A;  2R9O A;  5K16 A;  3KFQ A;  3DF0 A;  9PAP A;  2AIM A;  2B1N A;  2GFO A;  1U9X A;  4QBB A;  4KLB A;  1GMY A;  4YYR A;  3P5U A;  3IUT A;  2FT2 A;  1PIP A;  7PCK A;  4PAD A;  4Q8G A;  1MHW A;  2YJ9 A;  5JH3 A;  4HWY A;  3PBH A;  4YV8 A;  2F1G A;  1THE A;  4BS6 A;  3M99 A;  3C9E A;  4K7C A;  4YYV A;  2PRE A;  3KKU A;  1YK7 A;  3RVX A;  1STF E;  2R9F A;  4QRV A;  5F02 A;  2HH5 A;  4YYQ A;  2E03 A;  4BSQ A;  1F2A A;  3MHS A;  2DJG B;  2FRQ A;  3BOW A;  1Q6K A;  4CDF B;  2DCB A;  4CDE B;  1GCB A;  1AU2 A;  3U8E A;  3HHA A;  2DZY A;  1CV8 A;  1KFX L;  2AS8 A;  1PCI A;  1EWP A;  2PAD A;  3IEJ A;  2E01 A;  3H8C A;  1GX3 A;  1MEM A;  1CSB B;  2FUD A;  3D9W A;  4YYS A;  2G8E A;  3AI8 A;  2YJC A;  2FO5 A;  4I07 A;  1POP A;  3CH3 X;  1SNK A;  3V6C A;  4P6E A;  1SP4 B;  2Y5B A;  4MZS A;  1DEU A;  2DCC A;  4I05 A;  2GHU A;  3NHE A;  1PBH A;  5CVO B;  3S3R A;  3BPF A;  4GUZ A;  2R6N A;  1NB3 A;  3CH2 X;  2OZ2 A;  2DCA A;  1CTE A;  1JQP A;  1ZIV A;  2AYO A;  3IOQ A;  5PAD A;  3RVW A;  2O6X A;  2YJ2 A;  3BPM A;  1PPP A;  1W4T A;  3BWK A;  5FPW A;  2AUZ A;  4FIP A;  1AYW A;  2IBI A;  2FYE A;  3ZUA A;  2XU1 A;  4I04 A;  2P7U A;  4FK5 A;  4ZUX U;  4MZO A;  2R9M A;  1YAL A;  1PAD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...