5JH3A

Human cathepsin k mutant c25s
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
214
structure length
214
Chain Sequence
PDSVDYRKKGYVTPVKNQGQCGSSWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cathepsin K
publication title An allosteric site enables fine-tuning of cathepsin K by diverse effectors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 62
structure length 214
sequence length 214
ec nomenclature ec 3.4.22.38: Cathepsin K.
pdb deposition date 2016-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 5jh3A00
1AIMA 1GECE 4X6IA 2E01A 3HWNA 3USVA 4QH6A 1GCBA 2GFOA 4MZOA 4WA6A 4KLBA 2HXZA 3BPFA 3KWBX 3S3QA 1KHPA 1MS6A 1M6DA 4PP1A 4XUIA 2AUZA 4YYSA 1EWMA 4OELA 3PBHA 2JQFR 2FO5A 1VSNA 2AYNA 3C9EA 3PNRA 5J94A 3RVXA 1AYVA 1X9YA 1BP4A 4OEMA 3IUTA 2G7YA 2F7DA 3IHPA 1GLOA 2OULA 3MHSA 1EWOA 1F2AA 3HHAA 3IV2A 1PPPA 1A6RA 1F2BA 2Y5BA 2AYOA 1STFE 3RVWA 1XKGA 2FRAA 2DZYA 4FK5A 3BWKA 1Y08A 3V6CA 4G54A 1TLOA 3D6SA 1MDWA 2P86A 3H6SA 3K8UA 4QRGA 4FIPA 1DEUA 1AECA 2FTDA 4PP2E 3IOQA 2ARYA 4HWYA 3O1GA 3WXEA 1CB5A 1YT7A 3KW9A 4CDDB 1YALA 2R6NA 3P5WA 1BY8A 2B1MA 3E1ZB 1ZIVA 1KFXL 1VJVA 2P7UA 1YK8A 3BCNA 1U9WA 4I05A 4MZSA 2YJ8A 2AU1A 2HD5A 3P5VA 1NLJA 1TL9A 5EGWA 2BDZA 2BDLA 1CVZA 1U9VA 2OZ2A 3BPMA 2HHNA 3U8EA 4QRVA 2NQAA 3BC3A 1BQIA 1PIPA 4YYUA 1MIRA 1SNKA 2O6XA 4P6GA 2NQDB 2G8JA 1PXVA 2E00A 1JQPA 1BGOA 3GCBA 3OVXA 1O0EA 2R9OA 5EF4A 2XU4A 2PBHA 4AXLA 3KFQA 2FYEA 3BOWA 3KX1A 9PAPA 3HHIA 3OISA 3CBKA 2ATOA 3F75A 3B79A 5CVNB 1QOLA 3ERVA 3LXSA 3NHEA 1MEMA 3LFYA 2AS8A 2DCAA 1PBHA 1ITOA 5FPWA 2NQGA 1U9QX 1CTEA 2FT2A 1ATKA 3P5UA 3CBJA 4YYVA 1HUCB 3IMAA 5CHVA 4BPVA 4BSQA 4DMXA 3N4CA 5JA7A 2GHUA 1ME3A 1QXPA 1NPZA 3MORA 3OF9A 1EWPA 1POPA 6PADA 4BS5A 4N8WA 2H7JA 5JH3A 1YK7A 4I07A 4YV8A 1QMYA 1F2CA 4W5BA 4RY2A 1NQCA 2DC9A 1CPJA 2G6DA 4W5CA 1AU2A 2XU5A 1AU0A 1ICFA 4YYWA 5CHTA 2DC8A 4CDFB 2PREA 1MEGA 1CQDA 1PCIA 3RVVA 1KFUL 2XU3A 3KWZA 2C0YA 3O0UA 3HD3A 2P0RA 2YJBA 2ACTA 3H8BA 3OVZA 2OP3A 4CZWA 2DCDA 3MTNA 7PCKA 5K16A 3K9MA 3PW3A 1DF0A 1K3BB 1KXRA 1AU3A 3N3GA 3PDFA 4AXMA 1QDQA 1TU6A 5F02A 2VHSA 3F5VA 3WXGA 1F29A 4FJCA 4CDEB 3I3TA 4BQVA 2JQGR 2AUXA 2IPPB 2FQ9A 2XU1A 2DZZA 2PADA 1NL6A 3QJ3A 3CH2X 3OF8A 1PPOA 4X6JA 2DC7A 1AYWA 3MHHA 2R9CA 1CSBB 2E02A 1AYUA 2DJFB 3H8CA 1Y4HA 3WXFA 1IWDA 3CH3X 2F1GA 2AVWA 3ZUAA 4QBBA 1ZCMA 1PPNA 4Q8GA 4YYQA 2DJGB 2AIMA 3M99A 1Q6KA 2CB5A 4K7CA 4PADA 1NB3A 1NB5A 2FUDA 3QSDA 4Q8HA 1YVBA 2YJ9A 4YVAA 4DMYA 3H89A 4CDCB 2IBIA 2CIOA 3TNXA 1AU4A 2E03A 1GMYA 1PADA 1CJLA 4MSXA 4N79A 3QT4A 1PE6A 1EWLA 5CVMA 2Y6EA 1KHQA 2B1NA 8PCHA 2R9NA 5CVOB 2DC6A 2R9MA 4N4ZA 2YJ2A 2YJCA 1S4VA 1ME4A 3K24A 2FRQA 4YYRA 4PI3A 3H7DA 2DCCA 2VHFA 1FH0A 3KSEA 3IEJA 2WBFX 2R9FA 3DF0A 4X6HA 1U9XA 4W4UA 1CV8A 4ZUXU 1PPDA 4P6EA 3AI8A 3I06A 2HH5A 3P5XA 2DCBA 1THEA 1MHWA 4BS6A 4QRXA 1SP4B 3V6EA 2PNSA 2G8EA 1CS8A 3N3KA 3KKUA 1U5IA 2NQIA 1EF7A 5PADA 4XR7A 5A24A 3S3RA 4I04A
chains in the Genus database with same CATH superfamily
1AIMA 1GECE 4X6IA 2E01A 3HWNA 3USVA 4QH6A 1GCBA 2GFOA 4MZOA 4WA6A 3PHXA 4KLBA 2HXZA 3BPFA 3KWBX 3S3QA 1KHPA 1MS6A 1M6DA 4PP1A 4XUIA 4WURA 2AUZA 4YYSA 1EWMA 4OELA 4BOPA 3PBHA 2JQFR 2FO5A 3W30A 3MTVA 1VSNA 2AYNA 3C9EA 3PNRA 5J94A 3RVXA 1AYVA 3W31A 1X9YA 1YZBA 1BP4A 2FE8A 2AGAA 4OEMA 3IUTA 2G7YA 2F7DA 3IHPA 1GLOA 2OULA 3MHSA 1EWOA 1F2AA 2BU3A 3HHAA 3IV2A 1PPPA 1A6RA 1F2BA 2Y5BA 2AYOA 1STFE 3RVWA 1XKGA 2FRAA 3E9SA 2DZYA 5KO3A 4FK5A 3BWKA 1Y08A 3V6CA 4G54A 1TLOA 3D6SA 1MDWA 2P86A 3H6SA 3K8UA 4QRGA 4MI7A 4XZXA 4FIPA 1DEUA 1AECA 2FTDA 4PP2E 3IOQA 2ARYA 4HWYA 3O1GA 3WXEA 4GUAA 4M0WA 1CB5A 5EZQA 1YT7A 1PVJA 3KW9A 4CDDB 1YALA 2R6NA 3B21A 4OVZA 3P5WA 1BY8A 2J7QC 2B1MA 3E1ZB 1ZIVA 1KFXL 1VJVA 2P7UA 1YK8A 3BCNA 1U9WA 4I05A 3ZNHA 3MJ5A 4MZSA 2YJ8A 2AU1A 2HD5A 3P5VA 1NLJA 1TL9A 5EGWA 2BDZA 2BDLA 1CVZA 1U9VA 2OZ2A 3BPMA 2HHNA 4RKXA 3U8EA 4QRVA 2NQAA 3BC3A 4P16A 3OQCA 1BQIA 1PIPA 4YYUA 1MIRA 2JTCA 1SNKA 2BTWA 2O6XA 4P6GA 2NQDB 2G8JA 1PXVA 2E00A 3TMPA 1JQPA 1BGOA 3GCBA 3OVXA 1O0EA 2R9OA 5EF4A 2XU4A 5JZEA 2PBHA 4AXLA 3KFQA 2FYEA 3C0RA 3BOWA 3KX1A 9PAPA 3HHIA 3OISA 4RF1A 3CBKA 2ATOA 3RNVA 3F75A 3B79A 5CVNB 1QOLA 3ERVA 3LXSA 3NHEA 4OW0A 1MEMA 3LFYA 2AS8A 2DCAA 1PBHA 3BB7A 1ITOA 5FPWA 2NQGA 1U9QX 1CTEA 4D8IA 4RNAA 2FT2A 1ATKA 3P5UA 3CBJA 4YYVA 1HUCB 3IMAA 5CHVA 4BPVA 4BSQA 3MP2A 4DMXA 3N4CA 4BOZA 5JA7A 2GHUA 1ME3A 1QXPA 4R3DA 1NPZA 3MORA 3OF9A 1EWPA 1POPA 6PADA 4BOQA 4BS5A 4N8WA 2H7JA 5JH3A 4A5UA 1YK7A 4I07A 4YV8A 1QMYA 1F2CA 4W5BA 4RY2A 1NQCA 2DC9A 4BOSA 3PSEA 1CPJA 2G6DA 4OVZB 4W5CA 1AU2A 2XU5A 1AU0A 1ICFA 4YYWA 5CHTA 2DC8A 4CDFB 2PREA 1MEGA 1CQDA 1PCIA 3RVVA 1KFUL 2XU3A 3KWZA 2C0YA 2Z84A 2HWKA 3O0UA 3HD3A 2P0RA 2YJBA 2ACTA 5EZSA 3H8BA 3OVZA 2OP3A 3BBAA 4CZWA 2DCDA 4ZTBA 3MTNA 7PCKA 3PRPA 5K16A 3K9MA 2JRIA 3PW3A 1DF0A 1K3BB 1KXRA 3N3GA 3PDFA 4AXMA 1QDQA 1TU6A 5F02A 2VHSA 3F5VA 3PRMA 1UKFA 2BTWB 1DKIA 3WXGA 1F29A 4FJCA 4CDEB 3I3TA 4BQVA 2JQGR 2AUXA 2IPPB 2FQ9A 2XU1A 2DZZA 2PADA 1NL6A 3PT2A 3QJ3A 3CH2X 3OF8A 3PHUA 1PPOA 4X6JA 2DC7A 1AYWA 3MHHA 2R9CA 3IFUA 1CSBB 2E02A 1AYUA 2DJFB 4D8BA 2J7QA 3H8CA 1Y4HA 3WXFA 1IWDA 3CH3X 2F1GA 2AVWA 4IUMA 3ZUAA 4MM3B 4QBBA 1ZCMA 1PPNA 4Q8GA 2DOSA 4YYQA 2DJGB 2AIMA 3M99A 1Q6KA 2CB5A 4K7CA 4PADA 1NB3A 1NB5A 4IP3A 2FUDA 3QSDA 4Q8HA 1YVBA 2YJ9A 3O65A 4YVAA 4DMYA 3H89A 4CDCB 2IBIA 2CIOA 5E6JA 3TNXA 1AU4A 3BY4A 2E03A 1GMYA 1PADA 1CJLA 4MSXA 4N79A 3QT4A 1PE6A 1EWLA 5CVMA 2Y6EA 1KHQA 2B1NA 8PCHA 2R9NA 5CVOB 2DC6A 2R9MA 4N4ZA 4BOUA 2YJ2A 2YJCA 1S4VA 3PHWA 1ME4A 3K24A 4PT5A 2FRQA 4YYRA 4HXDB 4PI3A 4REZA 3H7DA 4RF0A 2DCCA 2VHFA 1FH0A 3KSEA 4I04A 3IEJA 2WBFX 2R9FA 3DF0A 4X6HA 1U9XA 4W4UA 1CV8A 4ZUXU 1PPDA 4P6EA 4D8EA 3AI8A 3I06A 2HH5A 3TRKA 3P5XA 2DCBA 1THEA 1MHWA 4BS6A 4QRXA 1SP4B 3V6EA 2PNSA 2G8EA 1CS8A 3N3KA 3KKUA 1U5IA 2NQIA 1EF7A 2UZJA 5PADA 4XR7A 5A24A 3S3RA 1AU3A
chains in the Genus database with same CATH topology
1AIMA 1GECE 4X6IA 2E01A 3HWNA 3USVA 4QH6A 1GCBA 2GFOA 4MZOA 4WA6A 4KLBA 2HXZA 3BPFA 3KWBX 3S3QA 1KHPA 1MS6A 1M6DA 4PP1A 4XUIA 2AUZA 4YYSA 1EWMA 4OELA 3PBHA 2JQFR 2FO5A 1VSNA 2AYNA 3C9EA 3PNRA 5J94A 3RVXA 1AYVA 1X9YA 1BP4A 4OEMA 3IUTA 2G7YA 2F7DA 3IHPA 4NV7A 1GLOA 2OULA 3MHSA 1EWOA 1F2AA 3HHAA 3IV2A 1PPPA 1A6RA 1F2BA 2Y5BA 2AYOA 1STFE 3RVWA 1XKGA 2FRAA 2DZYA 4FK5A 3BWKA 1Y08A 3V6CA 4G54A 1TLOA 3D6SA 1MDWA 2P86A 3H6SA 3K8UA 4QRGA 4FIPA 1DEUA 1AECA 2FTDA 4PP2E 3IOQA 2ARYA 4HWYA 3O1GA 3WXEA 1CB5A 1YT7A 3KW9A 1W6FA 4CDDB 1YALA 2R6NA 3P5WA 1BY8A 2B1MA 3E1ZB 1ZIVA 1KFXL 1VJVA 2P7UA 1YK8A 3BCNA 1U9WA 4I05A 4MZSA 1W5RA 2YJ8A 2AU1A 2HD5A 3P5VA 1NLJA 1TL9A 5EGWA 2BDZA 2BDLA 1CVZA 1U9VA 2OZ2A 3BPMA 2HHNA 3U8EA 4QRVA 2NQAA 3BC3A 1BQIA 1PIPA 4YYUA 1MIRA 1SNKA 2O6XA 4P6GA 2NQDB 2G8JA 1PXVA 2E00A 1JQPA 1BGOA 3GCBA 3OVXA 1O0EA 2R9OA 5EF4A 2XU4A 2PBHA 4AXLA 3KFQA 2FYEA 3BOWA 3KX1A 9PAPA 3HHIA 4GUZA 3OISA 3CBKA 2ATOA 3F75A 3B79A 5CVNB 1QOLA 3ERVA 3LXSA 3NHEA 1MEMA 3LFYA 2AS8A 2DCAA 1PBHA 1ITOA 5FPWA 2NQGA 1U9QX 1CTEA 2FT2A 1ATKA 3P5UA 3CBJA 4YYVA 1HUCB 3IMAA 5CHVA 4BPVA 4BSQA 4DMXA 3N4CA 5JA7A 2GHUA 1ME3A 1QXPA 1NPZA 3MORA 3OF9A 1EWPA 1POPA 6PADA 4BS5A 4N8WA 2H7JA 5JH3A 1YK7A 4I07A 4YV8A 1QMYA 1F2CA 4W5BA 4RY2A 1NQCA 2DC9A 1CPJA 2G6DA 4W5CA 1AU2A 2XU5A 1AU0A 1ICFA 4YYWA 5CHTA 2DC8A 4CDFB 4B55A 2PREA 3LTWA 1MEGA 1CQDA 1PCIA 3RVVA 1KFUL 2XU3A 1GX3A 3KWZA 2C0YA 3O0UA 3HD3A 2P0RA 2YJBA 2ACTA 3H8BA 3OVZA 4C5PA 2OP3A 4CZWA 2DCDA 3MTNA 7PCKA 5K16A 3K9MA 3PW3A 1DF0A 1K3BB 1KXRA 1AU3A 3N3GA 3PDFA 4AXMA 1QDQA 1TU6A 3D9WA 5F02A 2VHSA 3F5VA 2VFCA 1E2TA 3WXGA 1F29A 4FJCA 4CDEB 3I3TA 4BQVA 2JQGR 2AUXA 2IPPB 2FQ9A 2XU1A 2DZZA 2PADA 1NL6A 3QJ3A 3CH2X 3OF8A 1PPOA 4X6JA 2DC7A 1AYWA 3MHHA 2R9CA 1CSBB 2E02A 1AYUA 2DJFB 3H8CA 1Y4HA 3WXFA 1IWDA 3CH3X 2F1GA 2BSZA 2AVWA 3ZUAA 4QBBA 1ZCMA 1PPNA 4Q8GA 4YYQA 2DJGB 2AIMA 3M99A 1Q6KA 2CB5A 4K7CA 4PADA 1NB3A 1NB5A 2FUDA 3QSDA 4Q8HA 1YVBA 2YJ9A 4YVAA 4DMYA 3H89A 4CDCB 2IBIA 2CIOA 3TNXA 1AU4A 2E03A 1GMYA 1PADA 1CJLA 4MSXA 4N79A 3QT4A 1PE6A 1EWLA 5CVMA 2VFBA 2Y6EA 1KHQA 2B1NA 8PCHA 2R9NA 5CVOB 2DC6A 2R9MA 4N4ZA 2YJ2A 1W4TA 2YJCA 1S4VA 1ME4A 3K24A 2FRQA 4YYRA 4PI3A 3H7DA 2DCCA 2VHFA 1FH0A 3KSEA 3IEJA 2WBFX 2R9FA 3DF0A 4X6HA 1U9XA 4W4UA 1CV8A 4NV8A 4ZUXU 1PPDA 4P6EA 3AI8A 3I06A 2HH5A 3P5XA 2DCBA 1THEA 1MHWA 4BS6A 4QRXA 1SP4B 3V6EA 2PNSA 2G8EA 1CS8A 3N3KA 3KKUA 1U5IA 2NQIA 1EF7A 5PADA 4BGFA 4XR7A 5A24A 3S3RA 4I04A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AIM A;  1GEC E;  4X6I A;  2E01 A;  3HWN A;  3USV A;  4QH6 A;  1GCB A;  2GFO A;  4MZO A;  4WA6 A;  4KLB A;  2HXZ A;  3BPF A;  3KWB X;  3S3Q A;  1KHP A;  1MS6 A;  1M6D A;  4PP1 A;  4XUI A;  2AUZ A;  4YYS A;  1EWM A;  4OEL A;  3PBH A;  2JQF R;  2FO5 A;  1VSN A;  2AYN A;  3C9E A;  3PNR A;  5J94 A;  3RVX A;  1AYV A;  1X9Y A;  1BP4 A;  4OEM A;  3IUT A;  2G7Y A;  2F7D A;  3IHP A;  1GLO A;  2OUL A;  3MHS A;  1EWO A;  1F2A A;  3HHA A;  3IV2 A;  1PPP A;  1A6R A;  1F2B A;  2Y5B A;  2AYO A;  1STF E;  3RVW A;  1XKG A;  2FRA A;  2DZY A;  4FK5 A;  3BWK A;  1Y08 A;  3V6C A;  4G54 A;  1TLO A;  3D6S A;  1MDW A;  2P86 A;  3H6S A;  3K8U A;  4QRG A;  4FIP A;  1DEU A;  1AEC A;  2FTD A;  4PP2 E;  3IOQ A;  2ARY A;  4HWY A;  3O1G A;  3WXE A;  1CB5 A;  1YT7 A;  3KW9 A;  4CDD B;  1YAL A;  2R6N A;  3P5W A;  1BY8 A;  2B1M A;  3E1Z B;  1ZIV A;  1KFX L;  1VJV A;  2P7U A;  1YK8 A;  3BCN A;  1U9W A;  4I05 A;  4MZS A;  2YJ8 A;  2AU1 A;  2HD5 A;  3P5V A;  1NLJ A;  1TL9 A;  5EGW A;  2BDZ A;  2BDL A;  1CVZ A;  1U9V A;  2OZ2 A;  3BPM A;  2HHN A;  3U8E A;  4QRV A;  2NQA A;  3BC3 A;  1BQI A;  1PIP A;  4YYU A;  1MIR A;  1SNK A;  2O6X A;  4P6G A;  2NQD B;  2G8J A;  1PXV A;  2E00 A;  1JQP A;  1BGO A;  3GCB A;  3OVX A;  1O0E A;  2R9O A;  5EF4 A;  2XU4 A;  2PBH A;  4AXL A;  3KFQ A;  2FYE A;  3BOW A;  3KX1 A;  9PAP A;  3HHI A;  3OIS A;  3CBK A;  2ATO A;  3F75 A;  3B79 A;  5CVN B;  1QOL A;  3ERV A;  3LXS A;  3NHE A;  1MEM A;  3LFY A;  2AS8 A;  2DCA A;  1PBH A;  1ITO A;  5FPW A;  2NQG A;  1U9Q X;  1CTE A;  2FT2 A;  1ATK A;  3P5U A;  3CBJ A;  4YYV A;  1HUC B;  3IMA A;  5CHV A;  4BPV A;  4BSQ A;  4DMX A;  3N4C A;  5JA7 A;  2GHU A;  1ME3 A;  1QXP A;  1NPZ A;  3MOR A;  3OF9 A;  1EWP A;  1POP A;  6PAD A;  4BS5 A;  4N8W A;  2H7J A;  5JH3 A;  1YK7 A;  4I07 A;  4YV8 A;  1QMY A;  1F2C A;  4W5B A;  4RY2 A;  1NQC A;  2DC9 A;  1CPJ A;  2G6D A;  4W5C A;  1AU2 A;  2XU5 A;  1AU0 A;  1ICF A;  4YYW A;  5CHT A;  2DC8 A;  4CDF B;  2PRE A;  1MEG A;  1CQD A;  1PCI A;  3RVV A;  1KFU L;  2XU3 A;  3KWZ A;  2C0Y A;  3O0U A;  3HD3 A;  2P0R A;  2YJB A;  2ACT A;  3H8B A;  3OVZ A;  2OP3 A;  4CZW A;  2DCD A;  3MTN A;  7PCK A;  5K16 A;  3K9M A;  3PW3 A;  1DF0 A;  1K3B B;  1KXR A;  1AU3 A;  3N3G A;  3PDF A;  4AXM A;  1QDQ A;  1TU6 A;  5F02 A;  2VHS A;  3F5V A;  3WXG A;  1F29 A;  4FJC A;  4CDE B;  3I3T A;  4BQV A;  2JQG R;  2AUX A;  2IPP B;  2FQ9 A;  2XU1 A;  2DZZ A;  2PAD A;  1NL6 A;  3QJ3 A;  3CH2 X;  3OF8 A;  1PPO A;  4X6J A;  2DC7 A;  1AYW A;  3MHH A;  2R9C A;  1CSB B;  2E02 A;  1AYU A;  2DJF B;  3H8C A;  1Y4H A;  3WXF A;  1IWD A;  3CH3 X;  2F1G A;  2AVW A;  3ZUA A;  4QBB A;  1ZCM A;  1PPN A;  4Q8G A;  4YYQ A;  2DJG B;  2AIM A;  3M99 A;  1Q6K A;  2CB5 A;  4K7C A;  4PAD A;  1NB3 A;  1NB5 A;  2FUD A;  3QSD A;  4Q8H A;  1YVB A;  2YJ9 A;  4YVA A;  4DMY A;  3H89 A;  4CDC B;  2IBI A;  2CIO A;  3TNX A;  1AU4 A;  2E03 A;  1GMY A;  1PAD A;  1CJL A;  4MSX A;  4N79 A;  3QT4 A;  1PE6 A;  1EWL A;  5CVM A;  2Y6E A;  1KHQ A;  2B1N A;  8PCH A;  2R9N A;  5CVO B;  2DC6 A;  2R9M A;  4N4Z A;  2YJ2 A;  2YJC A;  1S4V A;  1ME4 A;  3K24 A;  2FRQ A;  4YYR A;  4PI3 A;  3H7D A;  2DCC A;  2VHF A;  1FH0 A;  3KSE A;  3IEJ A;  2WBF X;  2R9F A;  3DF0 A;  4X6H A;  1U9X A;  4W4U A;  1CV8 A;  4ZUX U;  1PPD A;  4P6E A;  3AI8 A;  3I06 A;  2HH5 A;  3P5X A;  2DCB A;  1THE A;  1MHW A;  4BS6 A;  4QRX A;  1SP4 B;  3V6E A;  2PNS A;  2G8E A;  1CS8 A;  3N3K A;  3KKU A;  1U5I A;  2NQI A;  1EF7 A;  5PAD A;  4XR7 A;  5A24 A;  3S3R A;  4I04 A; 
#chains in the Genus database with same CATH topology
 1AIM A;  1GEC E;  4X6I A;  2E01 A;  3HWN A;  3USV A;  4QH6 A;  1GCB A;  2GFO A;  4MZO A;  4WA6 A;  3PHX A;  4KLB A;  2HXZ A;  3BPF A;  3KWB X;  3S3Q A;  1KHP A;  1MS6 A;  1M6D A;  4PP1 A;  4XUI A;  4WUR A;  2AUZ A;  4YYS A;  1EWM A;  4OEL A;  4BOP A;  3PBH A;  2JQF R;  2FO5 A;  3W30 A;  3MTV A;  1VSN A;  2AYN A;  3C9E A;  3PNR A;  5J94 A;  3RVX A;  1AYV A;  3W31 A;  1X9Y A;  1YZB A;  1BP4 A;  2FE8 A;  2AGA A;  4OEM A;  3IUT A;  2G7Y A;  2F7D A;  3IHP A;  1GLO A;  2OUL A;  3MHS A;  1EWO A;  1F2A A;  2BU3 A;  3HHA A;  3IV2 A;  1PPP A;  1A6R A;  1F2B A;  2Y5B A;  2AYO A;  1STF E;  3RVW A;  1XKG A;  2FRA A;  3E9S A;  2DZY A;  5KO3 A;  4FK5 A;  3BWK A;  1Y08 A;  3V6C A;  4G54 A;  1TLO A;  3D6S A;  1MDW A;  2P86 A;  3H6S A;  3K8U A;  4QRG A;  4MI7 A;  4XZX A;  4FIP A;  1DEU A;  1AEC A;  2FTD A;  4PP2 E;  3IOQ A;  2ARY A;  4HWY A;  3O1G A;  3WXE A;  4GUA A;  4M0W A;  1CB5 A;  5EZQ A;  1YT7 A;  1PVJ A;  3KW9 A;  4CDD B;  1YAL A;  2R6N A;  3B21 A;  4OVZ A;  3P5W A;  1BY8 A;  2J7Q C;  2B1M A;  3E1Z B;  1ZIV A;  1KFX L;  1VJV A;  2P7U A;  1YK8 A;  3BCN A;  1U9W A;  4I05 A;  3ZNH A;  3MJ5 A;  4MZS A;  2YJ8 A;  2AU1 A;  2HD5 A;  3P5V A;  1NLJ A;  1TL9 A;  5EGW A;  2BDZ A;  2BDL A;  1CVZ A;  1U9V A;  2OZ2 A;  3BPM A;  2HHN A;  4RKX A;  3U8E A;  4QRV A;  2NQA A;  3BC3 A;  4P16 A;  3OQC A;  1BQI A;  1PIP A;  4YYU A;  1MIR A;  2JTC A;  1SNK A;  2BTW A;  2O6X A;  4P6G A;  2NQD B;  2G8J A;  1PXV A;  2E00 A;  3TMP A;  1JQP A;  1BGO A;  3GCB A;  3OVX A;  1O0E A;  2R9O A;  5EF4 A;  2XU4 A;  5JZE A;  2PBH A;  4AXL A;  3KFQ A;  2FYE A;  3C0R A;  3BOW A;  3KX1 A;  9PAP A;  3HHI A;  3OIS A;  4RF1 A;  3CBK A;  2ATO A;  3RNV A;  3F75 A;  3B79 A;  5CVN B;  1QOL A;  3ERV A;  3LXS A;  3NHE A;  4OW0 A;  1MEM A;  3LFY A;  2AS8 A;  2DCA A;  1PBH A;  3BB7 A;  1ITO A;  5FPW A;  2NQG A;  1U9Q X;  1CTE A;  4D8I A;  4RNA A;  2FT2 A;  1ATK A;  3P5U A;  3CBJ A;  4YYV A;  1HUC B;  3IMA A;  5CHV A;  4BPV A;  4BSQ A;  3MP2 A;  4DMX A;  3N4C A;  4BOZ A;  5JA7 A;  2GHU A;  1ME3 A;  1QXP A;  4R3D A;  1NPZ A;  3MOR A;  3OF9 A;  1EWP A;  1POP A;  6PAD A;  4BOQ A;  4BS5 A;  4N8W A;  2H7J A;  5JH3 A;  4A5U A;  1YK7 A;  4I07 A;  4YV8 A;  1QMY A;  1F2C A;  4W5B A;  4RY2 A;  1NQC A;  2DC9 A;  4BOS A;  3PSE A;  1CPJ A;  2G6D A;  4OVZ B;  4W5C A;  1AU2 A;  2XU5 A;  1AU0 A;  1ICF A;  4YYW A;  5CHT A;  2DC8 A;  4CDF B;  2PRE A;  1MEG A;  1CQD A;  1PCI A;  3RVV A;  1KFU L;  2XU3 A;  3KWZ A;  2C0Y A;  2Z84 A;  2HWK A;  3O0U A;  3HD3 A;  2P0R A;  2YJB A;  2ACT A;  5EZS A;  3H8B A;  3OVZ A;  2OP3 A;  3BBA A;  4CZW A;  2DCD A;  4ZTB A;  3MTN A;  7PCK A;  3PRP A;  5K16 A;  3K9M A;  2JRI A;  3PW3 A;  1DF0 A;  1K3B B;  1KXR A;  3N3G A;  3PDF A;  4AXM A;  1QDQ A;  1TU6 A;  5F02 A;  2VHS A;  3F5V A;  3PRM A;  1UKF A;  2BTW B;  1DKI A;  3WXG A;  1F29 A;  4FJC A;  4CDE B;  3I3T A;  4BQV A;  2JQG R;  2AUX A;  2IPP B;  2FQ9 A;  2XU1 A;  2DZZ A;  2PAD A;  1NL6 A;  3PT2 A;  3QJ3 A;  3CH2 X;  3OF8 A;  3PHU A;  1PPO A;  4X6J A;  2DC7 A;  1AYW A;  3MHH A;  2R9C A;  3IFU A;  1CSB B;  2E02 A;  1AYU A;  2DJF B;  4D8B A;  2J7Q A;  3H8C A;  1Y4H A;  3WXF A;  1IWD A;  3CH3 X;  2F1G A;  2AVW A;  4IUM A;  3ZUA A;  4MM3 B;  4QBB A;  1ZCM A;  1PPN A;  4Q8G A;  2DOS A;  4YYQ A;  2DJG B;  2AIM A;  3M99 A;  1Q6K A;  2CB5 A;  4K7C A;  4PAD A;  1NB3 A;  1NB5 A;  4IP3 A;  2FUD A;  3QSD A;  4Q8H A;  1YVB A;  2YJ9 A;  3O65 A;  4YVA A;  4DMY A;  3H89 A;  4CDC B;  2IBI A;  2CIO A;  5E6J A;  3TNX A;  1AU4 A;  3BY4 A;  2E03 A;  1GMY A;  1PAD A;  1CJL A;  4MSX A;  4N79 A;  3QT4 A;  1PE6 A;  1EWL A;  5CVM A;  2Y6E A;  1KHQ A;  2B1N A;  8PCH A;  2R9N A;  5CVO B;  2DC6 A;  2R9M A;  4N4Z A;  4BOU A;  2YJ2 A;  2YJC A;  1S4V A;  3PHW A;  1ME4 A;  3K24 A;  4PT5 A;  2FRQ A;  4YYR A;  4HXD B;  4PI3 A;  4REZ A;  3H7D A;  4RF0 A;  2DCC A;  2VHF A;  1FH0 A;  3KSE A;  4I04 A;  3IEJ A;  2WBF X;  2R9F A;  3DF0 A;  4X6H A;  1U9X A;  4W4U A;  1CV8 A;  4ZUX U;  1PPD A;  4P6E A;  4D8E A;  3AI8 A;  3I06 A;  2HH5 A;  3TRK A;  3P5X A;  2DCB A;  1THE A;  1MHW A;  4BS6 A;  4QRX A;  1SP4 B;  3V6E A;  2PNS A;  2G8E A;  1CS8 A;  3N3K A;  3KKU A;  1U5I A;  2NQI A;  1EF7 A;  2UZJ A;  5PAD A;  4XR7 A;  5A24 A;  3S3R A;  1AU3 A; 
#chains in the Genus database with same CATH homology
 1AIM A;  1GEC E;  4X6I A;  2E01 A;  3HWN A;  3USV A;  4QH6 A;  1GCB A;  2GFO A;  4MZO A;  4WA6 A;  4KLB A;  2HXZ A;  3BPF A;  3KWB X;  3S3Q A;  1KHP A;  1MS6 A;  1M6D A;  4PP1 A;  4XUI A;  2AUZ A;  4YYS A;  1EWM A;  4OEL A;  3PBH A;  2JQF R;  2FO5 A;  1VSN A;  2AYN A;  3C9E A;  3PNR A;  5J94 A;  3RVX A;  1AYV A;  1X9Y A;  1BP4 A;  4OEM A;  3IUT A;  2G7Y A;  2F7D A;  3IHP A;  4NV7 A;  1GLO A;  2OUL A;  3MHS A;  1EWO A;  1F2A A;  3HHA A;  3IV2 A;  1PPP A;  1A6R A;  1F2B A;  2Y5B A;  2AYO A;  1STF E;  3RVW A;  1XKG A;  2FRA A;  2DZY A;  4FK5 A;  3BWK A;  1Y08 A;  3V6C A;  4G54 A;  1TLO A;  3D6S A;  1MDW A;  2P86 A;  3H6S A;  3K8U A;  4QRG A;  4FIP A;  1DEU A;  1AEC A;  2FTD A;  4PP2 E;  3IOQ A;  2ARY A;  4HWY A;  3O1G A;  3WXE A;  1CB5 A;  1YT7 A;  3KW9 A;  1W6F A;  4CDD B;  1YAL A;  2R6N A;  3P5W A;  1BY8 A;  2B1M A;  3E1Z B;  1ZIV A;  1KFX L;  1VJV A;  2P7U A;  1YK8 A;  3BCN A;  1U9W A;  4I05 A;  4MZS A;  1W5R A;  2YJ8 A;  2AU1 A;  2HD5 A;  3P5V A;  1NLJ A;  1TL9 A;  5EGW A;  2BDZ A;  2BDL A;  1CVZ A;  1U9V A;  2OZ2 A;  3BPM A;  2HHN A;  3U8E A;  4QRV A;  2NQA A;  3BC3 A;  1BQI A;  1PIP A;  4YYU A;  1MIR A;  1SNK A;  2O6X A;  4P6G A;  2NQD B;  2G8J A;  1PXV A;  2E00 A;  1JQP A;  1BGO A;  3GCB A;  3OVX A;  1O0E A;  2R9O A;  5EF4 A;  2XU4 A;  2PBH A;  4AXL A;  3KFQ A;  2FYE A;  3BOW A;  3KX1 A;  9PAP A;  3HHI A;  4GUZ A;  3OIS A;  3CBK A;  2ATO A;  3F75 A;  3B79 A;  5CVN B;  1QOL A;  3ERV A;  3LXS A;  3NHE A;  1MEM A;  3LFY A;  2AS8 A;  2DCA A;  1PBH A;  1ITO A;  5FPW A;  2NQG A;  1U9Q X;  1CTE A;  2FT2 A;  1ATK A;  3P5U A;  3CBJ A;  4YYV A;  1HUC B;  3IMA A;  5CHV A;  4BPV A;  4BSQ A;  4DMX A;  3N4C A;  5JA7 A;  2GHU A;  1ME3 A;  1QXP A;  1NPZ A;  3MOR A;  3OF9 A;  1EWP A;  1POP A;  6PAD A;  4BS5 A;  4N8W A;  2H7J A;  5JH3 A;  1YK7 A;  4I07 A;  4YV8 A;  1QMY A;  1F2C A;  4W5B A;  4RY2 A;  1NQC A;  2DC9 A;  1CPJ A;  2G6D A;  4W5C A;  1AU2 A;  2XU5 A;  1AU0 A;  1ICF A;  4YYW A;  5CHT A;  2DC8 A;  4CDF B;  4B55 A;  2PRE A;  3LTW A;  1MEG A;  1CQD A;  1PCI A;  3RVV A;  1KFU L;  2XU3 A;  1GX3 A;  3KWZ A;  2C0Y A;  3O0U A;  3HD3 A;  2P0R A;  2YJB A;  2ACT A;  3H8B A;  3OVZ A;  4C5P A;  2OP3 A;  4CZW A;  2DCD A;  3MTN A;  7PCK A;  5K16 A;  3K9M A;  3PW3 A;  1DF0 A;  1K3B B;  1KXR A;  1AU3 A;  3N3G A;  3PDF A;  4AXM A;  1QDQ A;  1TU6 A;  3D9W A;  5F02 A;  2VHS A;  3F5V A;  2VFC A;  1E2T A;  3WXG A;  1F29 A;  4FJC A;  4CDE B;  3I3T A;  4BQV A;  2JQG R;  2AUX A;  2IPP B;  2FQ9 A;  2XU1 A;  2DZZ A;  2PAD A;  1NL6 A;  3QJ3 A;  3CH2 X;  3OF8 A;  1PPO A;  4X6J A;  2DC7 A;  1AYW A;  3MHH A;  2R9C A;  1CSB B;  2E02 A;  1AYU A;  2DJF B;  3H8C A;  1Y4H A;  3WXF A;  1IWD A;  3CH3 X;  2F1G A;  2BSZ A;  2AVW A;  3ZUA A;  4QBB A;  1ZCM A;  1PPN A;  4Q8G A;  4YYQ A;  2DJG B;  2AIM A;  3M99 A;  1Q6K A;  2CB5 A;  4K7C A;  4PAD A;  1NB3 A;  1NB5 A;  2FUD A;  3QSD A;  4Q8H A;  1YVB A;  2YJ9 A;  4YVA A;  4DMY A;  3H89 A;  4CDC B;  2IBI A;  2CIO A;  3TNX A;  1AU4 A;  2E03 A;  1GMY A;  1PAD A;  1CJL A;  4MSX A;  4N79 A;  3QT4 A;  1PE6 A;  1EWL A;  5CVM A;  2VFB A;  2Y6E A;  1KHQ A;  2B1N A;  8PCH A;  2R9N A;  5CVO B;  2DC6 A;  2R9M A;  4N4Z A;  2YJ2 A;  1W4T A;  2YJC A;  1S4V A;  1ME4 A;  3K24 A;  2FRQ A;  4YYR A;  4PI3 A;  3H7D A;  2DCC A;  2VHF A;  1FH0 A;  3KSE A;  3IEJ A;  2WBF X;  2R9F A;  3DF0 A;  4X6H A;  1U9X A;  4W4U A;  1CV8 A;  4NV8 A;  4ZUX U;  1PPD A;  4P6E A;  3AI8 A;  3I06 A;  2HH5 A;  3P5X A;  2DCB A;  1THE A;  1MHW A;  4BS6 A;  4QRX A;  1SP4 B;  3V6E A;  2PNS A;  2G8E A;  1CS8 A;  3N3K A;  3KKU A;  1U5I A;  2NQI A;  1EF7 A;  5PAD A;  4BGF A;  4XR7 A;  5A24 A;  3S3R A;  4I04 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...