4CDDB

Human dpp1 in complex with (2s)-n-((1s)-1-cyano-2-(4-(4-cyanophenyl) phenyl)ethyl)piperidine-2-carboxamide
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
162
structure length
162
Chain Sequence
HLPTSWDWRNVHGINFVSPVRNQASCGSCYSFASMGMLEARIRILTNNSQTPILSPQEVVSCSQYAQGCEGGFPYLIAGKYAQDFGLVEEACFPYTGTDSPCKMKEDCFRYYSSEYHYVGGFYGGCNEALMKLELVHHGPMAVAFEVYDDFLHYKKGIYHHT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords DIPEPTIDYL PEPTIDASE 1 EXCLUSION DOMAIN CHAIN
publication title Cathepsin C Inhibitors: Property Optimization and Identification of a Clinical Candidate.
pubmed doi rcsb
source organism Homo sapiens
total genus 42
structure length 162
sequence length 162
chains with identical sequence E
ec nomenclature ec 3.4.14.1: Dipeptidyl-peptidase I.
pdb deposition date 2013-10-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 4cddB01
3KX1A 3MHSA 3WXFA 1MIRA 1AYWA 1PPNA 1YALA 2FYEA 2P0RA 3TNXA 4I07A 4DMYA 3PNRA 4X6IA 4HWYA 3HHAA 2DCCA 2B1MA 2P86A 4FIPA 4I04A 3F75A 2OP3A 1U9XA 3C9EA 3IHPA 1AYUA 3D6SA 4CDDB 4PADA 1NL6A 2FTDA 2AYOA 1O0EA 3K8UA 5EGWA 2PBHA 1NB5A 1KHPA 2Y6EA 2F1GA 2IBIA 3LFYA 4PP2E 3OISA 4MZOA 2DJGB 3B79A 8PCHA 4FJCA 3ERVA 3QSDA 4W5CA 4QRGA 2AYNA 2HXZA 1NQCA 1KFXL 2AS8A 2B1NA 2DCBA 1AECA 4BS5A 2NQAA 3CBJA 4YYWA 1YK7A 1U5IA 3HWNA 3HD3A 3S3QA 2BDLA 4N8WA 1CB5A 3BPMA 4AXMA 1PADA 1ICFA 4CZWA 2G7YA 1EWOA 2YJBA 6PADA 2FT2A 1EWMA 4PI3A 3P5WA 2DJFB 2FUDA 2XU5A 3KSEA 1U9WA 1STFE 1F2BA 4Q8GA 3KWBX 1AIMA 4G54A 1CPJA 2YJ8A 1PPOA 4P6GA 3H6SA 4Q8HA 3GCBA 5CHTA 4YYSA 3F5VA 3E1ZB 3N3GA 1MEGA 1K3BB 2HHNA 1PXVA 4I05A 3O0UA 2YJCA 4YV8A 1GMYA 1GECE 3S3RA 3CH3X 5CVNB 1KFUL 1PPDA 2HH5A 2IPPB 5PADA 3QJ3A 2FRAA 2G6DA 1YVBA 2Y5BA 2DZYA 3BPFA 5JH3A 2NQDB 4YVAA 3BCNA 3RVWA 1POPA 3MTNA 1U9QX 5A24A 3V6EA 9PAPA 1QOLA 1X9YA 1HUCB 3DF0A 3PW3A 2AVWA 2AIMA 1CV8A 1PPPA 1AU0A 5FPWA 3U8EA 1BGOA 2C0YA 4P6EA 2ACTA 2R9FA 3MHHA 4QBBA 4BPVA 1KXRA 1S4VA 1M6DA 1NPZA 4W5BA 2ATOA 3H7DA 1SNKA 3BWKA 3WXEA 1YT7A 4XUIA 5JA7A 3PDFA 5F02A 2PADA 4MSXA 4FK5A 1BP4A 4RY2A 1CQDA 4KLBA 3H8CA 4QRVA 2CIOA 1AYVA 3IEJA 2F7DA 1ITOA 2DCAA 2VHSA 1AU3A 4X6HA 2HD5A 1AU4A 4CDFB 2YJ2A 3RVVA 3OVXA 3ZUAA 5CVMA 3OVZA 2BDZA 1MEMA 1EWPA 1VSNA 2XU3A 1TU6A 2XU1A 2DZZA 2R9CA 1XKGA 3KKUA 2O6XA 4OELA 3RVXA 1AU2A 4QH6A 5CHVA 2DCDA 3H89A 4K7CA 1MHWA 1MDWA 2H7JA 2ARYA 1Y08A 2E02A 1VJVA 4WA6A 3H8BA 1ME4A 1PBHA 1IWDA 1ZIVA 3I06A 4BQVA 4PP1A 3V6CA 1GLOA 1F2AA 4XR7A 3I3TA 2PNSA 1Y4HA 3P5UA 5EF4A 2WBFX 1QMYA 1ZCMA 3IV2A 2GFOA 1CTEA 4X6JA 1DEUA 2G8JA 2DC8A 3KW9A 3HHIA 3OF8A 3N3KA 1ME3A 3WXGA 4N79A 1TLOA 2AU1A 1CJLA 2AUXA 2E01A 4YYQA 3CH2X 3QT4A 4BS6A 4DMXA 2DC9A 1BY8A 2G8EA 2NQIA 4OEMA 2DC7A 1Q6KA 4CDEB 3K24A 1EF7A 2VHFA 3AI8A 2JQFR 4ZUXU 1SP4B 4YYVA 4YYUA 1A6RA 2NQGA 4QRXA 3IUTA 3PBHA 3M99A 1YK8A 3IOQA 5J94A 3CBKA 1CSBB 1CVZA 4BSQA 1NB3A 2YJ9A 1FH0A 3K9MA 2PREA 2R9OA 3NHEA 1ATKA 4MZSA 2OZ2A 4N4ZA 4YYRA 1QXPA 1EWLA 1GCBA 2GHUA 2CB5A 3KWZA 3O1GA 1F29A 1THEA 3MORA 3OF9A 2R9NA 4AXLA 3N4CA 1PIPA 2P7UA 2FQ9A 3BOWA 1DF0A 3LXSA 2OULA 2DC6A 1PE6A 3IMAA 2E03A 1TL9A 5CVOB 1BQIA 2R9MA 2E00A 1NLJA 5K16A 3BC3A 4W4UA 2R6NA 1F2CA 4CDCB 1U9VA 2AUZA 1KHQA 3P5VA 1PCIA 3USVA 2XU4A 2FRQA 1MS6A 1QDQA 3KFQA 7PCKA 2FO5A 2JQGR 1CS8A 3P5XA 1JQPA
chains in the Genus database with same CATH superfamily
3KX1A 3MHSA 3WXFA 1MIRA 1AYWA 1PPNA 1YALA 4RNAA 2FYEA 2P0RA 3TNXA 4I07A 4DMYA 1YZBA 3PNRA 4X6IA 4HWYA 3HHAA 2DCCA 3W31A 2B1MA 2P86A 4FIPA 4I04A 3BY4A 3F75A 2OP3A 1U9XA 3C9EA 3IHPA 4PT5A 1AYUA 3TRKA 3D6SA 4CDDB 4PADA 1NL6A 2FTDA 2AYOA 1O0EA 4BOSA 4A5UA 4IP3A 3K8UA 3ZNHA 5EGWA 2PBHA 2BTWB 1NB5A 4MM3B 4IUMA 1KHPA 2Y6EA 2F1GA 2IBIA 3LFYA 4BOQA 2J7QA 4PP2E 3PT2A 3OISA 4MZOA 2DJGB 5EZQA 3B79A 8PCHA 4FJCA 3ERVA 3QSDA 2J7QC 3BBAA 4W5CA 4QRGA 2AYNA 2HXZA 1NQCA 1KFXL 2AS8A 2B1NA 2DCBA 1AECA 4BS5A 2NQAA 2FE8A 3CBJA 4YYWA 3IFUA 1YK7A 1U5IA 3HWNA 2BU3A 3HD3A 3S3QA 2BDLA 4N8WA 2BTWA 1CB5A 3BPMA 4AXMA 1PADA 3PHXA 1ICFA 4CZWA 3C0RA 2G7YA 1EWOA 4BOUA 2AGAA 2YJBA 6PADA 2FT2A 1EWMA 4PI3A 3P5WA 2DJFB 2FUDA 2XU5A 3KSEA 1U9WA 3O65A 1STFE 1F2BA 2Z84A 4Q8GA 3KWBX 1AIMA 4G54A 1CPJA 3MP2A 2YJ8A 1PPOA 4P6GA 2HWKA 3H6SA 4Q8HA 3GCBA 5CHTA 4YYSA 3F5VA 3E1ZB 3N3GA 1MEGA 1K3BB 2HHNA 1PXVA 2JRIA 2UZJA 4I05A 3O0UA 3MJ5A 2YJCA 4YV8A 1GMYA 1GECE 3S3RA 3CH3X 5CVNB 1KFUL 1PPDA 3RNVA 2HH5A 2IPPB 5PADA 3QJ3A 2FRAA 2G6DA 1YVBA 2Y5BA 2DZYA 3BPFA 5JH3A 2NQDB 4YVAA 3BCNA 3RVWA 1POPA 3MTNA 1U9QX 5A24A 3V6EA 3W30A 3PHWA 9PAPA 1QOLA 1X9YA 1HUCB 3DF0A 3PW3A 2AVWA 2AIMA 1CV8A 1PPPA 1AU0A 5FPWA 4RKXA 3U8EA 1BGOA 2C0YA 4P6EA 2ACTA 2R9FA 3MHHA 4QBBA 4BPVA 1KXRA 1S4VA 1M6DA 1NPZA 4W5BA 2ATOA 3H7DA 3B21A 1SNKA 3BWKA 3WXEA 1YT7A 4XUIA 5JA7A 3PDFA 5F02A 2PADA 4MSXA 4FK5A 1BP4A 4RY2A 1CQDA 4KLBA 3PHUA 3H8CA 4QRVA 2DOSA 2CIOA 1AYVA 3IEJA 2F7DA 1ITOA 2DCAA 2VHSA 4RF1A 3PRMA 1AU3A 3E9SA 4X6HA 2HD5A 1AU4A 4CDFB 2YJ2A 3RVVA 3OVXA 3ZUAA 3PSEA 5CVMA 3OVZA 2BDZA 4XZXA 1MEMA 1EWPA 4HXDB 1VSNA 2XU3A 1TU6A 2XU1A 2DZZA 2R9CA 1XKGA 3KKUA 2O6XA 4OELA 3RVXA 2JTCA 1AU2A 4QH6A 5CHVA 2DCDA 3H89A 4K7CA 1MHWA 1MDWA 2H7JA 3BB7A 4R3DA 2ARYA 1Y08A 2E02A 1VJVA 4M0WA 4WA6A 3OQCA 3H8BA 1ME4A 1PBHA 1IWDA 1ZIVA 3I06A 4BQVA 4PP1A 4ZTBA 3V6CA 1GLOA 1F2AA 4XR7A 3I3TA 2PNSA 1Y4HA 3P5UA 5EF4A 2WBFX 1QMYA 1ZCMA 3IV2A 1PVJA 2GFOA 1CTEA 4MI7A 4X6JA 1DEUA 2G8JA 2DC8A 3KW9A 3HHIA 3OF8A 3N3KA 1ME3A 3WXGA 4N79A 1TLOA 2AU1A 1CJLA 4WURA 4P16A 3TMPA 2AUXA 2E01A 4YYQA 3CH2X 3QT4A 4BS6A 4REZA 4DMXA 2DC9A 1BY8A 1UKFA 2G8EA 5EZSA 2NQIA 4OEMA 2DC7A 1Q6KA 4CDEB 4OW0A 3K24A 1EF7A 2VHFA 3AI8A 2JQFR 4OVZB 1SP4B 4YYVA 4ZUXU 4YYUA 4D8EA 1A6RA 2NQGA 4QRXA 3IUTA 3PBHA 3M99A 1YK8A 4D8BA 3IOQA 5J94A 3CBKA 1CSBB 1CVZA 4BSQA 4GUAA 1NB3A 2YJ9A 1FH0A 3K9MA 2PREA 4D8IA 2R9OA 3NHEA 1ATKA 4MZSA 3MTVA 2OZ2A 4N4ZA 4YYRA 1QXPA 1EWLA 1GCBA 2GHUA 2CB5A 3KWZA 3O1GA 1F29A 1THEA 3MORA 3OF9A 2R9NA 5JZEA 4AXLA 3N4CA 1PIPA 2P7UA 2FQ9A 3BOWA 1DF0A 3LXSA 2OULA 1DKIA 2DC6A 1PE6A 3IMAA 2E03A 1TL9A 5CVOB 1BQIA 4BOPA 5KO3A 2R9MA 2E00A 4BOZA 4OVZA 1NLJA 5K16A 3BC3A 4W4UA 2R6NA 1F2CA 4CDCB 1U9VA 2AUZA 4RF0A 1KHQA 3P5VA 1PCIA 3USVA 2XU4A 2FRQA 1MS6A 1QDQA 3PRPA 3KFQA 7PCKA 2FO5A 2JQGR 1CS8A 5E6JA 3P5XA 1JQPA
chains in the Genus database with same CATH topology
3KX1A 3MHSA 3WXFA 1MIRA 1AYWA 1PPNA 1YALA 2FYEA 2BSZA 2P0RA 3TNXA 4I07A 4DMYA 3PNRA 4X6IA 4HWYA 3HHAA 2DCCA 2B1MA 2P86A 4FIPA 4I04A 3F75A 2OP3A 1U9XA 3C9EA 3IHPA 1AYUA 3D6SA 4CDDB 4PADA 1NL6A 2FTDA 2AYOA 1O0EA 3K8UA 5EGWA 2PBHA 1NB5A 1KHPA 2Y6EA 3LTWA 2F1GA 2IBIA 3LFYA 1W5RA 4PP2E 3OISA 4MZOA 2DJGB 3B79A 8PCHA 4FJCA 3ERVA 3QSDA 4W5CA 4QRGA 2AYNA 2HXZA 1NQCA 1KFXL 2AS8A 2B1NA 2DCBA 1AECA 4BS5A 2NQAA 3CBJA 4YYWA 1YK7A 1U5IA 3HWNA 3HD3A 3S3QA 2BDLA 4N8WA 1CB5A 3BPMA 3D9WA 4AXMA 1PADA 1ICFA 4CZWA 2G7YA 1EWOA 2YJBA 6PADA 2FT2A 1EWMA 4PI3A 3P5WA 2DJFB 2FUDA 2XU5A 3KSEA 1U9WA 1STFE 1F2BA 2VFBA 4Q8GA 3KWBX 1AIMA 4G54A 1CPJA 2YJ8A 1PPOA 4P6GA 3H6SA 4Q8HA 3GCBA 4B55A 5CHTA 4YYSA 3F5VA 3E1ZB 3N3GA 1MEGA 1K3BB 2HHNA 1PXVA 4I05A 3O0UA 2YJCA 4YV8A 1GMYA 1GECE 4C5PA 3S3RA 3CH3X 5CVNB 1KFUL 1PPDA 2HH5A 2IPPB 5PADA 3QJ3A 2FRAA 2G6DA 1YVBA 2Y5BA 2DZYA 3BPFA 5JH3A 2NQDB 4YVAA 3BCNA 3RVWA 1POPA 3MTNA 1U9QX 5A24A 3V6EA 9PAPA 1QOLA 1X9YA 1HUCB 3DF0A 3PW3A 2AVWA 2AIMA 1CV8A 1PPPA 1AU0A 5FPWA 1W6FA 3U8EA 1BGOA 2C0YA 4P6EA 2ACTA 2R9FA 3MHHA 4QBBA 4BPVA 1KXRA 1GX3A 1S4VA 1M6DA 1NPZA 4W5BA 2ATOA 3H7DA 1SNKA 3BWKA 3WXEA 1YT7A 4XUIA 5JA7A 4NV8A 3PDFA 5F02A 2PADA 4MSXA 4FK5A 1BP4A 4RY2A 1CQDA 4KLBA 4BGFA 3H8CA 4QRVA 2CIOA 1AYVA 3IEJA 2F7DA 1ITOA 2DCAA 2VHSA 1AU3A 4X6HA 2HD5A 1AU4A 4CDFB 2YJ2A 3RVVA 3OVXA 3ZUAA 5CVMA 3OVZA 2BDZA 1MEMA 1EWPA 4NV7A 1VSNA 2XU3A 1TU6A 2XU1A 2DZZA 2R9CA 1XKGA 3KKUA 2O6XA 4OELA 3RVXA 1AU2A 4QH6A 5CHVA 2DCDA 3H89A 4K7CA 1E2TA 1MHWA 1MDWA 2H7JA 2ARYA 1Y08A 2E02A 1VJVA 4GUZA 4WA6A 3H8BA 1ME4A 1PBHA 1IWDA 1ZIVA 3I06A 4BQVA 4PP1A 3V6CA 1GLOA 1F2AA 4XR7A 3I3TA 2PNSA 1Y4HA 3P5UA 5EF4A 2WBFX 1QMYA 1ZCMA 3IV2A 2GFOA 1CTEA 4X6JA 1DEUA 2G8JA 2DC8A 3KW9A 2VFCA 3HHIA 3OF8A 3N3KA 1ME3A 3WXGA 4N79A 1TLOA 2AU1A 1CJLA 2AUXA 2E01A 4YYQA 3CH2X 3QT4A 4BS6A 4DMXA 2DC9A 1BY8A 2G8EA 2NQIA 4OEMA 2DC7A 1Q6KA 4CDEB 3K24A 1EF7A 2VHFA 3AI8A 2JQFR 4ZUXU 1SP4B 4YYVA 4YYUA 1A6RA 2NQGA 4QRXA 3IUTA 3PBHA 3M99A 1YK8A 3IOQA 5J94A 3CBKA 1CSBB 1CVZA 4BSQA 1NB3A 2YJ9A 1FH0A 3K9MA 2PREA 2R9OA 3NHEA 1ATKA 4MZSA 2OZ2A 4N4ZA 4YYRA 1QXPA 1EWLA 1GCBA 2GHUA 2CB5A 3KWZA 3O1GA 1F29A 1THEA 3MORA 3OF9A 2R9NA 4AXLA 3N4CA 1PIPA 2P7UA 2FQ9A 3BOWA 1DF0A 3LXSA 2OULA 2DC6A 1PE6A 1W4TA 3IMAA 2E03A 1TL9A 5CVOB 1BQIA 2R9MA 2E00A 1NLJA 5K16A 3BC3A 4W4UA 2R6NA 1F2CA 4CDCB 1U9VA 2AUZA 1KHQA 3P5VA 1PCIA 3USVA 2XU4A 2FRQA 1MS6A 1QDQA 3KFQA 7PCKA 2FO5A 2JQGR 1CS8A 3P5XA 1JQPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KX1 A;  3MHS A;  3WXF A;  1MIR A;  1AYW A;  1PPN A;  1YAL A;  2FYE A;  2P0R A;  3TNX A;  4I07 A;  4DMY A;  3PNR A;  4X6I A;  4HWY A;  3HHA A;  2DCC A;  2B1M A;  2P86 A;  4FIP A;  4I04 A;  3F75 A;  2OP3 A;  1U9X A;  3C9E A;  3IHP A;  1AYU A;  3D6S A;  4CDD B;  4PAD A;  1NL6 A;  2FTD A;  2AYO A;  1O0E A;  3K8U A;  5EGW A;  2PBH A;  1NB5 A;  1KHP A;  2Y6E A;  2F1G A;  2IBI A;  3LFY A;  4PP2 E;  3OIS A;  4MZO A;  2DJG B;  3B79 A;  8PCH A;  4FJC A;  3ERV A;  3QSD A;  4W5C A;  4QRG A;  2AYN A;  2HXZ A;  1NQC A;  1KFX L;  2AS8 A;  2B1N A;  2DCB A;  1AEC A;  4BS5 A;  2NQA A;  3CBJ A;  4YYW A;  1YK7 A;  1U5I A;  3HWN A;  3HD3 A;  3S3Q A;  2BDL A;  4N8W A;  1CB5 A;  3BPM A;  4AXM A;  1PAD A;  1ICF A;  4CZW A;  2G7Y A;  1EWO A;  2YJB A;  6PAD A;  2FT2 A;  1EWM A;  4PI3 A;  3P5W A;  2DJF B;  2FUD A;  2XU5 A;  3KSE A;  1U9W A;  1STF E;  1F2B A;  4Q8G A;  3KWB X;  1AIM A;  4G54 A;  1CPJ A;  2YJ8 A;  1PPO A;  4P6G A;  3H6S A;  4Q8H A;  3GCB A;  5CHT A;  4YYS A;  3F5V A;  3E1Z B;  3N3G A;  1MEG A;  1K3B B;  2HHN A;  1PXV A;  4I05 A;  3O0U A;  2YJC A;  4YV8 A;  1GMY A;  1GEC E;  3S3R A;  3CH3 X;  5CVN B;  1KFU L;  1PPD A;  2HH5 A;  2IPP B;  5PAD A;  3QJ3 A;  2FRA A;  2G6D A;  1YVB A;  2Y5B A;  2DZY A;  3BPF A;  5JH3 A;  2NQD B;  4YVA A;  3BCN A;  3RVW A;  1POP A;  3MTN A;  1U9Q X;  5A24 A;  3V6E A;  9PAP A;  1QOL A;  1X9Y A;  1HUC B;  3DF0 A;  3PW3 A;  2AVW A;  2AIM A;  1CV8 A;  1PPP A;  1AU0 A;  5FPW A;  3U8E A;  1BGO A;  2C0Y A;  4P6E A;  2ACT A;  2R9F A;  3MHH A;  4QBB A;  4BPV A;  1KXR A;  1S4V A;  1M6D A;  1NPZ A;  4W5B A;  2ATO A;  3H7D A;  1SNK A;  3BWK A;  3WXE A;  1YT7 A;  4XUI A;  5JA7 A;  3PDF A;  5F02 A;  2PAD A;  4MSX A;  4FK5 A;  1BP4 A;  4RY2 A;  1CQD A;  4KLB A;  3H8C A;  4QRV A;  2CIO A;  1AYV A;  3IEJ A;  2F7D A;  1ITO A;  2DCA A;  2VHS A;  1AU3 A;  4X6H A;  2HD5 A;  1AU4 A;  4CDF B;  2YJ2 A;  3RVV A;  3OVX A;  3ZUA A;  5CVM A;  3OVZ A;  2BDZ A;  1MEM A;  1EWP A;  1VSN A;  2XU3 A;  1TU6 A;  2XU1 A;  2DZZ A;  2R9C A;  1XKG A;  3KKU A;  2O6X A;  4OEL A;  3RVX A;  1AU2 A;  4QH6 A;  5CHV A;  2DCD A;  3H89 A;  4K7C A;  1MHW A;  1MDW A;  2H7J A;  2ARY A;  1Y08 A;  2E02 A;  1VJV A;  4WA6 A;  3H8B A;  1ME4 A;  1PBH A;  1IWD A;  1ZIV A;  3I06 A;  4BQV A;  4PP1 A;  3V6C A;  1GLO A;  1F2A A;  4XR7 A;  3I3T A;  2PNS A;  1Y4H A;  3P5U A;  5EF4 A;  2WBF X;  1QMY A;  1ZCM A;  3IV2 A;  2GFO A;  1CTE A;  4X6J A;  1DEU A;  2G8J A;  2DC8 A;  3KW9 A;  3HHI A;  3OF8 A;  3N3K A;  1ME3 A;  3WXG A;  4N79 A;  1TLO A;  2AU1 A;  1CJL A;  2AUX A;  2E01 A;  4YYQ A;  3CH2 X;  3QT4 A;  4BS6 A;  4DMX A;  2DC9 A;  1BY8 A;  2G8E A;  2NQI A;  4OEM A;  2DC7 A;  1Q6K A;  4CDE B;  3K24 A;  1EF7 A;  2VHF A;  3AI8 A;  2JQF R;  4ZUX U;  1SP4 B;  4YYV A;  4YYU A;  1A6R A;  2NQG A;  4QRX A;  3IUT A;  3PBH A;  3M99 A;  1YK8 A;  3IOQ A;  5J94 A;  3CBK A;  1CSB B;  1CVZ A;  4BSQ A;  1NB3 A;  2YJ9 A;  1FH0 A;  3K9M A;  2PRE A;  2R9O A;  3NHE A;  1ATK A;  4MZS A;  2OZ2 A;  4N4Z A;  4YYR A;  1QXP A;  1EWL A;  1GCB A;  2GHU A;  2CB5 A;  3KWZ A;  3O1G A;  1F29 A;  1THE A;  3MOR A;  3OF9 A;  2R9N A;  4AXL A;  3N4C A;  1PIP A;  2P7U A;  2FQ9 A;  3BOW A;  1DF0 A;  3LXS A;  2OUL A;  2DC6 A;  1PE6 A;  3IMA A;  2E03 A;  1TL9 A;  5CVO B;  1BQI A;  2R9M A;  2E00 A;  1NLJ A;  5K16 A;  3BC3 A;  4W4U A;  2R6N A;  1F2C A;  4CDC B;  1U9V A;  2AUZ A;  1KHQ A;  3P5V A;  1PCI A;  3USV A;  2XU4 A;  2FRQ A;  1MS6 A;  1QDQ A;  3KFQ A;  7PCK A;  2FO5 A;  2JQG R;  1CS8 A;  3P5X A;  1JQP A; 
#chains in the Genus database with same CATH topology
 3KX1 A;  3MHS A;  3WXF A;  1MIR A;  1AYW A;  1PPN A;  1YAL A;  4RNA A;  2FYE A;  2P0R A;  3TNX A;  4I07 A;  4DMY A;  1YZB A;  3PNR A;  4X6I A;  4HWY A;  3HHA A;  2DCC A;  3W31 A;  2B1M A;  2P86 A;  4FIP A;  4I04 A;  3BY4 A;  3F75 A;  2OP3 A;  1U9X A;  3C9E A;  3IHP A;  4PT5 A;  1AYU A;  3TRK A;  3D6S A;  4CDD B;  4PAD A;  1NL6 A;  2FTD A;  2AYO A;  1O0E A;  4BOS A;  4A5U A;  4IP3 A;  3K8U A;  3ZNH A;  5EGW A;  2PBH A;  2BTW B;  1NB5 A;  4MM3 B;  4IUM A;  1KHP A;  2Y6E A;  2F1G A;  2IBI A;  3LFY A;  4BOQ A;  2J7Q A;  4PP2 E;  3PT2 A;  3OIS A;  4MZO A;  2DJG B;  5EZQ A;  3B79 A;  8PCH A;  4FJC A;  3ERV A;  3QSD A;  2J7Q C;  3BBA A;  4W5C A;  4QRG A;  2AYN A;  2HXZ A;  1NQC A;  1KFX L;  2AS8 A;  2B1N A;  2DCB A;  1AEC A;  4BS5 A;  2NQA A;  2FE8 A;  3CBJ A;  4YYW A;  3IFU A;  1YK7 A;  1U5I A;  3HWN A;  2BU3 A;  3HD3 A;  3S3Q A;  2BDL A;  4N8W A;  2BTW A;  1CB5 A;  3BPM A;  4AXM A;  1PAD A;  3PHX A;  1ICF A;  4CZW A;  3C0R A;  2G7Y A;  1EWO A;  4BOU A;  2AGA A;  2YJB A;  6PAD A;  2FT2 A;  1EWM A;  4PI3 A;  3P5W A;  2DJF B;  2FUD A;  2XU5 A;  3KSE A;  1U9W A;  3O65 A;  1STF E;  1F2B A;  2Z84 A;  4Q8G A;  3KWB X;  1AIM A;  4G54 A;  1CPJ A;  3MP2 A;  2YJ8 A;  1PPO A;  4P6G A;  2HWK A;  3H6S A;  4Q8H A;  3GCB A;  5CHT A;  4YYS A;  3F5V A;  3E1Z B;  3N3G A;  1MEG A;  1K3B B;  2HHN A;  1PXV A;  2JRI A;  2UZJ A;  4I05 A;  3O0U A;  3MJ5 A;  2YJC A;  4YV8 A;  1GMY A;  1GEC E;  3S3R A;  3CH3 X;  5CVN B;  1KFU L;  1PPD A;  3RNV A;  2HH5 A;  2IPP B;  5PAD A;  3QJ3 A;  2FRA A;  2G6D A;  1YVB A;  2Y5B A;  2DZY A;  3BPF A;  5JH3 A;  2NQD B;  4YVA A;  3BCN A;  3RVW A;  1POP A;  3MTN A;  1U9Q X;  5A24 A;  3V6E A;  3W30 A;  3PHW A;  9PAP A;  1QOL A;  1X9Y A;  1HUC B;  3DF0 A;  3PW3 A;  2AVW A;  2AIM A;  1CV8 A;  1PPP A;  1AU0 A;  5FPW A;  4RKX A;  3U8E A;  1BGO A;  2C0Y A;  4P6E A;  2ACT A;  2R9F A;  3MHH A;  4QBB A;  4BPV A;  1KXR A;  1S4V A;  1M6D A;  1NPZ A;  4W5B A;  2ATO A;  3H7D A;  3B21 A;  1SNK A;  3BWK A;  3WXE A;  1YT7 A;  4XUI A;  5JA7 A;  3PDF A;  5F02 A;  2PAD A;  4MSX A;  4FK5 A;  1BP4 A;  4RY2 A;  1CQD A;  4KLB A;  3PHU A;  3H8C A;  4QRV A;  2DOS A;  2CIO A;  1AYV A;  3IEJ A;  2F7D A;  1ITO A;  2DCA A;  2VHS A;  4RF1 A;  3PRM A;  1AU3 A;  3E9S A;  4X6H A;  2HD5 A;  1AU4 A;  4CDF B;  2YJ2 A;  3RVV A;  3OVX A;  3ZUA A;  3PSE A;  5CVM A;  3OVZ A;  2BDZ A;  4XZX A;  1MEM A;  1EWP A;  4HXD B;  1VSN A;  2XU3 A;  1TU6 A;  2XU1 A;  2DZZ A;  2R9C A;  1XKG A;  3KKU A;  2O6X A;  4OEL A;  3RVX A;  2JTC A;  1AU2 A;  4QH6 A;  5CHV A;  2DCD A;  3H89 A;  4K7C A;  1MHW A;  1MDW A;  2H7J A;  3BB7 A;  4R3D A;  2ARY A;  1Y08 A;  2E02 A;  1VJV A;  4M0W A;  4WA6 A;  3OQC A;  3H8B A;  1ME4 A;  1PBH A;  1IWD A;  1ZIV A;  3I06 A;  4BQV A;  4PP1 A;  4ZTB A;  3V6C A;  1GLO A;  1F2A A;  4XR7 A;  3I3T A;  2PNS A;  1Y4H A;  3P5U A;  5EF4 A;  2WBF X;  1QMY A;  1ZCM A;  3IV2 A;  1PVJ A;  2GFO A;  1CTE A;  4MI7 A;  4X6J A;  1DEU A;  2G8J A;  2DC8 A;  3KW9 A;  3HHI A;  3OF8 A;  3N3K A;  1ME3 A;  3WXG A;  4N79 A;  1TLO A;  2AU1 A;  1CJL A;  4WUR A;  4P16 A;  3TMP A;  2AUX A;  2E01 A;  4YYQ A;  3CH2 X;  3QT4 A;  4BS6 A;  4REZ A;  4DMX A;  2DC9 A;  1BY8 A;  1UKF A;  2G8E A;  5EZS A;  2NQI A;  4OEM A;  2DC7 A;  1Q6K A;  4CDE B;  4OW0 A;  3K24 A;  1EF7 A;  2VHF A;  3AI8 A;  2JQF R;  4OVZ B;  1SP4 B;  4YYV A;  4ZUX U;  4YYU A;  4D8E A;  1A6R A;  2NQG A;  4QRX A;  3IUT A;  3PBH A;  3M99 A;  1YK8 A;  4D8B A;  3IOQ A;  5J94 A;  3CBK A;  1CSB B;  1CVZ A;  4BSQ A;  4GUA A;  1NB3 A;  2YJ9 A;  1FH0 A;  3K9M A;  2PRE A;  4D8I A;  2R9O A;  3NHE A;  1ATK A;  4MZS A;  3MTV A;  2OZ2 A;  4N4Z A;  4YYR A;  1QXP A;  1EWL A;  1GCB A;  2GHU A;  2CB5 A;  3KWZ A;  3O1G A;  1F29 A;  1THE A;  3MOR A;  3OF9 A;  2R9N A;  5JZE A;  4AXL A;  3N4C A;  1PIP A;  2P7U A;  2FQ9 A;  3BOW A;  1DF0 A;  3LXS A;  2OUL A;  1DKI A;  2DC6 A;  1PE6 A;  3IMA A;  2E03 A;  1TL9 A;  5CVO B;  1BQI A;  4BOP A;  5KO3 A;  2R9M A;  2E00 A;  4BOZ A;  4OVZ A;  1NLJ A;  5K16 A;  3BC3 A;  4W4U A;  2R6N A;  1F2C A;  4CDC B;  1U9V A;  2AUZ A;  4RF0 A;  1KHQ A;  3P5V A;  1PCI A;  3USV A;  2XU4 A;  2FRQ A;  1MS6 A;  1QDQ A;  3PRP A;  3KFQ A;  7PCK A;  2FO5 A;  2JQG R;  1CS8 A;  5E6J A;  3P5X A;  1JQP A; 
#chains in the Genus database with same CATH homology
 3KX1 A;  3MHS A;  3WXF A;  1MIR A;  1AYW A;  1PPN A;  1YAL A;  2FYE A;  2BSZ A;  2P0R A;  3TNX A;  4I07 A;  4DMY A;  3PNR A;  4X6I A;  4HWY A;  3HHA A;  2DCC A;  2B1M A;  2P86 A;  4FIP A;  4I04 A;  3F75 A;  2OP3 A;  1U9X A;  3C9E A;  3IHP A;  1AYU A;  3D6S A;  4CDD B;  4PAD A;  1NL6 A;  2FTD A;  2AYO A;  1O0E A;  3K8U A;  5EGW A;  2PBH A;  1NB5 A;  1KHP A;  2Y6E A;  3LTW A;  2F1G A;  2IBI A;  3LFY A;  1W5R A;  4PP2 E;  3OIS A;  4MZO A;  2DJG B;  3B79 A;  8PCH A;  4FJC A;  3ERV A;  3QSD A;  4W5C A;  4QRG A;  2AYN A;  2HXZ A;  1NQC A;  1KFX L;  2AS8 A;  2B1N A;  2DCB A;  1AEC A;  4BS5 A;  2NQA A;  3CBJ A;  4YYW A;  1YK7 A;  1U5I A;  3HWN A;  3HD3 A;  3S3Q A;  2BDL A;  4N8W A;  1CB5 A;  3BPM A;  3D9W A;  4AXM A;  1PAD A;  1ICF A;  4CZW A;  2G7Y A;  1EWO A;  2YJB A;  6PAD A;  2FT2 A;  1EWM A;  4PI3 A;  3P5W A;  2DJF B;  2FUD A;  2XU5 A;  3KSE A;  1U9W A;  1STF E;  1F2B A;  2VFB A;  4Q8G A;  3KWB X;  1AIM A;  4G54 A;  1CPJ A;  2YJ8 A;  1PPO A;  4P6G A;  3H6S A;  4Q8H A;  3GCB A;  4B55 A;  5CHT A;  4YYS A;  3F5V A;  3E1Z B;  3N3G A;  1MEG A;  1K3B B;  2HHN A;  1PXV A;  4I05 A;  3O0U A;  2YJC A;  4YV8 A;  1GMY A;  1GEC E;  4C5P A;  3S3R A;  3CH3 X;  5CVN B;  1KFU L;  1PPD A;  2HH5 A;  2IPP B;  5PAD A;  3QJ3 A;  2FRA A;  2G6D A;  1YVB A;  2Y5B A;  2DZY A;  3BPF A;  5JH3 A;  2NQD B;  4YVA A;  3BCN A;  3RVW A;  1POP A;  3MTN A;  1U9Q X;  5A24 A;  3V6E A;  9PAP A;  1QOL A;  1X9Y A;  1HUC B;  3DF0 A;  3PW3 A;  2AVW A;  2AIM A;  1CV8 A;  1PPP A;  1AU0 A;  5FPW A;  1W6F A;  3U8E A;  1BGO A;  2C0Y A;  4P6E A;  2ACT A;  2R9F A;  3MHH A;  4QBB A;  4BPV A;  1KXR A;  1GX3 A;  1S4V A;  1M6D A;  1NPZ A;  4W5B A;  2ATO A;  3H7D A;  1SNK A;  3BWK A;  3WXE A;  1YT7 A;  4XUI A;  5JA7 A;  4NV8 A;  3PDF A;  5F02 A;  2PAD A;  4MSX A;  4FK5 A;  1BP4 A;  4RY2 A;  1CQD A;  4KLB A;  4BGF A;  3H8C A;  4QRV A;  2CIO A;  1AYV A;  3IEJ A;  2F7D A;  1ITO A;  2DCA A;  2VHS A;  1AU3 A;  4X6H A;  2HD5 A;  1AU4 A;  4CDF B;  2YJ2 A;  3RVV A;  3OVX A;  3ZUA A;  5CVM A;  3OVZ A;  2BDZ A;  1MEM A;  1EWP A;  4NV7 A;  1VSN A;  2XU3 A;  1TU6 A;  2XU1 A;  2DZZ A;  2R9C A;  1XKG A;  3KKU A;  2O6X A;  4OEL A;  3RVX A;  1AU2 A;  4QH6 A;  5CHV A;  2DCD A;  3H89 A;  4K7C A;  1E2T A;  1MHW A;  1MDW A;  2H7J A;  2ARY A;  1Y08 A;  2E02 A;  1VJV A;  4GUZ A;  4WA6 A;  3H8B A;  1ME4 A;  1PBH A;  1IWD A;  1ZIV A;  3I06 A;  4BQV A;  4PP1 A;  3V6C A;  1GLO A;  1F2A A;  4XR7 A;  3I3T A;  2PNS A;  1Y4H A;  3P5U A;  5EF4 A;  2WBF X;  1QMY A;  1ZCM A;  3IV2 A;  2GFO A;  1CTE A;  4X6J A;  1DEU A;  2G8J A;  2DC8 A;  3KW9 A;  2VFC A;  3HHI A;  3OF8 A;  3N3K A;  1ME3 A;  3WXG A;  4N79 A;  1TLO A;  2AU1 A;  1CJL A;  2AUX A;  2E01 A;  4YYQ A;  3CH2 X;  3QT4 A;  4BS6 A;  4DMX A;  2DC9 A;  1BY8 A;  2G8E A;  2NQI A;  4OEM A;  2DC7 A;  1Q6K A;  4CDE B;  3K24 A;  1EF7 A;  2VHF A;  3AI8 A;  2JQF R;  4ZUX U;  1SP4 B;  4YYV A;  4YYU A;  1A6R A;  2NQG A;  4QRX A;  3IUT A;  3PBH A;  3M99 A;  1YK8 A;  3IOQ A;  5J94 A;  3CBK A;  1CSB B;  1CVZ A;  4BSQ A;  1NB3 A;  2YJ9 A;  1FH0 A;  3K9M A;  2PRE A;  2R9O A;  3NHE A;  1ATK A;  4MZS A;  2OZ2 A;  4N4Z A;  4YYR A;  1QXP A;  1EWL A;  1GCB A;  2GHU A;  2CB5 A;  3KWZ A;  3O1G A;  1F29 A;  1THE A;  3MOR A;  3OF9 A;  2R9N A;  4AXL A;  3N4C A;  1PIP A;  2P7U A;  2FQ9 A;  3BOW A;  1DF0 A;  3LXS A;  2OUL A;  2DC6 A;  1PE6 A;  1W4T A;  3IMA A;  2E03 A;  1TL9 A;  5CVO B;  1BQI A;  2R9M A;  2E00 A;  1NLJ A;  5K16 A;  3BC3 A;  4W4U A;  2R6N A;  1F2C A;  4CDC B;  1U9V A;  2AUZ A;  1KHQ A;  3P5V A;  1PCI A;  3USV A;  2XU4 A;  2FRQ A;  1MS6 A;  1QDQ A;  3KFQ A;  7PCK A;  2FO5 A;  2JQG R;  1CS8 A;  3P5X A;  1JQP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...