1YK8A

Cathepsin k complexed with a cyanamide-based inhibitor
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
213
structure length
213
Chain Sequence
DSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Acyclic cyanamide-based inhibitors of cathepsin K.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Cathepsin K
total genus 62
structure length 213
sequence length 213
ec nomenclature ec 3.4.22.38: Cathepsin K.
pdb deposition date 2005-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1yk8A00
3IUTA 3BPFA 2OP3A 1F2AA 1U9QX 2NQGA 1Q6KA 2XU1A 2G8JA 5J94A 3KWZA 4OELA 1POPA 2G7YA 1MIRA 3KFQA 3U8EA 3K9MA 1AU2A 3V6CA 2FRQA 1BY8A 4CDDB 3H8CA 3C9EA 1F2CA 2O6XA 2PBHA 2FT2A 4DMYA 4PADA 1JQPA 3I3TA 3WXGA 2BDZA 1AU3A 2FO5A 3MORA 2B1MA 1PIPA 5FPWA 3OF9A 2FTDA 3ZUAA 1AYUA 2NQAA 3V6EA 4QBBA 2P0RA 4I04A 2YJCA 1U9XA 4AXMA 1MHWA 1EWMA 2AUXA 1KFUL 5CVOB 1EWOA 3RVWA 2R6NA 2P86A 4OEMA 4FK5A 3MHHA 1CB5A 4YYVA 2F1GA 3H89A 3TNXA 2DZYA 1GLOA 3BCNA 1NL6A 3OISA 3O0UA 1XKGA 2FYEA 1NB5A 1CS8A 1IWDA 3BOWA 2E01A 3QT4A 3PNRA 3BC3A 4CDCB 5CHVA 4BS6A 1NQCA 3CBKA 3QSDA 4AXLA 4FIPA 2DC9A 7PCKA 1YT7A 1THEA 4I07A 3MHSA 1EF7A 2ARYA 2AYNA 4QRXA 2DCBA 2E00A 3D6SA 2BDLA 2E03A 4XR7A 2AS8A 1CVZA 3F75A 3WXEA 5CHTA 3LXSA 2YJ9A 2AYOA 3E1ZB 2CIOA 3N3GA 2DJGB 2ATOA 2R9OA 1EWPA 2HXZA 2PADA 3K8UA 4N8WA 3S3RA 3H6SA 1U5IA 1GECE 2DC7A 1CJLA 3I06A 3RVXA 1PPPA 9PAPA 3QJ3A 1A6RA 1AECA 1QDQA 2OZ2A 2XU4A 3H7DA 3IMAA 4W5BA 3O1GA 4PI3A 3B79A 4I05A 3HHAA 1PPDA 1NLJA 1VSNA 3HHIA 2DC8A 4BPVA 2DCAA 3BPMA 1GCBA 3PW3A 2C0YA 3M99A 2OULA 5K16A 4ZUXU 1CV8A 4X6JA 2CB5A 1U9WA 2DCCA 4PP2E 3MTNA 2HHNA 1CQDA 1X9YA 2YJBA 3IV2A 2R9NA 3NHEA 2DZZA 5PADA 8PCHA 3CH3X 1SNKA 3USVA 5JH3A 1ZIVA 1AIMA 1CSBB 2YJ2A 3ERVA 1NPZA 2DCDA 1KHQA 4YYRA 1YK7A 1O0EA 2AVWA 5CVMA 1Y4HA 4BQVA 2R9FA 2ACTA 4YV8A 1AU4A 1TU6A 4BSQA 5JA7A 2DJFB 2FRAA 3KSEA 3F5VA 1KHPA 3P5UA 4KLBA 3K24A 2IBIA 2FUDA 4MZOA 1QMYA 1ME4A 5EGWA 2VHSA 3HD3A 1AYVA 1MEMA 4RY2A 1DF0A 1PADA 4YYWA 1GMYA 3GCBA 2R9MA 4P6GA 4HWYA 4Q8GA 2F7DA 3WXFA 2NQIA 1CPJA 2B1NA 3OF8A 4XUIA 1STFE 4X6IA 2R9CA 4Q8HA 3N3KA 1Y08A 2DC6A 2GFOA 1PE6A 1PBHA 2HD5A 1YALA 1F2BA 1AYWA 4YYUA 3OVZA 1TLOA 3LFYA 4W5CA 3IHPA 1MDWA 4W4UA 1DEUA 3BWKA 3DF0A 1KXRA 1KFXL 4MSXA 1CTEA 4G54A 2NQDB 3KX1A 5F02A 6PADA 1ITOA 3P5XA 4FJCA 3CBJA 4N4ZA 2XU5A 1YVBA 3S3QA 2H7JA 2JQFR 3PDFA 4PP1A 4N79A 4CDFB 4QH6A 1TL9A 1QOLA 5CVNB 1SP4B 3KKUA 3RVVA 1ME3A 2E02A 1ICFA 2FQ9A 4QRVA 3H8BA 3PBHA 2HH5A 2G8EA 1MEGA 3P5VA 4DMXA 2P7UA 2PREA 2WBFX 4WA6A 5A24A 2G6DA 1S4VA 4X6HA 3P5WA 4YYSA 2GHUA 1U9VA 1PXVA 2YJ8A 1PPOA 3HWNA 3KWBX 1BGOA 1QXPA 2XU3A 4QRGA 3KW9A 3IEJA 4MZSA 1VJVA 1FH0A 1PPNA 1F29A 1ZCMA 1MS6A 2AIMA 4CDEB 1K3BB 2Y6EA 3OVXA 1BQIA 4BS5A 4CZWA 4YYQA 1HUCB 1BP4A 3IOQA 1ATKA 2IPPB 2AUZA 1EWLA 1PCIA 2AU1A 4YVAA 3AI8A 2JQGR 1NB3A 2Y5BA 4P6EA 5EF4A 1AU0A 4K7CA 2PNSA 1YK8A 3N4CA 3CH2X 2VHFA 1M6DA
chains in the Genus database with same CATH superfamily
3IUTA 3BPFA 2OP3A 1F2AA 1U9QX 2NQGA 1Q6KA 2XU1A 2G8JA 5J94A 3KWZA 4OELA 1POPA 2G7YA 1MIRA 3KFQA 3U8EA 4D8EA 3K9MA 1AU2A 3V6CA 4OVZA 2FRQA 1YZBA 1BY8A 4CDDB 3H8CA 3C9EA 1F2CA 2O6XA 2PBHA 2FT2A 4DMYA 4PADA 1JQPA 4M0WA 3I3TA 4BOZA 3WXGA 2BDZA 4GUAA 4RKXA 1AU3A 2FO5A 3PSEA 4MM3B 3MORA 2B1MA 1PIPA 5FPWA 3OF9A 2FTDA 3ZUAA 1AYUA 2NQAA 3V6EA 4QBBA 2P0RA 4I04A 2YJCA 1U9XA 4AXMA 1MHWA 1EWMA 2AUXA 4ZTBA 1KFUL 5CVOB 1EWOA 3RVWA 2R6NA 2P86A 4OEMA 4FK5A 3MHHA 1CB5A 4YYVA 2F1GA 3H89A 3TNXA 2DZYA 3BBAA 1GLOA 3IFUA 3BCNA 1NL6A 3OISA 2Z84A 3O0UA 1XKGA 2FYEA 1NB5A 1CS8A 1IWDA 3BOWA 2E01A 3QT4A 3PNRA 3BC3A 4CDCB 5CHVA 4BS6A 1NQCA 3CBKA 3QSDA 4AXLA 4FIPA 2DC9A 7PCKA 1YT7A 5EZQA 1THEA 4XZXA 4I07A 3MHSA 1EF7A 2ARYA 2AYNA 4QRXA 2DCBA 2E00A 4RF0A 3D6SA 2BDLA 2E03A 3MJ5A 5JZEA 4XR7A 2AS8A 1CVZA 3F75A 3WXEA 5CHTA 3LXSA 3TRKA 2YJ9A 2AYOA 3E1ZB 2CIOA 3N3GA 2DJGB 2ATOA 2R9OA 1EWPA 2HXZA 2PADA 3K8UA 4N8WA 3S3RA 3H6SA 1U5IA 1GECE 3TMPA 2DC7A 1CJLA 3I06A 3RVXA 1PPPA 4BOSA 3QJ3A 1A6RA 9PAPA 1AECA 1QDQA 2OZ2A 2XU4A 3H7DA 3IMAA 4W5BA 3B21A 3O1GA 4PI3A 3B79A 4MI7A 4I05A 3HHAA 1PPDA 1NLJA 5KO3A 4P16A 1VSNA 3E9SA 3HHIA 2DC8A 2BTWA 4BPVA 2BTWB 2DCAA 3BPMA 4A5UA 1GCBA 3PW3A 2C0YA 3M99A 4HXDB 2OULA 5K16A 4ZUXU 1CV8A 4X6JA 2CB5A 1U9WA 2DCCA 4PP2E 3ZNHA 3MTNA 2HHNA 1CQDA 1X9YA 2YJBA 3IV2A 2R9NA 3NHEA 4BOUA 2DZZA 5PADA 8PCHA 3CH3X 1SNKA 3USVA 5JH3A 1ZIVA 2FE8A 1AIMA 1CSBB 2DOSA 2YJ2A 3ERVA 1NPZA 3W31A 2DCDA 1KHQA 4YYRA 1YK7A 1O0EA 2AVWA 5CVMA 1Y4HA 4BQVA 2R9FA 3PT2A 2ACTA 3PHXA 5EZSA 4YV8A 1AU4A 4IP3A 1TU6A 4BSQA 5JA7A 2DJFB 2FRAA 3KSEA 3F5VA 1KHPA 3P5UA 4KLBA 3K24A 2IBIA 4D8BA 2JTCA 2FUDA 4MZOA 1QMYA 1ME4A 1PVJA 5EGWA 2VHSA 2J7QC 3HD3A 4RF1A 1AYVA 1MEMA 4RY2A 1DF0A 4R3DA 1PADA 4YYWA 1GMYA 3GCBA 3O65A 4IUMA 2R9MA 4P6GA 4BOQA 4HWYA 4Q8GA 2F7DA 3WXFA 2NQIA 1CPJA 2B1NA 3OF8A 4XUIA 4OVZB 1STFE 4X6IA 2R9CA 4Q8HA 4REZA 3N3KA 1Y08A 2DC6A 2GFOA 1PE6A 1PBHA 5E6JA 2HD5A 1YALA 2HWKA 1F2BA 1AYWA 4YYUA 3OVZA 1TLOA 3LFYA 4OW0A 4D8IA 4W5CA 3IHPA 1MDWA 3PHWA 4W4UA 1DEUA 3MP2A 3BWKA 3DF0A 1KXRA 1KFXL 4MSXA 1CTEA 4G54A 1DKIA 2NQDB 3PRPA 3KX1A 5F02A 6PADA 1ITOA 3C0RA 3P5XA 4FJCA 3CBJA 4N4ZA 2XU5A 1YVBA 3S3QA 2H7JA 3BY4A 2JQFR 3PDFA 4PP1A 4N79A 4CDFB 4QH6A 1TL9A 2J7QA 1QOLA 5CVNB 1SP4B 3KKUA 3RVVA 1ME3A 2E02A 1ICFA 2FQ9A 4QRVA 4BOPA 3H8BA 3PBHA 2HH5A 2G8EA 1MEGA 3P5VA 4DMXA 3RNVA 2P7UA 2PREA 4RNAA 2WBFX 4WA6A 5A24A 2G6DA 1S4VA 4X6HA 3P5WA 4YYSA 2GHUA 1U9VA 1PXVA 2YJ8A 1PPOA 3OQCA 4WURA 3HWNA 3BB7A 3KWBX 1BGOA 1QXPA 2XU3A 4QRGA 3KW9A 3IEJA 4MZSA 1VJVA 1FH0A 3PHUA 1PPNA 1F29A 1ZCMA 1MS6A 2AIMA 4CDEB 1K3BB 2Y6EA 3OVXA 1BQIA 4BS5A 4CZWA 4YYQA 3MTVA 1HUCB 1BP4A 3IOQA 1ATKA 2IPPB 2AUZA 3W30A 1EWLA 1PCIA 2AU1A 4YVAA 3AI8A 3PRMA 2UZJA 2JQGR 1NB3A 4PT5A 2JRIA 2Y5BA 4P6EA 5EF4A 1AU0A 2AGAA 1UKFA 4K7CA 2PNSA 1YK8A 2BU3A 3N4CA 3CH2X 2VHFA 1M6DA
chains in the Genus database with same CATH topology
3IUTA 3BPFA 2OP3A 1F2AA 1U9QX 2NQGA 1Q6KA 2XU1A 2G8JA 5J94A 3KWZA 4OELA 1POPA 2G7YA 1MIRA 3KFQA 3U8EA 3K9MA 1AU2A 3V6CA 2FRQA 1BY8A 4CDDB 3H8CA 4C5PA 3C9EA 1F2CA 2O6XA 2PBHA 2FT2A 1E2TA 4DMYA 4NV7A 4PADA 1JQPA 3I3TA 3WXGA 2BDZA 1GX3A 1AU3A 2FO5A 3MORA 2B1MA 1PIPA 5FPWA 3OF9A 2FTDA 3ZUAA 1AYUA 2NQAA 3V6EA 4QBBA 2P0RA 4I04A 2YJCA 1U9XA 4AXMA 1MHWA 1EWMA 2AUXA 1KFUL 5CVOB 1EWOA 3RVWA 2R6NA 2P86A 4OEMA 4FK5A 3MHHA 1CB5A 4YYVA 2F1GA 3H89A 3TNXA 4NV8A 2DZYA 1GLOA 3BCNA 1NL6A 3OISA 3O0UA 1XKGA 2FYEA 1NB5A 1CS8A 1IWDA 3BOWA 2E01A 3QT4A 3PNRA 3BC3A 4CDCB 5CHVA 4BS6A 1NQCA 3CBKA 3QSDA 4AXLA 4FIPA 2DC9A 7PCKA 1YT7A 1THEA 4I07A 3MHSA 1EF7A 2ARYA 2AYNA 4QRXA 2DCBA 2E00A 3D6SA 2BDLA 2E03A 4XR7A 2AS8A 1CVZA 3F75A 3WXEA 5CHTA 3LXSA 2YJ9A 2AYOA 3E1ZB 2CIOA 3N3GA 2DJGB 2ATOA 2R9OA 1EWPA 2HXZA 2PADA 3K8UA 4N8WA 2VFBA 3S3RA 3H6SA 1U5IA 1GECE 2DC7A 1CJLA 3I06A 3RVXA 1PPPA 9PAPA 3QJ3A 1A6RA 1AECA 1QDQA 2OZ2A 2XU4A 3H7DA 3IMAA 4W5BA 3O1GA 4PI3A 3B79A 4I05A 3HHAA 1PPDA 1NLJA 2BSZA 1VSNA 3HHIA 2DC8A 4BPVA 2DCAA 3BPMA 1W6FA 1GCBA 3PW3A 2C0YA 3M99A 4B55A 2OULA 5K16A 4ZUXU 1CV8A 4X6JA 2CB5A 1U9WA 2DCCA 4PP2E 3MTNA 2HHNA 1CQDA 1X9YA 2YJBA 3IV2A 2R9NA 3NHEA 2DZZA 5PADA 8PCHA 3CH3X 1SNKA 3USVA 5JH3A 1ZIVA 1AIMA 1CSBB 2YJ2A 3ERVA 1NPZA 2DCDA 1KHQA 4YYRA 1YK7A 1O0EA 2AVWA 5CVMA 1Y4HA 4BQVA 2R9FA 2ACTA 4YV8A 1AU4A 1TU6A 4BSQA 5JA7A 2DJFB 2FRAA 3KSEA 3F5VA 1KHPA 3P5UA 3D9WA 4KLBA 3K24A 2IBIA 2FUDA 4MZOA 1QMYA 1ME4A 4GUZA 5EGWA 2VHSA 3HD3A 1AYVA 1MEMA 4RY2A 1DF0A 1PADA 4YYWA 1GMYA 3GCBA 2R9MA 4P6GA 4HWYA 4Q8GA 2F7DA 3WXFA 1W4TA 2NQIA 1CPJA 2B1NA 3OF8A 4XUIA 1STFE 4X6IA 2R9CA 4Q8HA 3N3KA 1Y08A 2DC6A 2GFOA 1PE6A 1PBHA 2HD5A 1YALA 1F2BA 1AYWA 4YYUA 3OVZA 1TLOA 3LFYA 4W5CA 3IHPA 1MDWA 4W4UA 1DEUA 3BWKA 3DF0A 1KXRA 1KFXL 4MSXA 1CTEA 4G54A 2NQDB 3KX1A 5F02A 6PADA 1ITOA 3P5XA 4FJCA 3CBJA 4N4ZA 2XU5A 1YVBA 3S3QA 2H7JA 2JQFR 3PDFA 4PP1A 4N79A 4CDFB 4QH6A 1TL9A 1QOLA 5CVNB 1SP4B 3KKUA 3LTWA 3RVVA 1ME3A 2E02A 1ICFA 2FQ9A 4QRVA 3H8BA 3PBHA 2HH5A 2G8EA 1MEGA 3P5VA 4BGFA 4DMXA 2P7UA 2PREA 2WBFX 4WA6A 5A24A 2G6DA 1S4VA 4X6HA 3P5WA 4YYSA 2VFCA 2GHUA 1U9VA 1PXVA 1W5RA 1PPOA 2YJ8A 3HWNA 3KWBX 1BGOA 1QXPA 2XU3A 4QRGA 3KW9A 3IEJA 4MZSA 1VJVA 1FH0A 1PPNA 1F29A 1ZCMA 1MS6A 2AIMA 4CDEB 1K3BB 2Y6EA 3OVXA 1BQIA 4BS5A 4CZWA 4YYQA 1HUCB 1BP4A 3IOQA 1ATKA 2IPPB 2AUZA 1EWLA 1PCIA 2AU1A 4YVAA 3AI8A 2JQGR 1NB3A 2Y5BA 4P6EA 5EF4A 1AU0A 4K7CA 2PNSA 1YK8A 3N4CA 3CH2X 2VHFA 1M6DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IUT A;  3BPF A;  2OP3 A;  1F2A A;  1U9Q X;  2NQG A;  1Q6K A;  2XU1 A;  2G8J A;  5J94 A;  3KWZ A;  4OEL A;  1POP A;  2G7Y A;  1MIR A;  3KFQ A;  3U8E A;  3K9M A;  1AU2 A;  3V6C A;  2FRQ A;  1BY8 A;  4CDD B;  3H8C A;  3C9E A;  1F2C A;  2O6X A;  2PBH A;  2FT2 A;  4DMY A;  4PAD A;  1JQP A;  3I3T A;  3WXG A;  2BDZ A;  1AU3 A;  2FO5 A;  3MOR A;  2B1M A;  1PIP A;  5FPW A;  3OF9 A;  2FTD A;  3ZUA A;  1AYU A;  2NQA A;  3V6E A;  4QBB A;  2P0R A;  4I04 A;  2YJC A;  1U9X A;  4AXM A;  1MHW A;  1EWM A;  2AUX A;  1KFU L;  5CVO B;  1EWO A;  3RVW A;  2R6N A;  2P86 A;  4OEM A;  4FK5 A;  3MHH A;  1CB5 A;  4YYV A;  2F1G A;  3H89 A;  3TNX A;  2DZY A;  1GLO A;  3BCN A;  1NL6 A;  3OIS A;  3O0U A;  1XKG A;  2FYE A;  1NB5 A;  1CS8 A;  1IWD A;  3BOW A;  2E01 A;  3QT4 A;  3PNR A;  3BC3 A;  4CDC B;  5CHV A;  4BS6 A;  1NQC A;  3CBK A;  3QSD A;  4AXL A;  4FIP A;  2DC9 A;  7PCK A;  1YT7 A;  1THE A;  4I07 A;  3MHS A;  1EF7 A;  2ARY A;  2AYN A;  4QRX A;  2DCB A;  2E00 A;  3D6S A;  2BDL A;  2E03 A;  4XR7 A;  2AS8 A;  1CVZ A;  3F75 A;  3WXE A;  5CHT A;  3LXS A;  2YJ9 A;  2AYO A;  3E1Z B;  2CIO A;  3N3G A;  2DJG B;  2ATO A;  2R9O A;  1EWP A;  2HXZ A;  2PAD A;  3K8U A;  4N8W A;  3S3R A;  3H6S A;  1U5I A;  1GEC E;  2DC7 A;  1CJL A;  3I06 A;  3RVX A;  1PPP A;  9PAP A;  3QJ3 A;  1A6R A;  1AEC A;  1QDQ A;  2OZ2 A;  2XU4 A;  3H7D A;  3IMA A;  4W5B A;  3O1G A;  4PI3 A;  3B79 A;  4I05 A;  3HHA A;  1PPD A;  1NLJ A;  1VSN A;  3HHI A;  2DC8 A;  4BPV A;  2DCA A;  3BPM A;  1GCB A;  3PW3 A;  2C0Y A;  3M99 A;  2OUL A;  5K16 A;  4ZUX U;  1CV8 A;  4X6J A;  2CB5 A;  1U9W A;  2DCC A;  4PP2 E;  3MTN A;  2HHN A;  1CQD A;  1X9Y A;  2YJB A;  3IV2 A;  2R9N A;  3NHE A;  2DZZ A;  5PAD A;  8PCH A;  3CH3 X;  1SNK A;  3USV A;  5JH3 A;  1ZIV A;  1AIM A;  1CSB B;  2YJ2 A;  3ERV A;  1NPZ A;  2DCD A;  1KHQ A;  4YYR A;  1YK7 A;  1O0E A;  2AVW A;  5CVM A;  1Y4H A;  4BQV A;  2R9F A;  2ACT A;  4YV8 A;  1AU4 A;  1TU6 A;  4BSQ A;  5JA7 A;  2DJF B;  2FRA A;  3KSE A;  3F5V A;  1KHP A;  3P5U A;  4KLB A;  3K24 A;  2IBI A;  2FUD A;  4MZO A;  1QMY A;  1ME4 A;  5EGW A;  2VHS A;  3HD3 A;  1AYV A;  1MEM A;  4RY2 A;  1DF0 A;  1PAD A;  4YYW A;  1GMY A;  3GCB A;  2R9M A;  4P6G A;  4HWY A;  4Q8G A;  2F7D A;  3WXF A;  2NQI A;  1CPJ A;  2B1N A;  3OF8 A;  4XUI A;  1STF E;  4X6I A;  2R9C A;  4Q8H A;  3N3K A;  1Y08 A;  2DC6 A;  2GFO A;  1PE6 A;  1PBH A;  2HD5 A;  1YAL A;  1F2B A;  1AYW A;  4YYU A;  3OVZ A;  1TLO A;  3LFY A;  4W5C A;  3IHP A;  1MDW A;  4W4U A;  1DEU A;  3BWK A;  3DF0 A;  1KXR A;  1KFX L;  4MSX A;  1CTE A;  4G54 A;  2NQD B;  3KX1 A;  5F02 A;  6PAD A;  1ITO A;  3P5X A;  4FJC A;  3CBJ A;  4N4Z A;  2XU5 A;  1YVB A;  3S3Q A;  2H7J A;  2JQF R;  3PDF A;  4PP1 A;  4N79 A;  4CDF B;  4QH6 A;  1TL9 A;  1QOL A;  5CVN B;  1SP4 B;  3KKU A;  3RVV A;  1ME3 A;  2E02 A;  1ICF A;  2FQ9 A;  4QRV A;  3H8B A;  3PBH A;  2HH5 A;  2G8E A;  1MEG A;  3P5V A;  4DMX A;  2P7U A;  2PRE A;  2WBF X;  4WA6 A;  5A24 A;  2G6D A;  1S4V A;  4X6H A;  3P5W A;  4YYS A;  2GHU A;  1U9V A;  1PXV A;  2YJ8 A;  1PPO A;  3HWN A;  3KWB X;  1BGO A;  1QXP A;  2XU3 A;  4QRG A;  3KW9 A;  3IEJ A;  4MZS A;  1VJV A;  1FH0 A;  1PPN A;  1F29 A;  1ZCM A;  1MS6 A;  2AIM A;  4CDE B;  1K3B B;  2Y6E A;  3OVX A;  1BQI A;  4BS5 A;  4CZW A;  4YYQ A;  1HUC B;  1BP4 A;  3IOQ A;  1ATK A;  2IPP B;  2AUZ A;  1EWL A;  1PCI A;  2AU1 A;  4YVA A;  3AI8 A;  2JQG R;  1NB3 A;  2Y5B A;  4P6E A;  5EF4 A;  1AU0 A;  4K7C A;  2PNS A;  1YK8 A;  3N4C A;  3CH2 X;  2VHF A;  1M6D A; 
#chains in the Genus database with same CATH topology
 3IUT A;  3BPF A;  2OP3 A;  1F2A A;  1U9Q X;  2NQG A;  1Q6K A;  2XU1 A;  2G8J A;  5J94 A;  3KWZ A;  4OEL A;  1POP A;  2G7Y A;  1MIR A;  3KFQ A;  3U8E A;  4D8E A;  3K9M A;  1AU2 A;  3V6C A;  4OVZ A;  2FRQ A;  1YZB A;  1BY8 A;  4CDD B;  3H8C A;  3C9E A;  1F2C A;  2O6X A;  2PBH A;  2FT2 A;  4DMY A;  4PAD A;  1JQP A;  4M0W A;  3I3T A;  4BOZ A;  3WXG A;  2BDZ A;  4GUA A;  4RKX A;  1AU3 A;  2FO5 A;  3PSE A;  4MM3 B;  3MOR A;  2B1M A;  1PIP A;  5FPW A;  3OF9 A;  2FTD A;  3ZUA A;  1AYU A;  2NQA A;  3V6E A;  4QBB A;  2P0R A;  4I04 A;  2YJC A;  1U9X A;  4AXM A;  1MHW A;  1EWM A;  2AUX A;  4ZTB A;  1KFU L;  5CVO B;  1EWO A;  3RVW A;  2R6N A;  2P86 A;  4OEM A;  4FK5 A;  3MHH A;  1CB5 A;  4YYV A;  2F1G A;  3H89 A;  3TNX A;  2DZY A;  3BBA A;  1GLO A;  3IFU A;  3BCN A;  1NL6 A;  3OIS A;  2Z84 A;  3O0U A;  1XKG A;  2FYE A;  1NB5 A;  1CS8 A;  1IWD A;  3BOW A;  2E01 A;  3QT4 A;  3PNR A;  3BC3 A;  4CDC B;  5CHV A;  4BS6 A;  1NQC A;  3CBK A;  3QSD A;  4AXL A;  4FIP A;  2DC9 A;  7PCK A;  1YT7 A;  5EZQ A;  1THE A;  4XZX A;  4I07 A;  3MHS A;  1EF7 A;  2ARY A;  2AYN A;  4QRX A;  2DCB A;  2E00 A;  4RF0 A;  3D6S A;  2BDL A;  2E03 A;  3MJ5 A;  5JZE A;  4XR7 A;  2AS8 A;  1CVZ A;  3F75 A;  3WXE A;  5CHT A;  3LXS A;  3TRK A;  2YJ9 A;  2AYO A;  3E1Z B;  2CIO A;  3N3G A;  2DJG B;  2ATO A;  2R9O A;  1EWP A;  2HXZ A;  2PAD A;  3K8U A;  4N8W A;  3S3R A;  3H6S A;  1U5I A;  1GEC E;  3TMP A;  2DC7 A;  1CJL A;  3I06 A;  3RVX A;  1PPP A;  4BOS A;  3QJ3 A;  1A6R A;  9PAP A;  1AEC A;  1QDQ A;  2OZ2 A;  2XU4 A;  3H7D A;  3IMA A;  4W5B A;  3B21 A;  3O1G A;  4PI3 A;  3B79 A;  4MI7 A;  4I05 A;  3HHA A;  1PPD A;  1NLJ A;  5KO3 A;  4P16 A;  1VSN A;  3E9S A;  3HHI A;  2DC8 A;  2BTW A;  4BPV A;  2BTW B;  2DCA A;  3BPM A;  4A5U A;  1GCB A;  3PW3 A;  2C0Y A;  3M99 A;  4HXD B;  2OUL A;  5K16 A;  4ZUX U;  1CV8 A;  4X6J A;  2CB5 A;  1U9W A;  2DCC A;  4PP2 E;  3ZNH A;  3MTN A;  2HHN A;  1CQD A;  1X9Y A;  2YJB A;  3IV2 A;  2R9N A;  3NHE A;  4BOU A;  2DZZ A;  5PAD A;  8PCH A;  3CH3 X;  1SNK A;  3USV A;  5JH3 A;  1ZIV A;  2FE8 A;  1AIM A;  1CSB B;  2DOS A;  2YJ2 A;  3ERV A;  1NPZ A;  3W31 A;  2DCD A;  1KHQ A;  4YYR A;  1YK7 A;  1O0E A;  2AVW A;  5CVM A;  1Y4H A;  4BQV A;  2R9F A;  3PT2 A;  2ACT A;  3PHX A;  5EZS A;  4YV8 A;  1AU4 A;  4IP3 A;  1TU6 A;  4BSQ A;  5JA7 A;  2DJF B;  2FRA A;  3KSE A;  3F5V A;  1KHP A;  3P5U A;  4KLB A;  3K24 A;  2IBI A;  4D8B A;  2JTC A;  2FUD A;  4MZO A;  1QMY A;  1ME4 A;  1PVJ A;  5EGW A;  2VHS A;  2J7Q C;  3HD3 A;  4RF1 A;  1AYV A;  1MEM A;  4RY2 A;  1DF0 A;  4R3D A;  1PAD A;  4YYW A;  1GMY A;  3GCB A;  3O65 A;  4IUM A;  2R9M A;  4P6G A;  4BOQ A;  4HWY A;  4Q8G A;  2F7D A;  3WXF A;  2NQI A;  1CPJ A;  2B1N A;  3OF8 A;  4XUI A;  4OVZ B;  1STF E;  4X6I A;  2R9C A;  4Q8H A;  4REZ A;  3N3K A;  1Y08 A;  2DC6 A;  2GFO A;  1PE6 A;  1PBH A;  5E6J A;  2HD5 A;  1YAL A;  2HWK A;  1F2B A;  1AYW A;  4YYU A;  3OVZ A;  1TLO A;  3LFY A;  4OW0 A;  4D8I A;  4W5C A;  3IHP A;  1MDW A;  3PHW A;  4W4U A;  1DEU A;  3MP2 A;  3BWK A;  3DF0 A;  1KXR A;  1KFX L;  4MSX A;  1CTE A;  4G54 A;  1DKI A;  2NQD B;  3PRP A;  3KX1 A;  5F02 A;  6PAD A;  1ITO A;  3C0R A;  3P5X A;  4FJC A;  3CBJ A;  4N4Z A;  2XU5 A;  1YVB A;  3S3Q A;  2H7J A;  3BY4 A;  2JQF R;  3PDF A;  4PP1 A;  4N79 A;  4CDF B;  4QH6 A;  1TL9 A;  2J7Q A;  1QOL A;  5CVN B;  1SP4 B;  3KKU A;  3RVV A;  1ME3 A;  2E02 A;  1ICF A;  2FQ9 A;  4QRV A;  4BOP A;  3H8B A;  3PBH A;  2HH5 A;  2G8E A;  1MEG A;  3P5V A;  4DMX A;  3RNV A;  2P7U A;  2PRE A;  4RNA A;  2WBF X;  4WA6 A;  5A24 A;  2G6D A;  1S4V A;  4X6H A;  3P5W A;  4YYS A;  2GHU A;  1U9V A;  1PXV A;  2YJ8 A;  1PPO A;  3OQC A;  4WUR A;  3HWN A;  3BB7 A;  3KWB X;  1BGO A;  1QXP A;  2XU3 A;  4QRG A;  3KW9 A;  3IEJ A;  4MZS A;  1VJV A;  1FH0 A;  3PHU A;  1PPN A;  1F29 A;  1ZCM A;  1MS6 A;  2AIM A;  4CDE B;  1K3B B;  2Y6E A;  3OVX A;  1BQI A;  4BS5 A;  4CZW A;  4YYQ A;  3MTV A;  1HUC B;  1BP4 A;  3IOQ A;  1ATK A;  2IPP B;  2AUZ A;  3W30 A;  1EWL A;  1PCI A;  2AU1 A;  4YVA A;  3AI8 A;  3PRM A;  2UZJ A;  2JQG R;  1NB3 A;  4PT5 A;  2JRI A;  2Y5B A;  4P6E A;  5EF4 A;  1AU0 A;  2AGA A;  1UKF A;  4K7C A;  2PNS A;  1YK8 A;  2BU3 A;  3N4C A;  3CH2 X;  2VHF A;  1M6D A; 
#chains in the Genus database with same CATH homology
 3IUT A;  3BPF A;  2OP3 A;  1F2A A;  1U9Q X;  2NQG A;  1Q6K A;  2XU1 A;  2G8J A;  5J94 A;  3KWZ A;  4OEL A;  1POP A;  2G7Y A;  1MIR A;  3KFQ A;  3U8E A;  3K9M A;  1AU2 A;  3V6C A;  2FRQ A;  1BY8 A;  4CDD B;  3H8C A;  4C5P A;  3C9E A;  1F2C A;  2O6X A;  2PBH A;  2FT2 A;  1E2T A;  4DMY A;  4NV7 A;  4PAD A;  1JQP A;  3I3T A;  3WXG A;  2BDZ A;  1GX3 A;  1AU3 A;  2FO5 A;  3MOR A;  2B1M A;  1PIP A;  5FPW A;  3OF9 A;  2FTD A;  3ZUA A;  1AYU A;  2NQA A;  3V6E A;  4QBB A;  2P0R A;  4I04 A;  2YJC A;  1U9X A;  4AXM A;  1MHW A;  1EWM A;  2AUX A;  1KFU L;  5CVO B;  1EWO A;  3RVW A;  2R6N A;  2P86 A;  4OEM A;  4FK5 A;  3MHH A;  1CB5 A;  4YYV A;  2F1G A;  3H89 A;  3TNX A;  4NV8 A;  2DZY A;  1GLO A;  3BCN A;  1NL6 A;  3OIS A;  3O0U A;  1XKG A;  2FYE A;  1NB5 A;  1CS8 A;  1IWD A;  3BOW A;  2E01 A;  3QT4 A;  3PNR A;  3BC3 A;  4CDC B;  5CHV A;  4BS6 A;  1NQC A;  3CBK A;  3QSD A;  4AXL A;  4FIP A;  2DC9 A;  7PCK A;  1YT7 A;  1THE A;  4I07 A;  3MHS A;  1EF7 A;  2ARY A;  2AYN A;  4QRX A;  2DCB A;  2E00 A;  3D6S A;  2BDL A;  2E03 A;  4XR7 A;  2AS8 A;  1CVZ A;  3F75 A;  3WXE A;  5CHT A;  3LXS A;  2YJ9 A;  2AYO A;  3E1Z B;  2CIO A;  3N3G A;  2DJG B;  2ATO A;  2R9O A;  1EWP A;  2HXZ A;  2PAD A;  3K8U A;  4N8W A;  2VFB A;  3S3R A;  3H6S A;  1U5I A;  1GEC E;  2DC7 A;  1CJL A;  3I06 A;  3RVX A;  1PPP A;  9PAP A;  3QJ3 A;  1A6R A;  1AEC A;  1QDQ A;  2OZ2 A;  2XU4 A;  3H7D A;  3IMA A;  4W5B A;  3O1G A;  4PI3 A;  3B79 A;  4I05 A;  3HHA A;  1PPD A;  1NLJ A;  2BSZ A;  1VSN A;  3HHI A;  2DC8 A;  4BPV A;  2DCA A;  3BPM A;  1W6F A;  1GCB A;  3PW3 A;  2C0Y A;  3M99 A;  4B55 A;  2OUL A;  5K16 A;  4ZUX U;  1CV8 A;  4X6J A;  2CB5 A;  1U9W A;  2DCC A;  4PP2 E;  3MTN A;  2HHN A;  1CQD A;  1X9Y A;  2YJB A;  3IV2 A;  2R9N A;  3NHE A;  2DZZ A;  5PAD A;  8PCH A;  3CH3 X;  1SNK A;  3USV A;  5JH3 A;  1ZIV A;  1AIM A;  1CSB B;  2YJ2 A;  3ERV A;  1NPZ A;  2DCD A;  1KHQ A;  4YYR A;  1YK7 A;  1O0E A;  2AVW A;  5CVM A;  1Y4H A;  4BQV A;  2R9F A;  2ACT A;  4YV8 A;  1AU4 A;  1TU6 A;  4BSQ A;  5JA7 A;  2DJF B;  2FRA A;  3KSE A;  3F5V A;  1KHP A;  3P5U A;  3D9W A;  4KLB A;  3K24 A;  2IBI A;  2FUD A;  4MZO A;  1QMY A;  1ME4 A;  4GUZ A;  5EGW A;  2VHS A;  3HD3 A;  1AYV A;  1MEM A;  4RY2 A;  1DF0 A;  1PAD A;  4YYW A;  1GMY A;  3GCB A;  2R9M A;  4P6G A;  4HWY A;  4Q8G A;  2F7D A;  3WXF A;  1W4T A;  2NQI A;  1CPJ A;  2B1N A;  3OF8 A;  4XUI A;  1STF E;  4X6I A;  2R9C A;  4Q8H A;  3N3K A;  1Y08 A;  2DC6 A;  2GFO A;  1PE6 A;  1PBH A;  2HD5 A;  1YAL A;  1F2B A;  1AYW A;  4YYU A;  3OVZ A;  1TLO A;  3LFY A;  4W5C A;  3IHP A;  1MDW A;  4W4U A;  1DEU A;  3BWK A;  3DF0 A;  1KXR A;  1KFX L;  4MSX A;  1CTE A;  4G54 A;  2NQD B;  3KX1 A;  5F02 A;  6PAD A;  1ITO A;  3P5X A;  4FJC A;  3CBJ A;  4N4Z A;  2XU5 A;  1YVB A;  3S3Q A;  2H7J A;  2JQF R;  3PDF A;  4PP1 A;  4N79 A;  4CDF B;  4QH6 A;  1TL9 A;  1QOL A;  5CVN B;  1SP4 B;  3KKU A;  3LTW A;  3RVV A;  1ME3 A;  2E02 A;  1ICF A;  2FQ9 A;  4QRV A;  3H8B A;  3PBH A;  2HH5 A;  2G8E A;  1MEG A;  3P5V A;  4BGF A;  4DMX A;  2P7U A;  2PRE A;  2WBF X;  4WA6 A;  5A24 A;  2G6D A;  1S4V A;  4X6H A;  3P5W A;  4YYS A;  2VFC A;  2GHU A;  1U9V A;  1PXV A;  1W5R A;  1PPO A;  2YJ8 A;  3HWN A;  3KWB X;  1BGO A;  1QXP A;  2XU3 A;  4QRG A;  3KW9 A;  3IEJ A;  4MZS A;  1VJV A;  1FH0 A;  1PPN A;  1F29 A;  1ZCM A;  1MS6 A;  2AIM A;  4CDE B;  1K3B B;  2Y6E A;  3OVX A;  1BQI A;  4BS5 A;  4CZW A;  4YYQ A;  1HUC B;  1BP4 A;  3IOQ A;  1ATK A;  2IPP B;  2AUZ A;  1EWL A;  1PCI A;  2AU1 A;  4YVA A;  3AI8 A;  2JQG R;  1NB3 A;  2Y5B A;  4P6E A;  5EF4 A;  1AU0 A;  4K7C A;  2PNS A;  1YK8 A;  3N4C A;  3CH2 X;  2VHF A;  1M6D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...