1YK8A

Cathepsin k complexed with a cyanamide-based inhibitor
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
213
structure length
213
Chain Sequence
b'DSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cathepsin K
publication title Acyclic cyanamide-based inhibitors of cathepsin K.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 62
structure length 213
sequence length 213
ec nomenclature ec 3.4.22.38: Cathepsin K.
pdb deposition date 2005-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1yk8A00
3GCBA 4QBBA 3AI8A 3PNRA 1YALA 4QRGA 2CIOA 2PBHA 8PCHA 3F5VA 1A6RA 1S4VA 2YJ8A 5CVNB 3I3TA 4YYUA 4P6GA 2FTDA 2G8EA 2ACTA 4ZUXU 1PXVA 2C0YA 2F1GA 4Q8GA 2NQIA 1PE6A 5J94A 9PAPA 4RY2A 1NL6A 1KFUL 1PPOA 2ATOA 4YV8A 1THEA 3F75A 4BS6A 4HWYA 1QDQA 1KXRA 1ITOA 2H7JA 5JH3A 1MIRA 4YYQA 1STFE 2DC8A 2BDZA 4CDDB 4I04A 3OF9A 1TL9A 3BCNA 2GHUA 4QH6A 3KFQA 2AS8A 3BPMA 3ZUAA 1AECA 1MDWA 2AUXA 5FPWA 3KWBX 1CS8A 3N4CA 4QRXA 2GFOA 1BY8A 3IMAA 1CVZA 1KHQA 3D6SA 1BGOA 3MTNA 4CDEB 1U9QX 1Y08A 3CBKA 2JQFR 3OVXA 3USVA 3KWZA 1F2BA 3V6CA 3KSEA 4FK5A 1X9YA 2DCDA 3OF8A 2R9MA 4N4ZA 1AU4A 1ME3A 4W5CA 4N8WA 3RVWA 4OELA 1IWDA 1FH0A 3WXGA 5JA7A 1CJLA 4G54A 4PP2E 3H7DA 1ME4A 2G6DA 3K8UA 2F7DA 1YK7A 1AU2A 4DMYA 2XU5A 2DC7A 1CV8A 2HXZA 4K7CA 1NLJA 1SP4B 3P5WA 4CDCB 4OEMA 2FQ9A 3E1ZB 5K16A 2FRQA 3IOQA 1TU6A 2R9FA 2E03A 2DCBA 1DF0A 1AU3A 2HD5A 1NQCA 1PPDA 1CPJA 4PI3A 3O0UA 3TNXA 2FT2A 3CH2X 1TLOA 3KX1A 1ICFA 4YYVA 4DMXA 1EF7A 2R6NA 2HH5A 2NQAA 5EF4A 2VHSA 1ZCMA 1Q6KA 3O1GA 1CQDA 1XKGA 1PPPA 2DZZA 1NPZA 2E00A 4XUIA 1GLOA 4QRVA 1YVBA 1EWOA 1MS6A 3MHHA 5PADA 1F2AA 1U9XA 4YYRA 2G8JA 4MZSA 3HHIA 2AYOA 3PW3A 1F2CA 3B79A 1M6DA 2ARYA 4I05A 1VJVA 3BOWA 4X6JA 1AU0A 4WA6A 1BP4A 5EGWA 4MZOA 1AYVA 3OVZA 1Y4HA 1CB5A 1BQIA 2NQGA 3BC3A 1EWLA 3ERVA 7PCKA 4X6HA 3MORA 6PADA 4W5BA 2CB5A 2FUDA 2YJCA 1MEGA 2WBFX 1EWMA 1NB5A 2XU1A 2AU1A 3H89A 1MHWA 5CHVA 2R9CA 2PNSA 2HHNA 4N79A 3LXSA 2DZYA 2DJGB 2IPPB 3S3QA 1CTEA 1PADA 3CBJA 1PPNA 3N3KA 2P0RA 1U9VA 3I06A 2IBIA 4P6EA 5A24A 1SNKA 2PREA 4AXMA 3M99A 2AUZA 2DC9A 3K9MA 1DEUA 2OULA 1GCBA 3H8BA 3MHSA 3K24A 2OZ2A 4YVAA 1QOLA 4BS5A 1YK8A 2AIMA 1CSBB 1ZIVA 3RVVA 5F02A 4I07A 4MSXA 3LFYA 1PIPA 3P5VA 1KHPA 2DCAA 2XU4A 5CVMA 2E02A 1O0EA 2PADA 3IHPA 3PDFA 3P5XA 3C9EA 2VHFA 4BPVA 3RVXA 1PCIA 1F29A 3QSDA 3IV2A 1AYUA 2AYNA 4FIPA 1U9WA 2B1MA 2R9OA 3IUTA 3PBHA 4PP1A 4XR7A 5CVOB 1GECE 1AIMA 3QJ3A 2Y6EA 2DC6A 4YYSA 2R9NA 1AYWA 3IEJA 2P7UA 2G7YA 1KFXL 3OISA 2B1NA 4X6IA 3HHAA 1QMYA 1K3BB 2E01A 3H6SA 1VSNA 2YJ2A 3DF0A 1YT7A 4PADA 2AVWA 4FJCA 2Y5BA 1QXPA 4AXLA 2FO5A 1HUCB 3QT4A 1ATKA 2NQDB 3KKUA 3WXFA 3V6EA 4CZWA 3KW9A 1U5IA 3H8CA 2O6XA 4YYWA 3HWNA 2FRAA 3HD3A 1GMYA 2FYEA 1PBHA 3BPFA 2JQGR 4CDFB 2YJBA 3BWKA 2P86A 2OP3A 2DCCA 4KLBA 3N3GA 1MEMA 4Q8HA 2XU3A 4BSQA 4W4UA 3NHEA 1POPA 3S3RA 3P5UA 2YJ9A 5CHTA 4BQVA 1EWPA 2BDLA 3U8EA 3WXEA 1NB3A 2DJFB 3CH3X 1JQPA
chains in the Genus database with same CATH superfamily
3GCBA 4QBBA 3AI8A 1UKFA 3PNRA 1YALA 4QRGA 3MJ5A 2CIOA 3PHUA 2PBHA 8PCHA 3F5VA 1A6RA 3TRKA 1S4VA 2YJ8A 5CVNB 3I3TA 4YYUA 4P6GA 2FTDA 2G8EA 2ACTA 4ZUXU 1PXVA 4IUMA 2C0YA 2F1GA 4Q8GA 2NQIA 1PE6A 5J94A 3OQCA 2BTWB 9PAPA 4RY2A 1NL6A 1KFUL 1PPOA 2AGAA 2ATOA 1THEA 4YV8A 3F75A 4BS6A 4HWYA 1QDQA 1DKIA 1KXRA 4BOUA 1ITOA 5EZSA 2H7JA 5JH3A 4OVZB 1MIRA 4YYQA 5E6JA 1STFE 2DC8A 2BDZA 4CDDB 4I04A 3OF9A 1TL9A 3BCNA 2GHUA 4QH6A 4D8BA 3TMPA 3KFQA 2AS8A 3BPMA 3ZUAA 1AECA 1MDWA 2AUXA 5FPWA 4IP3A 3KWBX 1CS8A 3N4CA 4QRXA 2GFOA 1BY8A 3IMAA 4MM3B 1CVZA 1KHQA 3D6SA 1BGOA 3MTNA 4CDEB 1U9QX 1Y08A 3CBKA 2JQFR 3OVXA 3USVA 3KWZA 1F2BA 3V6CA 3RNVA 3PT2A 2FE8A 3KSEA 4FK5A 1X9YA 2DCDA 3OF8A 2R9MA 4N4ZA 1AU4A 3PHXA 1ME3A 4W5CA 4N8WA 3RVWA 4OELA 1IWDA 1FH0A 3WXGA 5JA7A 1CJLA 4G54A 4PP2E 2BU3A 3H7DA 1ME4A 2G6DA 3K8UA 2F7DA 1YK7A 1AU2A 4DMYA 4MI7A 2XU5A 2DC7A 1CV8A 2HXZA 4K7CA 1NLJA 1SP4B 4HXDB 4RF1A 3P5WA 4CDCB 4OEMA 2FQ9A 4BOSA 3BBAA 3E1ZB 5K16A 2FRQA 3IOQA 1YZBA 1TU6A 2R9FA 2E03A 2BTWA 2DCBA 3BB7A 1DF0A 1AU3A 2HD5A 3MTVA 1NQCA 1PPDA 1CPJA 2DOSA 4BOPA 4PI3A 3O0UA 3TNXA 2FT2A 3CH2X 1TLOA 4OVZA 3KX1A 1ICFA 4YYVA 4DMXA 1EF7A 4BOQA 2R6NA 2HH5A 2NQAA 5EF4A 2VHSA 4XZXA 1ZCMA 1Q6KA 4D8EA 3O1GA 1CQDA 4WURA 1XKGA 3B21A 1PPPA 2DZZA 1NPZA 2E00A 4XUIA 1GLOA 4QRVA 4RNAA 1YVBA 3MP2A 3PRMA 1EWOA 1MS6A 3MHHA 5PADA 4D8IA 1F2AA 1U9XA 4YYRA 2G8JA 4MZSA 3HHIA 2AYOA 3PW3A 1F2CA 3B79A 1M6DA 2ARYA 4I05A 1VJVA 3BOWA 4X6JA 4RF0A 1AU0A 3IFUA 4WA6A 4OW0A 1BP4A 5EGWA 5JZEA 4MZOA 1AYVA 3OVZA 1Y4HA 1CB5A 1BQIA 2NQGA 3BC3A 1EWLA 3ERVA 7PCKA 3BY4A 4X6HA 3MORA 6PADA 4W5BA 2CB5A 2FUDA 2YJCA 1MEGA 2WBFX 1EWMA 1NB5A 2XU1A 2AU1A 3H89A 1MHWA 5CHVA 2R9CA 2PNSA 2HHNA 4N79A 3LXSA 2DZYA 2DJGB 2IPPB 3S3QA 1CTEA 4RKXA 1PADA 3CBJA 1PPNA 3N3KA 2P0RA 1U9VA 3I06A 2IBIA 4P6EA 5A24A 1SNKA 2PREA 4AXMA 3M99A 2AUZA 2DC9A 3K9MA 5KO3A 1DEUA 2OULA 1GCBA 3H8BA 3MHSA 3K24A 2OZ2A 4YVAA 1QOLA 4R3DA 4BS5A 1YK8A 4GUAA 2AIMA 1CSBB 3ZNHA 1ZIVA 3RVVA 4BOZA 5F02A 4I07A 4MSXA 3C0RA 3LFYA 1PIPA 3P5VA 1KHPA 2DCAA 3PRPA 2XU4A 5CVMA 2E02A 1O0EA 2PADA 4PT5A 3IHPA 3PDFA 3P5XA 3C9EA 2VHFA 4BPVA 3RVXA 1PCIA 1F29A 3QSDA 3IV2A 1AYUA 2AYNA 4FIPA 1U9WA 2B1MA 2R9OA 3W30A 2UZJA 3IUTA 3PBHA 4PP1A 4XR7A 5CVOB 1GECE 1AIMA 3QJ3A 3PSEA 2Y6EA 2DC6A 4YYSA 2R9NA 1AYWA 3IEJA 2P7UA 2G7YA 1KFXL 3OISA 2B1NA 4X6IA 2J7QA 3HHAA 1QMYA 3O65A 1K3BB 2E01A 3H6SA 1VSNA 2YJ2A 3DF0A 1YT7A 4PADA 2AVWA 4FJCA 2Y5BA 1QXPA 4AXLA 2FO5A 1HUCB 3QT4A 3E9SA 1ATKA 2NQDB 3KKUA 3WXFA 3V6EA 4CZWA 3KW9A 1U5IA 3H8CA 2O6XA 4YYWA 3HWNA 2FRAA 3HD3A 1GMYA 2FYEA 1PBHA 3BPFA 4REZA 2JTCA 2JQGR 4CDFB 2YJBA 3BWKA 2P86A 2OP3A 2JRIA 4ZTBA 2DCCA 4KLBA 2Z84A 3N3GA 1MEMA 4Q8HA 2XU3A 4BSQA 3PHWA 4W4UA 3NHEA 2HWKA 1POPA 3S3RA 2J7QC 3P5UA 2YJ9A 5CHTA 4BQVA 1EWPA 2BDLA 1PVJA 5EZQA 4P16A 3U8EA 4M0WA 4A5UA 3WXEA 1NB3A 2DJFB 3CH3X 3W31A 1JQPA
chains in the Genus database with same CATH topology
3GCBA 4QBBA 3AI8A 3PNRA 1YALA 4QRGA 2CIOA 2PBHA 8PCHA 3F5VA 1A6RA 1S4VA 2YJ8A 5CVNB 3I3TA 4YYUA 4P6GA 2FTDA 2G8EA 2ACTA 4ZUXU 1PXVA 2C0YA 2F1GA 4Q8GA 2NQIA 1PE6A 5J94A 9PAPA 4RY2A 1NL6A 1KFUL 1PPOA 2ATOA 4YV8A 1THEA 3F75A 4BS6A 4HWYA 1QDQA 1KXRA 1ITOA 2H7JA 5JH3A 1MIRA 4YYQA 1STFE 2DC8A 2BDZA 4CDDB 4I04A 3OF9A 1TL9A 3BCNA 2GHUA 4QH6A 4NV7A 3KFQA 2AS8A 3BPMA 3ZUAA 1AECA 1MDWA 2AUXA 5FPWA 3KWBX 1CS8A 3N4CA 4QRXA 2GFOA 1BY8A 3IMAA 1CVZA 1KHQA 3D6SA 1BGOA 3MTNA 4CDEB 1U9QX 1Y08A 3CBKA 2JQFR 3OVXA 3USVA 3KWZA 1F2BA 2BSZA 3V6CA 3KSEA 4FK5A 1W4TA 1X9YA 2DCDA 3OF8A 2R9MA 4N4ZA 1AU4A 1ME3A 4W5CA 4N8WA 3RVWA 4OELA 1IWDA 1FH0A 3WXGA 5JA7A 1CJLA 4G54A 4PP2E 3H7DA 1ME4A 2G6DA 3K8UA 2F7DA 4GUZA 1YK7A 1AU2A 4DMYA 2XU5A 2DC7A 1CV8A 2HXZA 4K7CA 1NLJA 1SP4B 1GX3A 3P5WA 4CDCB 4OEMA 2FQ9A 3E1ZB 5K16A 2FRQA 3IOQA 1TU6A 2R9FA 2E03A 2DCBA 1DF0A 1AU3A 4B55A 2HD5A 1NQCA 1PPDA 1CPJA 4PI3A 3O0UA 3TNXA 2FT2A 3CH2X 1TLOA 3KX1A 1ICFA 4YYVA 4DMXA 1EF7A 2R6NA 2HH5A 2NQAA 5EF4A 2VHSA 3LTWA 1ZCMA 1Q6KA 3O1GA 1CQDA 1XKGA 1PPPA 2DZZA 1NPZA 2E00A 4XUIA 1GLOA 4QRVA 1YVBA 1EWOA 1MS6A 3MHHA 5PADA 1F2AA 1U9XA 4YYRA 2G8JA 4MZSA 3HHIA 2AYOA 3PW3A 1F2CA 3B79A 1M6DA 2ARYA 4I05A 1VJVA 3BOWA 4X6JA 1AU0A 4WA6A 1BP4A 5EGWA 4MZOA 3D9WA 1AYVA 3OVZA 1Y4HA 1CB5A 1BQIA 2NQGA 4NV8A 3BC3A 1EWLA 3ERVA 7PCKA 4X6HA 3MORA 6PADA 4W5BA 1E2TA 2CB5A 2FUDA 2YJCA 1MEGA 2WBFX 1EWMA 1NB5A 2XU1A 2AU1A 3H89A 1MHWA 5CHVA 2R9CA 2PNSA 2HHNA 4BGFA 4N79A 3LXSA 2DZYA 2DJGB 4C5PA 2IPPB 3S3QA 1CTEA 1PADA 3CBJA 1PPNA 3N3KA 2P0RA 1U9VA 3I06A 2IBIA 4P6EA 5A24A 1SNKA 2PREA 4AXMA 3M99A 2AUZA 2DC9A 3K9MA 1DEUA 2OULA 1GCBA 3H8BA 3MHSA 3K24A 2OZ2A 4YVAA 1QOLA 4BS5A 1YK8A 2AIMA 1CSBB 1ZIVA 3RVVA 5F02A 4I07A 4MSXA 1W5RA 3LFYA 1PIPA 3P5VA 1KHPA 2DCAA 2XU4A 5CVMA 2E02A 1O0EA 2PADA 3IHPA 3PDFA 3P5XA 3C9EA 2VHFA 4BPVA 3RVXA 1PCIA 1F29A 3QSDA 3IV2A 1AYUA 2AYNA 4FIPA 1U9WA 2B1MA 2R9OA 3IUTA 3PBHA 4PP1A 4XR7A 5CVOB 1GECE 1AIMA 3QJ3A 1W6FA 2Y6EA 2DC6A 4YYSA 2R9NA 1AYWA 3IEJA 2P7UA 2G7YA 1KFXL 3OISA 2B1NA 4X6IA 3HHAA 1QMYA 1K3BB 2E01A 3H6SA 1VSNA 2YJ2A 3DF0A 1YT7A 4PADA 2AVWA 4FJCA 2Y5BA 1QXPA 4AXLA 2FO5A 1HUCB 3QT4A 1ATKA 2NQDB 3KKUA 3WXFA 2VFCA 3V6EA 4CZWA 3KW9A 1U5IA 3H8CA 2O6XA 4YYWA 3HWNA 2FRAA 3HD3A 1GMYA 2FYEA 1PBHA 3BPFA 2JQGR 4CDFB 2YJBA 3BWKA 2P86A 2OP3A 2VFBA 2DCCA 4KLBA 3N3GA 1MEMA 4Q8HA 2XU3A 4BSQA 4W4UA 3NHEA 1POPA 3S3RA 3P5UA 2YJ9A 5CHTA 4BQVA 1EWPA 2BDLA 3U8EA 3WXEA 1NB3A 2DJFB 3CH3X 1JQPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GCB A;  4QBB A;  3AI8 A;  3PNR A;  1YAL A;  4QRG A;  2CIO A;  2PBH A;  8PCH A;  3F5V A;  1A6R A;  1S4V A;  2YJ8 A;  5CVN B;  3I3T A;  4YYU A;  4P6G A;  2FTD A;  2G8E A;  2ACT A;  4ZUX U;  1PXV A;  2C0Y A;  2F1G A;  4Q8G A;  2NQI A;  1PE6 A;  5J94 A;  9PAP A;  4RY2 A;  1NL6 A;  1KFU L;  1PPO A;  2ATO A;  4YV8 A;  1THE A;  3F75 A;  4BS6 A;  4HWY A;  1QDQ A;  1KXR A;  1ITO A;  2H7J A;  5JH3 A;  1MIR A;  4YYQ A;  1STF E;  2DC8 A;  2BDZ A;  4CDD B;  4I04 A;  3OF9 A;  1TL9 A;  3BCN A;  2GHU A;  4QH6 A;  3KFQ A;  2AS8 A;  3BPM A;  3ZUA A;  1AEC A;  1MDW A;  2AUX A;  5FPW A;  3KWB X;  1CS8 A;  3N4C A;  4QRX A;  2GFO A;  1BY8 A;  3IMA A;  1CVZ A;  1KHQ A;  3D6S A;  1BGO A;  3MTN A;  4CDE B;  1U9Q X;  1Y08 A;  3CBK A;  2JQF R;  3OVX A;  3USV A;  3KWZ A;  1F2B A;  3V6C A;  3KSE A;  4FK5 A;  1X9Y A;  2DCD A;  3OF8 A;  2R9M A;  4N4Z A;  1AU4 A;  1ME3 A;  4W5C A;  4N8W A;  3RVW A;  4OEL A;  1IWD A;  1FH0 A;  3WXG A;  5JA7 A;  1CJL A;  4G54 A;  4PP2 E;  3H7D A;  1ME4 A;  2G6D A;  3K8U A;  2F7D A;  1YK7 A;  1AU2 A;  4DMY A;  2XU5 A;  2DC7 A;  1CV8 A;  2HXZ A;  4K7C A;  1NLJ A;  1SP4 B;  3P5W A;  4CDC B;  4OEM A;  2FQ9 A;  3E1Z B;  5K16 A;  2FRQ A;  3IOQ A;  1TU6 A;  2R9F A;  2E03 A;  2DCB A;  1DF0 A;  1AU3 A;  2HD5 A;  1NQC A;  1PPD A;  1CPJ A;  4PI3 A;  3O0U A;  3TNX A;  2FT2 A;  3CH2 X;  1TLO A;  3KX1 A;  1ICF A;  4YYV A;  4DMX A;  1EF7 A;  2R6N A;  2HH5 A;  2NQA A;  5EF4 A;  2VHS A;  1ZCM A;  1Q6K A;  3O1G A;  1CQD A;  1XKG A;  1PPP A;  2DZZ A;  1NPZ A;  2E00 A;  4XUI A;  1GLO A;  4QRV A;  1YVB A;  1EWO A;  1MS6 A;  3MHH A;  5PAD A;  1F2A A;  1U9X A;  4YYR A;  2G8J A;  4MZS A;  3HHI A;  2AYO A;  3PW3 A;  1F2C A;  3B79 A;  1M6D A;  2ARY A;  4I05 A;  1VJV A;  3BOW A;  4X6J A;  1AU0 A;  4WA6 A;  1BP4 A;  5EGW A;  4MZO A;  1AYV A;  3OVZ A;  1Y4H A;  1CB5 A;  1BQI A;  2NQG A;  3BC3 A;  1EWL A;  3ERV A;  7PCK A;  4X6H A;  3MOR A;  6PAD A;  4W5B A;  2CB5 A;  2FUD A;  2YJC A;  1MEG A;  2WBF X;  1EWM A;  1NB5 A;  2XU1 A;  2AU1 A;  3H89 A;  1MHW A;  5CHV A;  2R9C A;  2PNS A;  2HHN A;  4N79 A;  3LXS A;  2DZY A;  2DJG B;  2IPP B;  3S3Q A;  1CTE A;  1PAD A;  3CBJ A;  1PPN A;  3N3K A;  2P0R A;  1U9V A;  3I06 A;  2IBI A;  4P6E A;  5A24 A;  1SNK A;  2PRE A;  4AXM A;  3M99 A;  2AUZ A;  2DC9 A;  3K9M A;  1DEU A;  2OUL A;  1GCB A;  3H8B A;  3MHS A;  3K24 A;  2OZ2 A;  4YVA A;  1QOL A;  4BS5 A;  1YK8 A;  2AIM A;  1CSB B;  1ZIV A;  3RVV A;  5F02 A;  4I07 A;  4MSX A;  3LFY A;  1PIP A;  3P5V A;  1KHP A;  2DCA A;  2XU4 A;  5CVM A;  2E02 A;  1O0E A;  2PAD A;  3IHP A;  3PDF A;  3P5X A;  3C9E A;  2VHF A;  4BPV A;  3RVX A;  1PCI A;  1F29 A;  3QSD A;  3IV2 A;  1AYU A;  2AYN A;  4FIP A;  1U9W A;  2B1M A;  2R9O A;  3IUT A;  3PBH A;  4PP1 A;  4XR7 A;  5CVO B;  1GEC E;  1AIM A;  3QJ3 A;  2Y6E A;  2DC6 A;  4YYS A;  2R9N A;  1AYW A;  3IEJ A;  2P7U A;  2G7Y A;  1KFX L;  3OIS A;  2B1N A;  4X6I A;  3HHA A;  1QMY A;  1K3B B;  2E01 A;  3H6S A;  1VSN A;  2YJ2 A;  3DF0 A;  1YT7 A;  4PAD A;  2AVW A;  4FJC A;  2Y5B A;  1QXP A;  4AXL A;  2FO5 A;  1HUC B;  3QT4 A;  1ATK A;  2NQD B;  3KKU A;  3WXF A;  3V6E A;  4CZW A;  3KW9 A;  1U5I A;  3H8C A;  2O6X A;  4YYW A;  3HWN A;  2FRA A;  3HD3 A;  1GMY A;  2FYE A;  1PBH A;  3BPF A;  2JQG R;  4CDF B;  2YJB A;  3BWK A;  2P86 A;  2OP3 A;  2DCC A;  4KLB A;  3N3G A;  1MEM A;  4Q8H A;  2XU3 A;  4BSQ A;  4W4U A;  3NHE A;  1POP A;  3S3R A;  3P5U A;  2YJ9 A;  5CHT A;  4BQV A;  1EWP A;  2BDL A;  3U8E A;  3WXE A;  1NB3 A;  2DJF B;  3CH3 X;  1JQP A; 
#chains in the Genus database with same CATH topology
 3GCB A;  4QBB A;  3AI8 A;  1UKF A;  3PNR A;  1YAL A;  4QRG A;  3MJ5 A;  2CIO A;  3PHU A;  2PBH A;  8PCH A;  3F5V A;  1A6R A;  3TRK A;  1S4V A;  2YJ8 A;  5CVN B;  3I3T A;  4YYU A;  4P6G A;  2FTD A;  2G8E A;  2ACT A;  4ZUX U;  1PXV A;  4IUM A;  2C0Y A;  2F1G A;  4Q8G A;  2NQI A;  1PE6 A;  5J94 A;  3OQC A;  2BTW B;  9PAP A;  4RY2 A;  1NL6 A;  1KFU L;  1PPO A;  2AGA A;  2ATO A;  1THE A;  4YV8 A;  3F75 A;  4BS6 A;  4HWY A;  1QDQ A;  1DKI A;  1KXR A;  4BOU A;  1ITO A;  5EZS A;  2H7J A;  5JH3 A;  4OVZ B;  1MIR A;  4YYQ A;  5E6J A;  1STF E;  2DC8 A;  2BDZ A;  4CDD B;  4I04 A;  3OF9 A;  1TL9 A;  3BCN A;  2GHU A;  4QH6 A;  4D8B A;  3TMP A;  3KFQ A;  2AS8 A;  3BPM A;  3ZUA A;  1AEC A;  1MDW A;  2AUX A;  5FPW A;  4IP3 A;  3KWB X;  1CS8 A;  3N4C A;  4QRX A;  2GFO A;  1BY8 A;  3IMA A;  4MM3 B;  1CVZ A;  1KHQ A;  3D6S A;  1BGO A;  3MTN A;  4CDE B;  1U9Q X;  1Y08 A;  3CBK A;  2JQF R;  3OVX A;  3USV A;  3KWZ A;  1F2B A;  3V6C A;  3RNV A;  3PT2 A;  2FE8 A;  3KSE A;  4FK5 A;  1X9Y A;  2DCD A;  3OF8 A;  2R9M A;  4N4Z A;  1AU4 A;  3PHX A;  1ME3 A;  4W5C A;  4N8W A;  3RVW A;  4OEL A;  1IWD A;  1FH0 A;  3WXG A;  5JA7 A;  1CJL A;  4G54 A;  4PP2 E;  2BU3 A;  3H7D A;  1ME4 A;  2G6D A;  3K8U A;  2F7D A;  1YK7 A;  1AU2 A;  4DMY A;  4MI7 A;  2XU5 A;  2DC7 A;  1CV8 A;  2HXZ A;  4K7C A;  1NLJ A;  1SP4 B;  4HXD B;  4RF1 A;  3P5W A;  4CDC B;  4OEM A;  2FQ9 A;  4BOS A;  3BBA A;  3E1Z B;  5K16 A;  2FRQ A;  3IOQ A;  1YZB A;  1TU6 A;  2R9F A;  2E03 A;  2BTW A;  2DCB A;  3BB7 A;  1DF0 A;  1AU3 A;  2HD5 A;  3MTV A;  1NQC A;  1PPD A;  1CPJ A;  2DOS A;  4BOP A;  4PI3 A;  3O0U A;  3TNX A;  2FT2 A;  3CH2 X;  1TLO A;  4OVZ A;  3KX1 A;  1ICF A;  4YYV A;  4DMX A;  1EF7 A;  4BOQ A;  2R6N A;  2HH5 A;  2NQA A;  5EF4 A;  2VHS A;  4XZX A;  1ZCM A;  1Q6K A;  4D8E A;  3O1G A;  1CQD A;  4WUR A;  1XKG A;  3B21 A;  1PPP A;  2DZZ A;  1NPZ A;  2E00 A;  4XUI A;  1GLO A;  4QRV A;  4RNA A;  1YVB A;  3MP2 A;  3PRM A;  1EWO A;  1MS6 A;  3MHH A;  5PAD A;  4D8I A;  1F2A A;  1U9X A;  4YYR A;  2G8J A;  4MZS A;  3HHI A;  2AYO A;  3PW3 A;  1F2C A;  3B79 A;  1M6D A;  2ARY A;  4I05 A;  1VJV A;  3BOW A;  4X6J A;  4RF0 A;  1AU0 A;  3IFU A;  4WA6 A;  4OW0 A;  1BP4 A;  5EGW A;  5JZE A;  4MZO A;  1AYV A;  3OVZ A;  1Y4H A;  1CB5 A;  1BQI A;  2NQG A;  3BC3 A;  1EWL A;  3ERV A;  7PCK A;  3BY4 A;  4X6H A;  3MOR A;  6PAD A;  4W5B A;  2CB5 A;  2FUD A;  2YJC A;  1MEG A;  2WBF X;  1EWM A;  1NB5 A;  2XU1 A;  2AU1 A;  3H89 A;  1MHW A;  5CHV A;  2R9C A;  2PNS A;  2HHN A;  4N79 A;  3LXS A;  2DZY A;  2DJG B;  2IPP B;  3S3Q A;  1CTE A;  4RKX A;  1PAD A;  3CBJ A;  1PPN A;  3N3K A;  2P0R A;  1U9V A;  3I06 A;  2IBI A;  4P6E A;  5A24 A;  1SNK A;  2PRE A;  4AXM A;  3M99 A;  2AUZ A;  2DC9 A;  3K9M A;  5KO3 A;  1DEU A;  2OUL A;  1GCB A;  3H8B A;  3MHS A;  3K24 A;  2OZ2 A;  4YVA A;  1QOL A;  4R3D A;  4BS5 A;  1YK8 A;  4GUA A;  2AIM A;  1CSB B;  3ZNH A;  1ZIV A;  3RVV A;  4BOZ A;  5F02 A;  4I07 A;  4MSX A;  3C0R A;  3LFY A;  1PIP A;  3P5V A;  1KHP A;  2DCA A;  3PRP A;  2XU4 A;  5CVM A;  2E02 A;  1O0E A;  2PAD A;  4PT5 A;  3IHP A;  3PDF A;  3P5X A;  3C9E A;  2VHF A;  4BPV A;  3RVX A;  1PCI A;  1F29 A;  3QSD A;  3IV2 A;  1AYU A;  2AYN A;  4FIP A;  1U9W A;  2B1M A;  2R9O A;  3W30 A;  2UZJ A;  3IUT A;  3PBH A;  4PP1 A;  4XR7 A;  5CVO B;  1GEC E;  1AIM A;  3QJ3 A;  3PSE A;  2Y6E A;  2DC6 A;  4YYS A;  2R9N A;  1AYW A;  3IEJ A;  2P7U A;  2G7Y A;  1KFX L;  3OIS A;  2B1N A;  4X6I A;  2J7Q A;  3HHA A;  1QMY A;  3O65 A;  1K3B B;  2E01 A;  3H6S A;  1VSN A;  2YJ2 A;  3DF0 A;  1YT7 A;  4PAD A;  2AVW A;  4FJC A;  2Y5B A;  1QXP A;  4AXL A;  2FO5 A;  1HUC B;  3QT4 A;  3E9S A;  1ATK A;  2NQD B;  3KKU A;  3WXF A;  3V6E A;  4CZW A;  3KW9 A;  1U5I A;  3H8C A;  2O6X A;  4YYW A;  3HWN A;  2FRA A;  3HD3 A;  1GMY A;  2FYE A;  1PBH A;  3BPF A;  4REZ A;  2JTC A;  2JQG R;  4CDF B;  2YJB A;  3BWK A;  2P86 A;  2OP3 A;  2JRI A;  4ZTB A;  2DCC A;  4KLB A;  2Z84 A;  3N3G A;  1MEM A;  4Q8H A;  2XU3 A;  4BSQ A;  3PHW A;  4W4U A;  3NHE A;  2HWK A;  1POP A;  3S3R A;  2J7Q C;  3P5U A;  2YJ9 A;  5CHT A;  4BQV A;  1EWP A;  2BDL A;  1PVJ A;  5EZQ A;  4P16 A;  3U8E A;  4M0W A;  4A5U A;  3WXE A;  1NB3 A;  2DJF B;  3CH3 X;  3W31 A;  1JQP A; 
#chains in the Genus database with same CATH homology
 3GCB A;  4QBB A;  3AI8 A;  3PNR A;  1YAL A;  4QRG A;  2CIO A;  2PBH A;  8PCH A;  3F5V A;  1A6R A;  1S4V A;  2YJ8 A;  5CVN B;  3I3T A;  4YYU A;  4P6G A;  2FTD A;  2G8E A;  2ACT A;  4ZUX U;  1PXV A;  2C0Y A;  2F1G A;  4Q8G A;  2NQI A;  1PE6 A;  5J94 A;  9PAP A;  4RY2 A;  1NL6 A;  1KFU L;  1PPO A;  2ATO A;  4YV8 A;  1THE A;  3F75 A;  4BS6 A;  4HWY A;  1QDQ A;  1KXR A;  1ITO A;  2H7J A;  5JH3 A;  1MIR A;  4YYQ A;  1STF E;  2DC8 A;  2BDZ A;  4CDD B;  4I04 A;  3OF9 A;  1TL9 A;  3BCN A;  2GHU A;  4QH6 A;  4NV7 A;  3KFQ A;  2AS8 A;  3BPM A;  3ZUA A;  1AEC A;  1MDW A;  2AUX A;  5FPW A;  3KWB X;  1CS8 A;  3N4C A;  4QRX A;  2GFO A;  1BY8 A;  3IMA A;  1CVZ A;  1KHQ A;  3D6S A;  1BGO A;  3MTN A;  4CDE B;  1U9Q X;  1Y08 A;  3CBK A;  2JQF R;  3OVX A;  3USV A;  3KWZ A;  1F2B A;  2BSZ A;  3V6C A;  3KSE A;  4FK5 A;  1W4T A;  1X9Y A;  2DCD A;  3OF8 A;  2R9M A;  4N4Z A;  1AU4 A;  1ME3 A;  4W5C A;  4N8W A;  3RVW A;  4OEL A;  1IWD A;  1FH0 A;  3WXG A;  5JA7 A;  1CJL A;  4G54 A;  4PP2 E;  3H7D A;  1ME4 A;  2G6D A;  3K8U A;  2F7D A;  4GUZ A;  1YK7 A;  1AU2 A;  4DMY A;  2XU5 A;  2DC7 A;  1CV8 A;  2HXZ A;  4K7C A;  1NLJ A;  1SP4 B;  1GX3 A;  3P5W A;  4CDC B;  4OEM A;  2FQ9 A;  3E1Z B;  5K16 A;  2FRQ A;  3IOQ A;  1TU6 A;  2R9F A;  2E03 A;  2DCB A;  1DF0 A;  1AU3 A;  4B55 A;  2HD5 A;  1NQC A;  1PPD A;  1CPJ A;  4PI3 A;  3O0U A;  3TNX A;  2FT2 A;  3CH2 X;  1TLO A;  3KX1 A;  1ICF A;  4YYV A;  4DMX A;  1EF7 A;  2R6N A;  2HH5 A;  2NQA A;  5EF4 A;  2VHS A;  3LTW A;  1ZCM A;  1Q6K A;  3O1G A;  1CQD A;  1XKG A;  1PPP A;  2DZZ A;  1NPZ A;  2E00 A;  4XUI A;  1GLO A;  4QRV A;  1YVB A;  1EWO A;  1MS6 A;  3MHH A;  5PAD A;  1F2A A;  1U9X A;  4YYR A;  2G8J A;  4MZS A;  3HHI A;  2AYO A;  3PW3 A;  1F2C A;  3B79 A;  1M6D A;  2ARY A;  4I05 A;  1VJV A;  3BOW A;  4X6J A;  1AU0 A;  4WA6 A;  1BP4 A;  5EGW A;  4MZO A;  3D9W A;  1AYV A;  3OVZ A;  1Y4H A;  1CB5 A;  1BQI A;  2NQG A;  4NV8 A;  3BC3 A;  1EWL A;  3ERV A;  7PCK A;  4X6H A;  3MOR A;  6PAD A;  4W5B A;  1E2T A;  2CB5 A;  2FUD A;  2YJC A;  1MEG A;  2WBF X;  1EWM A;  1NB5 A;  2XU1 A;  2AU1 A;  3H89 A;  1MHW A;  5CHV A;  2R9C A;  2PNS A;  2HHN A;  4BGF A;  4N79 A;  3LXS A;  2DZY A;  2DJG B;  4C5P A;  2IPP B;  3S3Q A;  1CTE A;  1PAD A;  3CBJ A;  1PPN A;  3N3K A;  2P0R A;  1U9V A;  3I06 A;  2IBI A;  4P6E A;  5A24 A;  1SNK A;  2PRE A;  4AXM A;  3M99 A;  2AUZ A;  2DC9 A;  3K9M A;  1DEU A;  2OUL A;  1GCB A;  3H8B A;  3MHS A;  3K24 A;  2OZ2 A;  4YVA A;  1QOL A;  4BS5 A;  1YK8 A;  2AIM A;  1CSB B;  1ZIV A;  3RVV A;  5F02 A;  4I07 A;  4MSX A;  1W5R A;  3LFY A;  1PIP A;  3P5V A;  1KHP A;  2DCA A;  2XU4 A;  5CVM A;  2E02 A;  1O0E A;  2PAD A;  3IHP A;  3PDF A;  3P5X A;  3C9E A;  2VHF A;  4BPV A;  3RVX A;  1PCI A;  1F29 A;  3QSD A;  3IV2 A;  1AYU A;  2AYN A;  4FIP A;  1U9W A;  2B1M A;  2R9O A;  3IUT A;  3PBH A;  4PP1 A;  4XR7 A;  5CVO B;  1GEC E;  1AIM A;  3QJ3 A;  1W6F A;  2Y6E A;  2DC6 A;  4YYS A;  2R9N A;  1AYW A;  3IEJ A;  2P7U A;  2G7Y A;  1KFX L;  3OIS A;  2B1N A;  4X6I A;  3HHA A;  1QMY A;  1K3B B;  2E01 A;  3H6S A;  1VSN A;  2YJ2 A;  3DF0 A;  1YT7 A;  4PAD A;  2AVW A;  4FJC A;  2Y5B A;  1QXP A;  4AXL A;  2FO5 A;  1HUC B;  3QT4 A;  1ATK A;  2NQD B;  3KKU A;  3WXF A;  2VFC A;  3V6E A;  4CZW A;  3KW9 A;  1U5I A;  3H8C A;  2O6X A;  4YYW A;  3HWN A;  2FRA A;  3HD3 A;  1GMY A;  2FYE A;  1PBH A;  3BPF A;  2JQG R;  4CDF B;  2YJB A;  3BWK A;  2P86 A;  2OP3 A;  2VFB A;  2DCC A;  4KLB A;  3N3G A;  1MEM A;  4Q8H A;  2XU3 A;  4BSQ A;  4W4U A;  3NHE A;  1POP A;  3S3R A;  3P5U A;  2YJ9 A;  5CHT A;  4BQV A;  1EWP A;  2BDL A;  3U8E A;  3WXE A;  1NB3 A;  2DJF B;  3CH3 X;  1JQP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...