1YK8A

Cathepsin k complexed with a cyanamide-based inhibitor
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
213
structure length
213
Chain Sequence
DSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Cathepsin K
publication title Acyclic cyanamide-based inhibitors of cathepsin K.
pubmed doi rcsb
source organism Homo sapiens
total genus 62
structure length 213
sequence length 213
ec nomenclature ec 3.4.22.38: Cathepsin K.
pdb deposition date 2005-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1yk8A00
1F29A 1Q6KA 4FK5A 2Y6EA 2FUDA 1STFE 5K16A 4P6GA 2AIMA 3WXGA 4BSQA 4K7CA 1CPJA 1FH0A 1PIPA 3N4CA 3O0UA 4RY2A 2PADA 5CVMA 4AXLA 1PE6A 2DC7A 3CH2X 1ATKA 2DCDA 2NQDB 1QOLA 1TL9A 3IOQA 1EF7A 5JH3A 2XU3A 4I07A 3RVVA 2FO5A 1ITOA 1PPDA 1PPPA 3KW9A 3RVWA 1AU2A 9PAPA 4X6IA 2P7UA 2PNSA 2DCBA 3TNXA 1CTEA 2YJCA 1BGOA 2G7YA 1CV8A 4QH6A 1U5IA 2B1MA 1KXRA 3MTNA 3NHEA 2DC9A 3I3TA 4G54A 1YVBA 1EWMA 2AYNA 2R6NA 3CBJA 1U9QX 3OF9A 3HHIA 4N8WA 4X6JA 5F02A 3ERVA 2G8EA 3P5VA 3V6EA 2BDLA 1NB3A 2OP3A 3H89A 4YYSA 1U9XA 4PI3A 5FPWA 3QJ3A 2R9OA 2AS8A 4I04A 1MHWA 1GECE 4X6HA 2JQFR 2R9FA 4CDDB 2HD5A 1AU3A 2VHFA 4DMXA 3DF0A 2FRQA 4OELA 3MORA 2GFOA 2PREA 2P0RA 1CVZA 1AYVA 5CHTA 1ICFA 4QRGA 4P6EA 1IWDA 5EF4A 3MHHA 2DCAA 1KHQA 2DC6A 3PNRA 3P5XA 3H7DA 2IBIA 2E03A 3BOWA 3PBHA 4Q8GA 1THEA 4FIPA 2CIOA 2FT2A 3K24A 3QSDA 1PADA 2IPPB 1AU0A 3CBKA 1SNKA 3BWKA 1Y08A 5EGWA 4QRVA 4XR7A 3D6SA 5A24A 5CVOB 1CJLA 3OF8A 3BPFA 3PDFA 2G8JA 3HD3A 3K8UA 2NQIA 3OVXA 1Y4HA 2XU4A 3QT4A 4YYUA 1ME4A 1VJVA 4DMYA 2E00A 1MS6A 2E02A 4HWYA 1U9VA 1GMYA 1A6RA 2YJBA 3KWZA 3PW3A 1M6DA 2ATOA 2WBFX 1YT7A 2HHNA 1XKGA 2XU5A 3GCBA 1ZCMA 2DC8A 3F5VA 2DJGB 1NLJA 1QDQA 1GCBA 2FRAA 3O1GA 4PP1A 2PBHA 3KX1A 3OISA 1EWOA 3M99A 6PADA 3S3RA 1ME3A 1MEMA 7PCKA 1K3BB 1DF0A 1PXVA 1NB5A 3AI8A 2FQ9A 2YJ2A 4CZWA 1U9WA 3KFQA 2BDZA 3P5UA 1NPZA 1EWLA 1YK8A 2FYEA 1CQDA 1MEGA 1CB5A 3H8CA 3I06A 4W5BA 4MZOA 4N79A 4AXMA 3WXEA 2VHSA 1F2BA 3BC3A 1AECA 2AYOA 2YJ8A 1PCIA 4PP2E 4YYVA 2FTDA 2B1NA 4BS6A 1AYUA 2JQGR 2AUXA 3HHAA 4KLBA 3MHSA 3N3GA 2F7DA 3N3KA 2GHUA 3CH3X 3USVA 4YYRA 2AVWA 2H7JA 3IUTA 3KSEA 2CB5A 3BPMA 2NQGA 1MIRA 1YALA 1CS8A 1PPOA 1BY8A 2ACTA 3B79A 2DCCA 2R9MA 1VSNA 1CSBB 4W5CA 2YJ9A 4FJCA 1ZIVA 3BCNA 3C9EA 1KHPA 3HWNA 2HH5A 2P86A 4YYQA 4MSXA 1YK7A 3IHPA 4YV8A 1S4VA 1MDWA 2C0YA 2E01A 1JQPA 1F2AA 3P5WA 2DZYA 1X9YA 2ARYA 4XUIA 1PPNA 5PADA 1F2CA 5J94A 2DZZA 3WXFA 3IV2A 4ZUXU 3F75A 3LFYA 2OZ2A 4BS5A 1GLOA 4I05A 2OULA 4QRXA 4N4ZA 1QMYA 1KFXL 4OEMA 1SP4B 4CDEB 4QBBA 3OVZA 1KFUL 2AUZA 1DEUA 1BP4A 2R9CA 3V6CA 5CHVA 2DJFB 1TLOA 1EWPA 4YVAA 1BQIA 1AU4A 1AYWA 4PADA 3S3QA 3IMAA 4MZSA 1O0EA 4CDCB 2NQAA 3H8BA 1NQCA 1AIMA 4Q8HA 3LXSA 3KKUA 8PCHA 1QXPA 3IEJA 4WA6A 1POPA 2F1GA 1NL6A 3U8EA 4YYWA 3RVXA 5JA7A 5CVNB 3ZUAA 1TU6A 3H6SA 1PBHA 2G6DA 4BQVA 4BPVA 4W4UA 2Y5BA 4CDFB 2R9NA 2HXZA 1HUCB 2AU1A 3K9MA 2O6XA 3KWBX 2XU1A 3E1ZB
chains in the Genus database with same CATH superfamily
1F29A 1Q6KA 4FK5A 2Y6EA 2J7QC 2FUDA 1STFE 5K16A 3MP2A 4P6GA 2AIMA 3WXGA 4BOPA 4BSQA 4D8BA 4K7CA 1CPJA 1FH0A 1PIPA 3N4CA 3O0UA 4RY2A 2PADA 4BOSA 5CVMA 4PT5A 4AXLA 4RF1A 1PE6A 2DC7A 3CH2X 1ATKA 2DCDA 2NQDB 1QOLA 1TL9A 3IOQA 1EF7A 5JH3A 3BY4A 2XU3A 4I07A 3RVVA 2FO5A 4IP3A 1ITOA 1PPDA 1PPPA 3KW9A 3RVWA 1AU2A 9PAPA 4X6IA 2P7UA 2PNSA 2DCBA 3TNXA 1CTEA 2YJCA 1BGOA 3TRKA 2G7YA 3W30A 1CV8A 4QH6A 1U5IA 2B1MA 3PHXA 1KXRA 3MTNA 3NHEA 2DC9A 3I3TA 4G54A 1YVBA 1EWMA 4WURA 2AYNA 2R6NA 3CBJA 1U9QX 3OF9A 3HHIA 4N8WA 4X6JA 5F02A 3ERVA 3IFUA 2G8EA 3PSEA 3P5VA 3V6EA 2BDLA 1NB3A 2OP3A 3H89A 4YYSA 3W31A 1U9XA 4PI3A 5FPWA 3QJ3A 2R9OA 2AS8A 2DOSA 4I04A 1MHWA 1GECE 3PHUA 4X6HA 2JQFR 4OW0A 2R9FA 4ZTBA 4CDDB 2HD5A 1AU3A 2VHFA 3ZNHA 4DMXA 3DF0A 2FRQA 3MJ5A 4OELA 3MORA 2GFOA 2PREA 2P0RA 1CVZA 1AYVA 5CHTA 1ICFA 4QRGA 1YZBA 4P6EA 1IWDA 5EF4A 3MHHA 2DCAA 1KHQA 2DC6A 3PNRA 3P5XA 3H7DA 2IBIA 2E03A 5E6JA 3BOWA 3PBHA 4Q8GA 1THEA 4FIPA 2CIOA 2FT2A 3K24A 3QSDA 1PADA 2IPPB 1AU0A 3C0RA 3CBKA 2JTCA 1SNKA 3BWKA 3PT2A 1Y08A 5EGWA 4BOUA 4OVZA 4QRVA 4XR7A 4XZXA 3D6SA 5A24A 5CVOB 1CJLA 4D8IA 3OF8A 3BPFA 3PDFA 2G8JA 3HD3A 3K8UA 2NQIA 3OVXA 1Y4HA 2XU4A 3BB7A 3QT4A 4YYUA 1ME4A 1VJVA 4DMYA 2E00A 1MS6A 2E02A 4HWYA 1U9VA 1GMYA 1A6RA 2YJBA 3KWZA 4OVZB 3PW3A 1M6DA 2ATOA 2WBFX 5KO3A 1YT7A 4HXDB 2HHNA 1XKGA 2XU5A 3GCBA 1ZCMA 2DC8A 3F5VA 2DJGB 2FE8A 1NLJA 1QDQA 4M0WA 1GCBA 2FRAA 4A5UA 3O1GA 3O65A 4BOZA 5JZEA 4PP1A 2PBHA 3KX1A 3OISA 1EWOA 3M99A 6PADA 3S3RA 1ME3A 5EZSA 1MEMA 7PCKA 1K3BB 1DF0A 1PXVA 2J7QA 1NB5A 3AI8A 3PRPA 2FQ9A 2YJ2A 4CZWA 1U9WA 3KFQA 3BBAA 2BDZA 3P5UA 1NPZA 1EWLA 1YK8A 2FYEA 1CQDA 1MEGA 1CB5A 3H8CA 3I06A 4W5BA 4RF0A 4MZOA 4N79A 4AXMA 3WXEA 2VHSA 1F2BA 3BC3A 1AECA 2AYOA 2YJ8A 1PCIA 4PP2E 4YYVA 3TMPA 4RNAA 4BOQA 2FTDA 2B1NA 4BS6A 1AYUA 2JQGR 2AUXA 2BTWA 2AGAA 4R3DA 3HHAA 4KLBA 3MHSA 3N3GA 2F7DA 3N3KA 2GHUA 3CH3X 3USVA 4YYRA 2AVWA 2H7JA 3IUTA 3KSEA 2CB5A 2Z84A 3BPMA 2BTWB 2NQGA 1MIRA 1YALA 1CS8A 1DKIA 1PPOA 1BY8A 2ACTA 3B79A 2DCCA 2R9MA 1VSNA 1CSBB 4W5CA 2YJ9A 4FJCA 1ZIVA 3OQCA 2BU3A 3BCNA 3C9EA 1KHPA 3HWNA 2HH5A 2P86A 3RNVA 4YYQA 4MSXA 1YK7A 3IHPA 4YV8A 1S4VA 1MDWA 2C0YA 3PRMA 2E01A 1JQPA 1F2AA 3P5WA 4GUAA 2DZYA 1X9YA 2UZJA 2JRIA 2ARYA 4XUIA 1PPNA 5PADA 1PVJA 1F2CA 5J94A 4P16A 2DZZA 3WXFA 3IV2A 4ZUXU 3F75A 3LFYA 2OZ2A 4BS5A 1GLOA 4I05A 2OULA 5EZQA 4QRXA 4N4ZA 1QMYA 1KFXL 4OEMA 3MTVA 1SP4B 4CDEB 4QBBA 3E9SA 3OVZA 1KFUL 2AUZA 1DEUA 1BP4A 2R9CA 3V6CA 5CHVA 2DJFB 1TLOA 4MI7A 1EWPA 1UKFA 4YVAA 1BQIA 1AU4A 1AYWA 4PADA 3S3QA 3IMAA 4MZSA 1O0EA 4CDCB 4RKXA 2NQAA 3H8BA 1NQCA 1AIMA 3B21A 4IUMA 3PHWA 4Q8HA 3LXSA 3KKUA 8PCHA 1QXPA 3IEJA 4WA6A 1POPA 2F1GA 4D8EA 1NL6A 3U8EA 4YYWA 3RVXA 2HWKA 5JA7A 5CVNB 3ZUAA 1TU6A 3H6SA 1PBHA 4MM3B 2G6DA 4BQVA 4BPVA 4W4UA 2Y5BA 4CDFB 2R9NA 2HXZA 1HUCB 2AU1A 3K9MA 2O6XA 3KWBX 2XU1A 4REZA 3E1ZB
chains in the Genus database with same CATH topology
1F29A 1Q6KA 4FK5A 2Y6EA 2FUDA 3LTWA 1STFE 5K16A 4P6GA 2AIMA 3WXGA 4BSQA 4K7CA 1CPJA 1FH0A 1PIPA 3N4CA 3O0UA 4RY2A 2PADA 5CVMA 4AXLA 1PE6A 2DC7A 3CH2X 1ATKA 2DCDA 1GX3A 2NQDB 1QOLA 1TL9A 3IOQA 1EF7A 5JH3A 2BSZA 2XU3A 4I07A 3RVVA 2FO5A 1ITOA 1PPDA 1PPPA 3KW9A 3RVWA 1AU2A 9PAPA 4X6IA 2P7UA 2PNSA 2DCBA 3TNXA 1CTEA 2YJCA 1BGOA 2G7YA 1CV8A 4QH6A 1U5IA 2B1MA 1KXRA 4NV7A 3MTNA 3NHEA 2DC9A 3I3TA 4G54A 1YVBA 1EWMA 2AYNA 2R6NA 3CBJA 1U9QX 3OF9A 3HHIA 4N8WA 4X6JA 5F02A 3ERVA 2G8EA 3P5VA 3V6EA 2BDLA 1NB3A 2OP3A 3H89A 4YYSA 1U9XA 4PI3A 5FPWA 3QJ3A 2R9OA 2AS8A 4I04A 1MHWA 1GECE 4X6HA 2JQFR 2R9FA 4CDDB 2HD5A 4GUZA 1AU3A 2VHFA 4BGFA 4DMXA 3DF0A 2FRQA 4OELA 3MORA 2GFOA 2PREA 2P0RA 1CVZA 1AYVA 5CHTA 1ICFA 4QRGA 4P6EA 1IWDA 5EF4A 3MHHA 2DCAA 1KHQA 2DC6A 3PNRA 3P5XA 3H7DA 2IBIA 2E03A 3BOWA 3PBHA 4Q8GA 1THEA 4FIPA 2CIOA 2FT2A 3K24A 3QSDA 1PADA 2IPPB 1AU0A 3CBKA 1SNKA 3BWKA 1Y08A 5EGWA 4QRVA 4XR7A 3D6SA 5A24A 5CVOB 1CJLA 3OF8A 3BPFA 3PDFA 1W5RA 2G8JA 3HD3A 3K8UA 2NQIA 3OVXA 1Y4HA 2XU4A 3QT4A 4YYUA 1ME4A 1VJVA 4DMYA 2E00A 1MS6A 2E02A 4HWYA 1U9VA 1GMYA 1A6RA 2YJBA 3KWZA 3PW3A 1M6DA 2ATOA 2VFBA 2WBFX 1YT7A 2HHNA 1XKGA 2XU5A 3GCBA 1ZCMA 2DC8A 3F5VA 2DJGB 1NLJA 1QDQA 1GCBA 2FRAA 3O1GA 4B55A 4PP1A 2PBHA 3KX1A 3OISA 1EWOA 3M99A 6PADA 3S3RA 1ME3A 1MEMA 7PCKA 1K3BB 1DF0A 1PXVA 1E2TA 1NB5A 3AI8A 2FQ9A 2YJ2A 4CZWA 1U9WA 3KFQA 2BDZA 3P5UA 2VFCA 1NPZA 1EWLA 1YK8A 2FYEA 1CQDA 1MEGA 1CB5A 3H8CA 3I06A 4W5BA 4MZOA 4N79A 4AXMA 3WXEA 2VHSA 1F2BA 3BC3A 1W4TA 1AECA 2AYOA 2YJ8A 1PCIA 4PP2E 4YYVA 2FTDA 2B1NA 4BS6A 1AYUA 2JQGR 2AUXA 3HHAA 4KLBA 3MHSA 3N3GA 2F7DA 3N3KA 2GHUA 3CH3X 3USVA 4YYRA 2AVWA 2H7JA 3IUTA 3KSEA 2CB5A 3BPMA 2NQGA 1MIRA 1YALA 1CS8A 1PPOA 1BY8A 2ACTA 3B79A 2DCCA 2R9MA 1VSNA 1CSBB 4W5CA 2YJ9A 4FJCA 1ZIVA 3BCNA 3C9EA 1KHPA 3HWNA 2HH5A 2P86A 4YYQA 4MSXA 1YK7A 3IHPA 4YV8A 1S4VA 1MDWA 2C0YA 2E01A 1JQPA 1F2AA 3P5WA 2DZYA 1X9YA 3D9WA 2ARYA 4XUIA 1PPNA 5PADA 1F2CA 5J94A 2DZZA 3WXFA 3IV2A 4ZUXU 3F75A 3LFYA 2OZ2A 4BS5A 1GLOA 4I05A 2OULA 4QRXA 4N4ZA 1QMYA 1KFXL 4OEMA 1SP4B 4CDEB 4QBBA 3OVZA 1KFUL 2AUZA 1DEUA 1BP4A 2R9CA 3V6CA 5CHVA 2DJFB 4C5PA 1TLOA 1EWPA 4YVAA 4NV8A 1BQIA 1AU4A 1AYWA 4PADA 3S3QA 3IMAA 4MZSA 1O0EA 4CDCB 2NQAA 3H8BA 1NQCA 1AIMA 4Q8HA 3LXSA 3KKUA 8PCHA 1QXPA 1W6FA 3IEJA 4WA6A 1POPA 2F1GA 1NL6A 3U8EA 4YYWA 3RVXA 5JA7A 5CVNB 3ZUAA 1TU6A 3H6SA 1PBHA 2G6DA 4BQVA 4BPVA 4W4UA 2Y5BA 4CDFB 2R9NA 2HXZA 1HUCB 2AU1A 3K9MA 2O6XA 3KWBX 2XU1A 3E1ZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F29 A;  1Q6K A;  4FK5 A;  2Y6E A;  2FUD A;  1STF E;  5K16 A;  4P6G A;  2AIM A;  3WXG A;  4BSQ A;  4K7C A;  1CPJ A;  1FH0 A;  1PIP A;  3N4C A;  3O0U A;  4RY2 A;  2PAD A;  5CVM A;  4AXL A;  1PE6 A;  2DC7 A;  3CH2 X;  1ATK A;  2DCD A;  2NQD B;  1QOL A;  1TL9 A;  3IOQ A;  1EF7 A;  5JH3 A;  2XU3 A;  4I07 A;  3RVV A;  2FO5 A;  1ITO A;  1PPD A;  1PPP A;  3KW9 A;  3RVW A;  1AU2 A;  9PAP A;  4X6I A;  2P7U A;  2PNS A;  2DCB A;  3TNX A;  1CTE A;  2YJC A;  1BGO A;  2G7Y A;  1CV8 A;  4QH6 A;  1U5I A;  2B1M A;  1KXR A;  3MTN A;  3NHE A;  2DC9 A;  3I3T A;  4G54 A;  1YVB A;  1EWM A;  2AYN A;  2R6N A;  3CBJ A;  1U9Q X;  3OF9 A;  3HHI A;  4N8W A;  4X6J A;  5F02 A;  3ERV A;  2G8E A;  3P5V A;  3V6E A;  2BDL A;  1NB3 A;  2OP3 A;  3H89 A;  4YYS A;  1U9X A;  4PI3 A;  5FPW A;  3QJ3 A;  2R9O A;  2AS8 A;  4I04 A;  1MHW A;  1GEC E;  4X6H A;  2JQF R;  2R9F A;  4CDD B;  2HD5 A;  1AU3 A;  2VHF A;  4DMX A;  3DF0 A;  2FRQ A;  4OEL A;  3MOR A;  2GFO A;  2PRE A;  2P0R A;  1CVZ A;  1AYV A;  5CHT A;  1ICF A;  4QRG A;  4P6E A;  1IWD A;  5EF4 A;  3MHH A;  2DCA A;  1KHQ A;  2DC6 A;  3PNR A;  3P5X A;  3H7D A;  2IBI A;  2E03 A;  3BOW A;  3PBH A;  4Q8G A;  1THE A;  4FIP A;  2CIO A;  2FT2 A;  3K24 A;  3QSD A;  1PAD A;  2IPP B;  1AU0 A;  3CBK A;  1SNK A;  3BWK A;  1Y08 A;  5EGW A;  4QRV A;  4XR7 A;  3D6S A;  5A24 A;  5CVO B;  1CJL A;  3OF8 A;  3BPF A;  3PDF A;  2G8J A;  3HD3 A;  3K8U A;  2NQI A;  3OVX A;  1Y4H A;  2XU4 A;  3QT4 A;  4YYU A;  1ME4 A;  1VJV A;  4DMY A;  2E00 A;  1MS6 A;  2E02 A;  4HWY A;  1U9V A;  1GMY A;  1A6R A;  2YJB A;  3KWZ A;  3PW3 A;  1M6D A;  2ATO A;  2WBF X;  1YT7 A;  2HHN A;  1XKG A;  2XU5 A;  3GCB A;  1ZCM A;  2DC8 A;  3F5V A;  2DJG B;  1NLJ A;  1QDQ A;  1GCB A;  2FRA A;  3O1G A;  4PP1 A;  2PBH A;  3KX1 A;  3OIS A;  1EWO A;  3M99 A;  6PAD A;  3S3R A;  1ME3 A;  1MEM A;  7PCK A;  1K3B B;  1DF0 A;  1PXV A;  1NB5 A;  3AI8 A;  2FQ9 A;  2YJ2 A;  4CZW A;  1U9W A;  3KFQ A;  2BDZ A;  3P5U A;  1NPZ A;  1EWL A;  1YK8 A;  2FYE A;  1CQD A;  1MEG A;  1CB5 A;  3H8C A;  3I06 A;  4W5B A;  4MZO A;  4N79 A;  4AXM A;  3WXE A;  2VHS A;  1F2B A;  3BC3 A;  1AEC A;  2AYO A;  2YJ8 A;  1PCI A;  4PP2 E;  4YYV A;  2FTD A;  2B1N A;  4BS6 A;  1AYU A;  2JQG R;  2AUX A;  3HHA A;  4KLB A;  3MHS A;  3N3G A;  2F7D A;  3N3K A;  2GHU A;  3CH3 X;  3USV A;  4YYR A;  2AVW A;  2H7J A;  3IUT A;  3KSE A;  2CB5 A;  3BPM A;  2NQG A;  1MIR A;  1YAL A;  1CS8 A;  1PPO A;  1BY8 A;  2ACT A;  3B79 A;  2DCC A;  2R9M A;  1VSN A;  1CSB B;  4W5C A;  2YJ9 A;  4FJC A;  1ZIV A;  3BCN A;  3C9E A;  1KHP A;  3HWN A;  2HH5 A;  2P86 A;  4YYQ A;  4MSX A;  1YK7 A;  3IHP A;  4YV8 A;  1S4V A;  1MDW A;  2C0Y A;  2E01 A;  1JQP A;  1F2A A;  3P5W A;  2DZY A;  1X9Y A;  2ARY A;  4XUI A;  1PPN A;  5PAD A;  1F2C A;  5J94 A;  2DZZ A;  3WXF A;  3IV2 A;  4ZUX U;  3F75 A;  3LFY A;  2OZ2 A;  4BS5 A;  1GLO A;  4I05 A;  2OUL A;  4QRX A;  4N4Z A;  1QMY A;  1KFX L;  4OEM A;  1SP4 B;  4CDE B;  4QBB A;  3OVZ A;  1KFU L;  2AUZ A;  1DEU A;  1BP4 A;  2R9C A;  3V6C A;  5CHV A;  2DJF B;  1TLO A;  1EWP A;  4YVA A;  1BQI A;  1AU4 A;  1AYW A;  4PAD A;  3S3Q A;  3IMA A;  4MZS A;  1O0E A;  4CDC B;  2NQA A;  3H8B A;  1NQC A;  1AIM A;  4Q8H A;  3LXS A;  3KKU A;  8PCH A;  1QXP A;  3IEJ A;  4WA6 A;  1POP A;  2F1G A;  1NL6 A;  3U8E A;  4YYW A;  3RVX A;  5JA7 A;  5CVN B;  3ZUA A;  1TU6 A;  3H6S A;  1PBH A;  2G6D A;  4BQV A;  4BPV A;  4W4U A;  2Y5B A;  4CDF B;  2R9N A;  2HXZ A;  1HUC B;  2AU1 A;  3K9M A;  2O6X A;  3KWB X;  2XU1 A;  3E1Z B; 
#chains in the Genus database with same CATH topology
 1F29 A;  1Q6K A;  4FK5 A;  2Y6E A;  2J7Q C;  2FUD A;  1STF E;  5K16 A;  3MP2 A;  4P6G A;  2AIM A;  3WXG A;  4BOP A;  4BSQ A;  4D8B A;  4K7C A;  1CPJ A;  1FH0 A;  1PIP A;  3N4C A;  3O0U A;  4RY2 A;  2PAD A;  4BOS A;  5CVM A;  4PT5 A;  4AXL A;  4RF1 A;  1PE6 A;  2DC7 A;  3CH2 X;  1ATK A;  2DCD A;  2NQD B;  1QOL A;  1TL9 A;  3IOQ A;  1EF7 A;  5JH3 A;  3BY4 A;  2XU3 A;  4I07 A;  3RVV A;  2FO5 A;  4IP3 A;  1ITO A;  1PPD A;  1PPP A;  3KW9 A;  3RVW A;  1AU2 A;  9PAP A;  4X6I A;  2P7U A;  2PNS A;  2DCB A;  3TNX A;  1CTE A;  2YJC A;  1BGO A;  3TRK A;  2G7Y A;  3W30 A;  1CV8 A;  4QH6 A;  1U5I A;  2B1M A;  3PHX A;  1KXR A;  3MTN A;  3NHE A;  2DC9 A;  3I3T A;  4G54 A;  1YVB A;  1EWM A;  4WUR A;  2AYN A;  2R6N A;  3CBJ A;  1U9Q X;  3OF9 A;  3HHI A;  4N8W A;  4X6J A;  5F02 A;  3ERV A;  3IFU A;  2G8E A;  3PSE A;  3P5V A;  3V6E A;  2BDL A;  1NB3 A;  2OP3 A;  3H89 A;  4YYS A;  3W31 A;  1U9X A;  4PI3 A;  5FPW A;  3QJ3 A;  2R9O A;  2AS8 A;  2DOS A;  4I04 A;  1MHW A;  1GEC E;  3PHU A;  4X6H A;  2JQF R;  4OW0 A;  2R9F A;  4ZTB A;  4CDD B;  2HD5 A;  1AU3 A;  2VHF A;  3ZNH A;  4DMX A;  3DF0 A;  2FRQ A;  3MJ5 A;  4OEL A;  3MOR A;  2GFO A;  2PRE A;  2P0R A;  1CVZ A;  1AYV A;  5CHT A;  1ICF A;  4QRG A;  1YZB A;  4P6E A;  1IWD A;  5EF4 A;  3MHH A;  2DCA A;  1KHQ A;  2DC6 A;  3PNR A;  3P5X A;  3H7D A;  2IBI A;  2E03 A;  5E6J A;  3BOW A;  3PBH A;  4Q8G A;  1THE A;  4FIP A;  2CIO A;  2FT2 A;  3K24 A;  3QSD A;  1PAD A;  2IPP B;  1AU0 A;  3C0R A;  3CBK A;  2JTC A;  1SNK A;  3BWK A;  3PT2 A;  1Y08 A;  5EGW A;  4BOU A;  4OVZ A;  4QRV A;  4XR7 A;  4XZX A;  3D6S A;  5A24 A;  5CVO B;  1CJL A;  4D8I A;  3OF8 A;  3BPF A;  3PDF A;  2G8J A;  3HD3 A;  3K8U A;  2NQI A;  3OVX A;  1Y4H A;  2XU4 A;  3BB7 A;  3QT4 A;  4YYU A;  1ME4 A;  1VJV A;  4DMY A;  2E00 A;  1MS6 A;  2E02 A;  4HWY A;  1U9V A;  1GMY A;  1A6R A;  2YJB A;  3KWZ A;  4OVZ B;  3PW3 A;  1M6D A;  2ATO A;  2WBF X;  5KO3 A;  1YT7 A;  4HXD B;  2HHN A;  1XKG A;  2XU5 A;  3GCB A;  1ZCM A;  2DC8 A;  3F5V A;  2DJG B;  2FE8 A;  1NLJ A;  1QDQ A;  4M0W A;  1GCB A;  2FRA A;  4A5U A;  3O1G A;  3O65 A;  4BOZ A;  5JZE A;  4PP1 A;  2PBH A;  3KX1 A;  3OIS A;  1EWO A;  3M99 A;  6PAD A;  3S3R A;  1ME3 A;  5EZS A;  1MEM A;  7PCK A;  1K3B B;  1DF0 A;  1PXV A;  2J7Q A;  1NB5 A;  3AI8 A;  3PRP A;  2FQ9 A;  2YJ2 A;  4CZW A;  1U9W A;  3KFQ A;  3BBA A;  2BDZ A;  3P5U A;  1NPZ A;  1EWL A;  1YK8 A;  2FYE A;  1CQD A;  1MEG A;  1CB5 A;  3H8C A;  3I06 A;  4W5B A;  4RF0 A;  4MZO A;  4N79 A;  4AXM A;  3WXE A;  2VHS A;  1F2B A;  3BC3 A;  1AEC A;  2AYO A;  2YJ8 A;  1PCI A;  4PP2 E;  4YYV A;  3TMP A;  4RNA A;  4BOQ A;  2FTD A;  2B1N A;  4BS6 A;  1AYU A;  2JQG R;  2AUX A;  2BTW A;  2AGA A;  4R3D A;  3HHA A;  4KLB A;  3MHS A;  3N3G A;  2F7D A;  3N3K A;  2GHU A;  3CH3 X;  3USV A;  4YYR A;  2AVW A;  2H7J A;  3IUT A;  3KSE A;  2CB5 A;  2Z84 A;  3BPM A;  2BTW B;  2NQG A;  1MIR A;  1YAL A;  1CS8 A;  1DKI A;  1PPO A;  1BY8 A;  2ACT A;  3B79 A;  2DCC A;  2R9M A;  1VSN A;  1CSB B;  4W5C A;  2YJ9 A;  4FJC A;  1ZIV A;  3OQC A;  2BU3 A;  3BCN A;  3C9E A;  1KHP A;  3HWN A;  2HH5 A;  2P86 A;  3RNV A;  4YYQ A;  4MSX A;  1YK7 A;  3IHP A;  4YV8 A;  1S4V A;  1MDW A;  2C0Y A;  3PRM A;  2E01 A;  1JQP A;  1F2A A;  3P5W A;  4GUA A;  2DZY A;  1X9Y A;  2UZJ A;  2JRI A;  2ARY A;  4XUI A;  1PPN A;  5PAD A;  1PVJ A;  1F2C A;  5J94 A;  4P16 A;  2DZZ A;  3WXF A;  3IV2 A;  4ZUX U;  3F75 A;  3LFY A;  2OZ2 A;  4BS5 A;  1GLO A;  4I05 A;  2OUL A;  5EZQ A;  4QRX A;  4N4Z A;  1QMY A;  1KFX L;  4OEM A;  3MTV A;  1SP4 B;  4CDE B;  4QBB A;  3E9S A;  3OVZ A;  1KFU L;  2AUZ A;  1DEU A;  1BP4 A;  2R9C A;  3V6C A;  5CHV A;  2DJF B;  1TLO A;  4MI7 A;  1EWP A;  1UKF A;  4YVA A;  1BQI A;  1AU4 A;  1AYW A;  4PAD A;  3S3Q A;  3IMA A;  4MZS A;  1O0E A;  4CDC B;  4RKX A;  2NQA A;  3H8B A;  1NQC A;  1AIM A;  3B21 A;  4IUM A;  3PHW A;  4Q8H A;  3LXS A;  3KKU A;  8PCH A;  1QXP A;  3IEJ A;  4WA6 A;  1POP A;  2F1G A;  4D8E A;  1NL6 A;  3U8E A;  4YYW A;  3RVX A;  2HWK A;  5JA7 A;  5CVN B;  3ZUA A;  1TU6 A;  3H6S A;  1PBH A;  4MM3 B;  2G6D A;  4BQV A;  4BPV A;  4W4U A;  2Y5B A;  4CDF B;  2R9N A;  2HXZ A;  1HUC B;  2AU1 A;  3K9M A;  2O6X A;  3KWB X;  2XU1 A;  4REZ A;  3E1Z B; 
#chains in the Genus database with same CATH homology
 1F29 A;  1Q6K A;  4FK5 A;  2Y6E A;  2FUD A;  3LTW A;  1STF E;  5K16 A;  4P6G A;  2AIM A;  3WXG A;  4BSQ A;  4K7C A;  1CPJ A;  1FH0 A;  1PIP A;  3N4C A;  3O0U A;  4RY2 A;  2PAD A;  5CVM A;  4AXL A;  1PE6 A;  2DC7 A;  3CH2 X;  1ATK A;  2DCD A;  1GX3 A;  2NQD B;  1QOL A;  1TL9 A;  3IOQ A;  1EF7 A;  5JH3 A;  2BSZ A;  2XU3 A;  4I07 A;  3RVV A;  2FO5 A;  1ITO A;  1PPD A;  1PPP A;  3KW9 A;  3RVW A;  1AU2 A;  9PAP A;  4X6I A;  2P7U A;  2PNS A;  2DCB A;  3TNX A;  1CTE A;  2YJC A;  1BGO A;  2G7Y A;  1CV8 A;  4QH6 A;  1U5I A;  2B1M A;  1KXR A;  4NV7 A;  3MTN A;  3NHE A;  2DC9 A;  3I3T A;  4G54 A;  1YVB A;  1EWM A;  2AYN A;  2R6N A;  3CBJ A;  1U9Q X;  3OF9 A;  3HHI A;  4N8W A;  4X6J A;  5F02 A;  3ERV A;  2G8E A;  3P5V A;  3V6E A;  2BDL A;  1NB3 A;  2OP3 A;  3H89 A;  4YYS A;  1U9X A;  4PI3 A;  5FPW A;  3QJ3 A;  2R9O A;  2AS8 A;  4I04 A;  1MHW A;  1GEC E;  4X6H A;  2JQF R;  2R9F A;  4CDD B;  2HD5 A;  4GUZ A;  1AU3 A;  2VHF A;  4BGF A;  4DMX A;  3DF0 A;  2FRQ A;  4OEL A;  3MOR A;  2GFO A;  2PRE A;  2P0R A;  1CVZ A;  1AYV A;  5CHT A;  1ICF A;  4QRG A;  4P6E A;  1IWD A;  5EF4 A;  3MHH A;  2DCA A;  1KHQ A;  2DC6 A;  3PNR A;  3P5X A;  3H7D A;  2IBI A;  2E03 A;  3BOW A;  3PBH A;  4Q8G A;  1THE A;  4FIP A;  2CIO A;  2FT2 A;  3K24 A;  3QSD A;  1PAD A;  2IPP B;  1AU0 A;  3CBK A;  1SNK A;  3BWK A;  1Y08 A;  5EGW A;  4QRV A;  4XR7 A;  3D6S A;  5A24 A;  5CVO B;  1CJL A;  3OF8 A;  3BPF A;  3PDF A;  1W5R A;  2G8J A;  3HD3 A;  3K8U A;  2NQI A;  3OVX A;  1Y4H A;  2XU4 A;  3QT4 A;  4YYU A;  1ME4 A;  1VJV A;  4DMY A;  2E00 A;  1MS6 A;  2E02 A;  4HWY A;  1U9V A;  1GMY A;  1A6R A;  2YJB A;  3KWZ A;  3PW3 A;  1M6D A;  2ATO A;  2VFB A;  2WBF X;  1YT7 A;  2HHN A;  1XKG A;  2XU5 A;  3GCB A;  1ZCM A;  2DC8 A;  3F5V A;  2DJG B;  1NLJ A;  1QDQ A;  1GCB A;  2FRA A;  3O1G A;  4B55 A;  4PP1 A;  2PBH A;  3KX1 A;  3OIS A;  1EWO A;  3M99 A;  6PAD A;  3S3R A;  1ME3 A;  1MEM A;  7PCK A;  1K3B B;  1DF0 A;  1PXV A;  1E2T A;  1NB5 A;  3AI8 A;  2FQ9 A;  2YJ2 A;  4CZW A;  1U9W A;  3KFQ A;  2BDZ A;  3P5U A;  2VFC A;  1NPZ A;  1EWL A;  1YK8 A;  2FYE A;  1CQD A;  1MEG A;  1CB5 A;  3H8C A;  3I06 A;  4W5B A;  4MZO A;  4N79 A;  4AXM A;  3WXE A;  2VHS A;  1F2B A;  3BC3 A;  1W4T A;  1AEC A;  2AYO A;  2YJ8 A;  1PCI A;  4PP2 E;  4YYV A;  2FTD A;  2B1N A;  4BS6 A;  1AYU A;  2JQG R;  2AUX A;  3HHA A;  4KLB A;  3MHS A;  3N3G A;  2F7D A;  3N3K A;  2GHU A;  3CH3 X;  3USV A;  4YYR A;  2AVW A;  2H7J A;  3IUT A;  3KSE A;  2CB5 A;  3BPM A;  2NQG A;  1MIR A;  1YAL A;  1CS8 A;  1PPO A;  1BY8 A;  2ACT A;  3B79 A;  2DCC A;  2R9M A;  1VSN A;  1CSB B;  4W5C A;  2YJ9 A;  4FJC A;  1ZIV A;  3BCN A;  3C9E A;  1KHP A;  3HWN A;  2HH5 A;  2P86 A;  4YYQ A;  4MSX A;  1YK7 A;  3IHP A;  4YV8 A;  1S4V A;  1MDW A;  2C0Y A;  2E01 A;  1JQP A;  1F2A A;  3P5W A;  2DZY A;  1X9Y A;  3D9W A;  2ARY A;  4XUI A;  1PPN A;  5PAD A;  1F2C A;  5J94 A;  2DZZ A;  3WXF A;  3IV2 A;  4ZUX U;  3F75 A;  3LFY A;  2OZ2 A;  4BS5 A;  1GLO A;  4I05 A;  2OUL A;  4QRX A;  4N4Z A;  1QMY A;  1KFX L;  4OEM A;  1SP4 B;  4CDE B;  4QBB A;  3OVZ A;  1KFU L;  2AUZ A;  1DEU A;  1BP4 A;  2R9C A;  3V6C A;  5CHV A;  2DJF B;  4C5P A;  1TLO A;  1EWP A;  4YVA A;  4NV8 A;  1BQI A;  1AU4 A;  1AYW A;  4PAD A;  3S3Q A;  3IMA A;  4MZS A;  1O0E A;  4CDC B;  2NQA A;  3H8B A;  1NQC A;  1AIM A;  4Q8H A;  3LXS A;  3KKU A;  8PCH A;  1QXP A;  1W6F A;  3IEJ A;  4WA6 A;  1POP A;  2F1G A;  1NL6 A;  3U8E A;  4YYW A;  3RVX A;  5JA7 A;  5CVN B;  3ZUA A;  1TU6 A;  3H6S A;  1PBH A;  2G6D A;  4BQV A;  4BPV A;  4W4U A;  2Y5B A;  4CDF B;  2R9N A;  2HXZ A;  1HUC B;  2AU1 A;  3K9M A;  2O6X A;  3KWB X;  2XU1 A;  3E1Z B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...