1YK8A

Cathepsin k complexed with a cyanamide-based inhibitor
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
213
structure length
213
Chain Sequence
DSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cathepsin K
publication title Acyclic cyanamide-based inhibitors of cathepsin K.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 62
structure length 213
sequence length 213
ec nomenclature ec 3.4.22.38: Cathepsin K.
pdb deposition date 2005-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1yk8A00
3OF9A 4K7CA 2NQAA 2G6DA 1PE6A 1CSBB 4CDCB 1U9WA 3KX1A 1YK8A 4P6EA 4N79A 2R9MA 3H6SA 4I04A 3CH3X 3GCBA 1CV8A 1AYWA 4QBBA 1GECE 2R6NA 1GCBA 2AIMA 2AVWA 1NLJA 5PADA 1PBHA 1CTEA 4BPVA 1AECA 1BGOA 1MDWA 3WXGA 4N4ZA 3MHSA 5J94A 3HD3A 1ITOA 2DC9A 2JQGR 1STFE 4BS5A 3MTNA 4QH6A 4Q8HA 2FRAA 2ATOA 3NHEA 3LFYA 4BS6A 1MEMA 1MEGA 2YJBA 5CVOB 1PPPA 3RVXA 2HHNA 1DF0A 2PADA 4BQVA 2WBFX 1ME3A 2B1MA 4W5BA 1DEUA 4YYWA 1THEA 2PBHA 1PIPA 4MZOA 1M6DA 1QDQA 4PP2E 1NB5A 4CDDB 3IUTA 1PXVA 4OEMA 2JQFR 2FYEA 3S3QA 4DMYA 1BY8A 4OELA 2OP3A 2DZZA 4FK5A 4CDEB 3E1ZB 4CZWA 3OISA 1U5IA 1F2BA 2PREA 4YYSA 2ACTA 1HUCB 3BPMA 1BP4A 3CH2X 2YJ8A 1Y4HA 2YJ2A 2IBIA 2VHSA 3QT4A 1Q6KA 4PP1A 2AU1A 4ZUXU 1EWLA 2E00A 1QMYA 1AYVA 2DC8A 2XU5A 2AS8A 1AU2A 2R9OA 5F02A 2FO5A 4I07A 2NQDB 2Y5BA 2OZ2A 3HWNA 4WA6A 1QOLA 2XU4A 3ERVA 1U9XA 2DC7A 1YVBA 3BOWA 1NL6A 3MORA 1AYUA 1KFUL 1SP4B 2R9NA 2FRQA 1MS6A 2Y6EA 4YYUA 3OVZA 3RVWA 3V6CA 3O0UA 1CJLA 2FUDA 5EF4A 4YVAA 1X9YA 1MIRA 4BSQA 3IEJA 3BWKA 4YYQA 3H8CA 2BDLA 4W5CA 5CVNB 1POPA 1EF7A 1KHQA 1ICFA 3I3TA 4MZSA 3P5UA 2BDZA 2AUZA 1MHWA 3CBJA 4RY2A 3QJ3A 4Q8GA 1FH0A 3BC3A 3K24A 3LXSA 4AXMA 1EWMA 1VJVA 3P5WA 3OF8A 3HHIA 2G8JA 3N4CA 3N3KA 3IMAA 4QRGA 1AU4A 1QXPA 4KLBA 5CVMA 1PPNA 1F2CA 2YJCA 1AU0A 1KFXL 2C0YA 1PCIA 3IOQA 2OULA 5CHVA 2NQIA 1SNKA 2YJ9A 3V6EA 4HWYA 5K16A 2E01A 3HHAA 5EGWA 4I05A 1NPZA 3B79A 4FJCA 1NB3A 1ME4A 2P7UA 3O1GA 4X6IA 1CS8A 1TU6A 3S3RA 1KXRA 1K3BB 2XU3A 4N8WA 1JQPA 2P86A 2B1NA 2CB5A 3PBHA 3WXFA 1PPOA 1ATKA 1TL9A 1GLOA 3P5XA 3U8EA 4W4UA 2GFOA 9PAPA 1KHPA 1VSNA 4G54A 2FTDA 3D6SA 2DJFB 1EWPA 5A24A 1U9VA 3PNRA 3C9EA 4PI3A 2DCBA 3H7DA 7PCKA 3P5VA 4QRXA 4DMXA 3KKUA 3KFQA 5CHTA 5JA7A 2DCCA 3BPFA 3RVVA 4XUIA 1TLOA 8PCHA 3TNXA 3OVXA 1GMYA 1PPDA 1ZIVA 1IWDA 1NQCA 3PW3A 2H7JA 2G7YA 3IV2A 5FPWA 3IHPA 3ZUAA 2FQ9A 3N3GA 4AXLA 3H8BA 1F29A 2ARYA 2HXZA 3AI8A 2G8EA 2HH5A 3QSDA 1F2AA 3I06A 3PDFA 2R9CA 1YK7A 1U9QX 2AYOA 2F7DA 4PADA 1EWOA 3KW9A 5JH3A 3MHHA 2HD5A 4MSXA 3M99A 2PNSA 6PADA 1AU3A 4FIPA 1AIMA 2AUXA 1CB5A 3K8UA 3F5VA 4QRVA 2O6XA 2F1GA 1XKGA 2VHFA 2DC6A 3CBKA 2AYNA 3DF0A 4X6JA 2FT2A 4XR7A 3KWBX 4YYRA 3BCNA 1YT7A 1Y08A 4YV8A 1CVZA 2DJGB 2R9FA 2P0RA 1CQDA 3F75A 3KSEA 1O0EA 1ZCMA 4X6HA 3WXEA 3USVA 2E02A 2E03A 2IPPB 2CIOA 4CDFB 1PADA 1YALA 2NQGA 3K9MA 1S4VA 1A6RA 3H89A 2XU1A 2GHUA 3KWZA 4YYVA 1CPJA 4P6GA 2DZYA 1BQIA 2DCAA 2DCDA
chains in the Genus database with same CATH superfamily
3OF9A 4K7CA 2NQAA 2G6DA 1PE6A 4IP3A 1CSBB 4CDCB 1U9WA 5EZSA 3KX1A 1YK8A 4P6EA 4N79A 2R9MA 3H6SA 4I04A 3CH3X 4M0WA 3GCBA 1CV8A 1AYWA 4QBBA 5JZEA 3TMPA 1GECE 2R6NA 2BTWA 1GCBA 1PVJA 2AIMA 3PRPA 2AVWA 4RNAA 1NLJA 5PADA 2HWKA 1PBHA 1CTEA 4BPVA 1AECA 1BGOA 1MDWA 2J7QC 3WXGA 4N4ZA 3MHSA 5J94A 3HD3A 1ITOA 2DC9A 2JQGR 1STFE 4BS5A 3MTNA 4QH6A 4Q8HA 2FRAA 2ATOA 4A5UA 3NHEA 3LFYA 4BS6A 1MEMA 1MEGA 2YJBA 5CVOB 4PT5A 1PPPA 3RVXA 2HHNA 1DF0A 2PADA 4BQVA 2WBFX 1ME3A 2B1MA 1UKFA 2BU3A 4W5BA 1DEUA 4YYWA 1THEA 2PBHA 1PIPA 4MZOA 1M6DA 1QDQA 4PP2E 1NB5A 4CDDB 3IUTA 1PXVA 4OEMA 2JQFR 2FYEA 3S3QA 4DMYA 1BY8A 4OELA 5E6JA 2OP3A 2DZZA 3RNVA 4FK5A 4CDEB 3E1ZB 4CZWA 3MP2A 3OISA 1U5IA 1F2BA 2PREA 4YYSA 2ACTA 1HUCB 3BPMA 1BP4A 3CH2X 2YJ8A 1Y4HA 2YJ2A 2IBIA 1YZBA 2VHSA 3QT4A 4BOZA 1Q6KA 4PP1A 2AU1A 4ZUXU 1EWLA 2E00A 1QMYA 2XU5A 1AYVA 2DC8A 2AS8A 1AU2A 2R9OA 2DOSA 5F02A 2FO5A 4I07A 4MI7A 2NQDB 2Y5BA 2OZ2A 3HWNA 4WA6A 4D8EA 1QOLA 2XU4A 3ERVA 1U9XA 2DC7A 1YVBA 3BOWA 1NL6A 3PHWA 3MORA 1AYUA 1KFUL 1SP4B 2R9NA 2FRQA 1MS6A 2Y6EA 4YYUA 3OVZA 3RVWA 3V6CA 3O0UA 1CJLA 2FUDA 5EF4A 4YVAA 1X9YA 1MIRA 4RF1A 4BSQA 3IEJA 3BWKA 4YYQA 3H8CA 2BDLA 4W5CA 5CVNB 1POPA 1EF7A 1KHQA 1ICFA 4BOQA 3I3TA 4MZSA 3P5UA 5EZQA 2BDZA 2AUZA 1MHWA 3CBJA 4RY2A 3QJ3A 4Q8GA 1FH0A 3BC3A 3OQCA 3K24A 3LXSA 4AXMA 1EWMA 4OVZB 1VJVA 3P5WA 3OF8A 3HHIA 2G8JA 3N4CA 4WURA 3N3KA 4BOPA 3IMAA 4QRGA 1AU4A 4XZXA 1QXPA 4KLBA 5CVMA 1PPNA 1F2CA 2YJCA 1AU0A 1KFXL 2C0YA 1PCIA 3IOQA 2OULA 5CHVA 3MJ5A 2NQIA 1SNKA 4D8IA 2YJ9A 3PHXA 3V6EA 3BB7A 3C0RA 4HWYA 5K16A 2E01A 3HHAA 5EGWA 4I05A 1NPZA 3B79A 4MM3B 2BTWB 4FJCA 1NB3A 3O65A 5KO3A 1ME4A 2P7UA 3O1GA 4X6IA 1CS8A 1TU6A 3BBAA 3S3RA 3TRKA 1KXRA 1K3BB 2XU3A 4N8WA 1JQPA 2P86A 2B1NA 2CB5A 3PBHA 3WXFA 4HXDB 1PPOA 3PRMA 1ATKA 1TL9A 1GLOA 3P5XA 3PT2A 3U8EA 4W4UA 2GFOA 9PAPA 1KHPA 1VSNA 4G54A 2FTDA 3D6SA 2DJFB 4RKXA 1EWPA 2J7QA 5A24A 1U9VA 3PNRA 3C9EA 4PI3A 2DCBA 3H7DA 7PCKA 3MTVA 3P5VA 4QRXA 4REZA 4DMXA 3KKUA 3KFQA 5CHTA 5JA7A 2DCCA 3BPFA 3RVVA 4XUIA 1TLOA 2UZJA 8PCHA 3TNXA 3OVXA 1GMYA 1PPDA 1ZIVA 1IWDA 1NQCA 3PW3A 2H7JA 2G7YA 2FE8A 4ZTBA 3IV2A 5FPWA 3IHPA 2AGAA 3ZUAA 2FQ9A 3N3GA 4AXLA 3H8BA 1F29A 4R3DA 2ARYA 2HXZA 3AI8A 3PHUA 3W31A 4BOUA 1DKIA 2G8EA 2HH5A 3QSDA 4IUMA 1F2AA 3I06A 3PDFA 2R9CA 1YK7A 1U9QX 2AYOA 2F7DA 4PADA 1EWOA 3KW9A 4P16A 5JH3A 3MHHA 2HD5A 4MSXA 3M99A 4D8BA 2PNSA 6PADA 1AU3A 4FIPA 1AIMA 2AUXA 3W30A 1CB5A 3K8UA 3F5VA 4QRVA 2O6XA 2F1GA 4GUAA 1XKGA 2VHFA 2DC6A 3CBKA 2AYNA 2JTCA 3DF0A 4X6JA 2FT2A 4XR7A 3KWBX 4YYRA 3BCNA 1YT7A 1Y08A 4YV8A 1CVZA 2DJGB 4BOSA 2R9FA 2P0RA 1CQDA 3F75A 3KSEA 1O0EA 1ZCMA 4X6HA 4RF0A 3WXEA 3USVA 4OVZA 2E02A 3B21A 3PSEA 2E03A 3IFUA 2IPPB 2CIOA 4CDFB 1PADA 1YALA 2NQGA 3K9MA 1S4VA 1A6RA 3H89A 4OW0A 2XU1A 2GHUA 3KWZA 2Z84A 4YYVA 1CPJA 3ZNHA 4P6GA 2DZYA 2JRIA 1BQIA 3BY4A 2DCAA 3E9SA 2DCDA
chains in the Genus database with same CATH topology
3OF9A 4K7CA 2NQAA 2G6DA 1PE6A 1CSBB 4CDCB 1U9WA 3KX1A 1YK8A 4P6EA 4N79A 2R9MA 3H6SA 4I04A 3CH3X 3GCBA 1CV8A 1AYWA 4QBBA 1GECE 2R6NA 1GCBA 2AIMA 2AVWA 1NLJA 5PADA 1PBHA 1CTEA 4BPVA 1AECA 1BGOA 1MDWA 3WXGA 4N4ZA 1E2TA 3MHSA 5J94A 3HD3A 1ITOA 2DC9A 2JQGR 1STFE 4BS5A 3MTNA 4QH6A 4BGFA 2FRAA 4Q8HA 2ATOA 3NHEA 3LFYA 4BS6A 1MEMA 1MEGA 2YJBA 5CVOB 1PPPA 3RVXA 2HHNA 1DF0A 2PADA 4BQVA 2WBFX 1ME3A 2B1MA 4W5BA 1DEUA 4YYWA 1THEA 2PBHA 1PIPA 4MZOA 1M6DA 1QDQA 4PP2E 1NB5A 4CDDB 3IUTA 1PXVA 4OEMA 2JQFR 2FYEA 3S3QA 2VFCA 4DMYA 1BY8A 4OELA 2OP3A 2DZZA 4FK5A 4CDEB 3E1ZB 4CZWA 3OISA 1U5IA 1F2BA 2PREA 4YYSA 2ACTA 1HUCB 3BPMA 1BP4A 3CH2X 2YJ8A 1Y4HA 2YJ2A 2IBIA 2VHSA 3QT4A 1Q6KA 4PP1A 2AU1A 4ZUXU 1EWLA 2E00A 1QMYA 1AYVA 2DC8A 2XU5A 2AS8A 1AU2A 2R9OA 5F02A 2FO5A 4I07A 2NQDB 2Y5BA 2OZ2A 3HWNA 4WA6A 1QOLA 2XU4A 3ERVA 1U9XA 2DC7A 1YVBA 3BOWA 1NL6A 3MORA 1AYUA 1KFUL 1SP4B 2R9NA 2FRQA 1MS6A 2Y6EA 4YYUA 3OVZA 3RVWA 3V6CA 3O0UA 1CJLA 2FUDA 5EF4A 4YVAA 1X9YA 1MIRA 4BSQA 3IEJA 3BWKA 4YYQA 3H8CA 2BDLA 4W5CA 5CVNB 1POPA 1EF7A 1KHQA 1ICFA 3I3TA 4MZSA 3P5UA 2BDZA 4NV8A 2AUZA 1MHWA 3CBJA 4RY2A 3QJ3A 4Q8GA 1FH0A 3BC3A 3K24A 3LXSA 4AXMA 1EWMA 1VJVA 3P5WA 4GUZA 3OF8A 3HHIA 2G8JA 3N4CA 3N3KA 3IMAA 4QRGA 1AU4A 1QXPA 4KLBA 5CVMA 1PPNA 1F2CA 2YJCA 1AU0A 1KFXL 2C0YA 1PCIA 3IOQA 2OULA 5CHVA 2NQIA 1SNKA 2YJ9A 3V6EA 4HWYA 3LTWA 5K16A 2E01A 3HHAA 5EGWA 4I05A 1NPZA 3B79A 4FJCA 1NB3A 1ME4A 2P7UA 3O1GA 4X6IA 1CS8A 1TU6A 3S3RA 1KXRA 1K3BB 2XU3A 2VFBA 4N8WA 1JQPA 2P86A 2B1NA 2CB5A 3PBHA 3WXFA 1PPOA 1ATKA 1TL9A 1GLOA 3P5XA 3U8EA 4W4UA 2GFOA 9PAPA 1KHPA 1VSNA 4G54A 2FTDA 3D6SA 2DJFB 1EWPA 5A24A 1U9VA 3PNRA 3C9EA 4PI3A 2DCBA 3H7DA 7PCKA 4C5PA 3P5VA 4QRXA 4DMXA 3KKUA 3KFQA 5CHTA 4NV7A 2DCCA 3BPFA 5JA7A 3RVVA 4XUIA 1TLOA 8PCHA 3TNXA 3OVXA 1GMYA 1PPDA 1ZIVA 1IWDA 1NQCA 3PW3A 2H7JA 2G7YA 3IV2A 5FPWA 3IHPA 4B55A 3ZUAA 2FQ9A 3N3GA 4AXLA 3H8BA 1F29A 2ARYA 2HXZA 3AI8A 3D9WA 2G8EA 2HH5A 3QSDA 1F2AA 3I06A 3PDFA 2R9CA 1YK7A 1U9QX 2AYOA 2F7DA 1W4TA 4PADA 1EWOA 3KW9A 5JH3A 3MHHA 2HD5A 4MSXA 3M99A 2PNSA 6PADA 1AU3A 4FIPA 1AIMA 2AUXA 3K8UA 1CB5A 3F5VA 1GX3A 4QRVA 2O6XA 2F1GA 1XKGA 2VHFA 2DC6A 3CBKA 2AYNA 3DF0A 4X6JA 2FT2A 4XR7A 3KWBX 4YYRA 3BCNA 1YT7A 1Y08A 4YV8A 1CVZA 2DJGB 2R9FA 2P0RA 1CQDA 3F75A 3KSEA 1O0EA 1W6FA 1ZCMA 4X6HA 3WXEA 3USVA 2E02A 2E03A 1W5RA 2IPPB 2CIOA 4CDFB 1PADA 1YALA 2NQGA 3K9MA 2BSZA 1S4VA 1A6RA 3H89A 2XU1A 2GHUA 3KWZA 4YYVA 1CPJA 4P6GA 2DZYA 1BQIA 2DCAA 2DCDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OF9 A;  4K7C A;  2NQA A;  2G6D A;  1PE6 A;  1CSB B;  4CDC B;  1U9W A;  3KX1 A;  1YK8 A;  4P6E A;  4N79 A;  2R9M A;  3H6S A;  4I04 A;  3CH3 X;  3GCB A;  1CV8 A;  1AYW A;  4QBB A;  1GEC E;  2R6N A;  1GCB A;  2AIM A;  2AVW A;  1NLJ A;  5PAD A;  1PBH A;  1CTE A;  4BPV A;  1AEC A;  1BGO A;  1MDW A;  3WXG A;  4N4Z A;  3MHS A;  5J94 A;  3HD3 A;  1ITO A;  2DC9 A;  2JQG R;  1STF E;  4BS5 A;  3MTN A;  4QH6 A;  4Q8H A;  2FRA A;  2ATO A;  3NHE A;  3LFY A;  4BS6 A;  1MEM A;  1MEG A;  2YJB A;  5CVO B;  1PPP A;  3RVX A;  2HHN A;  1DF0 A;  2PAD A;  4BQV A;  2WBF X;  1ME3 A;  2B1M A;  4W5B A;  1DEU A;  4YYW A;  1THE A;  2PBH A;  1PIP A;  4MZO A;  1M6D A;  1QDQ A;  4PP2 E;  1NB5 A;  4CDD B;  3IUT A;  1PXV A;  4OEM A;  2JQF R;  2FYE A;  3S3Q A;  4DMY A;  1BY8 A;  4OEL A;  2OP3 A;  2DZZ A;  4FK5 A;  4CDE B;  3E1Z B;  4CZW A;  3OIS A;  1U5I A;  1F2B A;  2PRE A;  4YYS A;  2ACT A;  1HUC B;  3BPM A;  1BP4 A;  3CH2 X;  2YJ8 A;  1Y4H A;  2YJ2 A;  2IBI A;  2VHS A;  3QT4 A;  1Q6K A;  4PP1 A;  2AU1 A;  4ZUX U;  1EWL A;  2E00 A;  1QMY A;  1AYV A;  2DC8 A;  2XU5 A;  2AS8 A;  1AU2 A;  2R9O A;  5F02 A;  2FO5 A;  4I07 A;  2NQD B;  2Y5B A;  2OZ2 A;  3HWN A;  4WA6 A;  1QOL A;  2XU4 A;  3ERV A;  1U9X A;  2DC7 A;  1YVB A;  3BOW A;  1NL6 A;  3MOR A;  1AYU A;  1KFU L;  1SP4 B;  2R9N A;  2FRQ A;  1MS6 A;  2Y6E A;  4YYU A;  3OVZ A;  3RVW A;  3V6C A;  3O0U A;  1CJL A;  2FUD A;  5EF4 A;  4YVA A;  1X9Y A;  1MIR A;  4BSQ A;  3IEJ A;  3BWK A;  4YYQ A;  3H8C A;  2BDL A;  4W5C A;  5CVN B;  1POP A;  1EF7 A;  1KHQ A;  1ICF A;  3I3T A;  4MZS A;  3P5U A;  2BDZ A;  2AUZ A;  1MHW A;  3CBJ A;  4RY2 A;  3QJ3 A;  4Q8G A;  1FH0 A;  3BC3 A;  3K24 A;  3LXS A;  4AXM A;  1EWM A;  1VJV A;  3P5W A;  3OF8 A;  3HHI A;  2G8J A;  3N4C A;  3N3K A;  3IMA A;  4QRG A;  1AU4 A;  1QXP A;  4KLB A;  5CVM A;  1PPN A;  1F2C A;  2YJC A;  1AU0 A;  1KFX L;  2C0Y A;  1PCI A;  3IOQ A;  2OUL A;  5CHV A;  2NQI A;  1SNK A;  2YJ9 A;  3V6E A;  4HWY A;  5K16 A;  2E01 A;  3HHA A;  5EGW A;  4I05 A;  1NPZ A;  3B79 A;  4FJC A;  1NB3 A;  1ME4 A;  2P7U A;  3O1G A;  4X6I A;  1CS8 A;  1TU6 A;  3S3R A;  1KXR A;  1K3B B;  2XU3 A;  4N8W A;  1JQP A;  2P86 A;  2B1N A;  2CB5 A;  3PBH A;  3WXF A;  1PPO A;  1ATK A;  1TL9 A;  1GLO A;  3P5X A;  3U8E A;  4W4U A;  2GFO A;  9PAP A;  1KHP A;  1VSN A;  4G54 A;  2FTD A;  3D6S A;  2DJF B;  1EWP A;  5A24 A;  1U9V A;  3PNR A;  3C9E A;  4PI3 A;  2DCB A;  3H7D A;  7PCK A;  3P5V A;  4QRX A;  4DMX A;  3KKU A;  3KFQ A;  5CHT A;  5JA7 A;  2DCC A;  3BPF A;  3RVV A;  4XUI A;  1TLO A;  8PCH A;  3TNX A;  3OVX A;  1GMY A;  1PPD A;  1ZIV A;  1IWD A;  1NQC A;  3PW3 A;  2H7J A;  2G7Y A;  3IV2 A;  5FPW A;  3IHP A;  3ZUA A;  2FQ9 A;  3N3G A;  4AXL A;  3H8B A;  1F29 A;  2ARY A;  2HXZ A;  3AI8 A;  2G8E A;  2HH5 A;  3QSD A;  1F2A A;  3I06 A;  3PDF A;  2R9C A;  1YK7 A;  1U9Q X;  2AYO A;  2F7D A;  4PAD A;  1EWO A;  3KW9 A;  5JH3 A;  3MHH A;  2HD5 A;  4MSX A;  3M99 A;  2PNS A;  6PAD A;  1AU3 A;  4FIP A;  1AIM A;  2AUX A;  1CB5 A;  3K8U A;  3F5V A;  4QRV A;  2O6X A;  2F1G A;  1XKG A;  2VHF A;  2DC6 A;  3CBK A;  2AYN A;  3DF0 A;  4X6J A;  2FT2 A;  4XR7 A;  3KWB X;  4YYR A;  3BCN A;  1YT7 A;  1Y08 A;  4YV8 A;  1CVZ A;  2DJG B;  2R9F A;  2P0R A;  1CQD A;  3F75 A;  3KSE A;  1O0E A;  1ZCM A;  4X6H A;  3WXE A;  3USV A;  2E02 A;  2E03 A;  2IPP B;  2CIO A;  4CDF B;  1PAD A;  1YAL A;  2NQG A;  3K9M A;  1S4V A;  1A6R A;  3H89 A;  2XU1 A;  2GHU A;  3KWZ A;  4YYV A;  1CPJ A;  4P6G A;  2DZY A;  1BQI A;  2DCA A;  2DCD A; 
#chains in the Genus database with same CATH topology
 3OF9 A;  4K7C A;  2NQA A;  2G6D A;  1PE6 A;  4IP3 A;  1CSB B;  4CDC B;  1U9W A;  5EZS A;  3KX1 A;  1YK8 A;  4P6E A;  4N79 A;  2R9M A;  3H6S A;  4I04 A;  3CH3 X;  4M0W A;  3GCB A;  1CV8 A;  1AYW A;  4QBB A;  5JZE A;  3TMP A;  1GEC E;  2R6N A;  2BTW A;  1GCB A;  1PVJ A;  2AIM A;  3PRP A;  2AVW A;  4RNA A;  1NLJ A;  5PAD A;  2HWK A;  1PBH A;  1CTE A;  4BPV A;  1AEC A;  1BGO A;  1MDW A;  2J7Q C;  3WXG A;  4N4Z A;  3MHS A;  5J94 A;  3HD3 A;  1ITO A;  2DC9 A;  2JQG R;  1STF E;  4BS5 A;  3MTN A;  4QH6 A;  4Q8H A;  2FRA A;  2ATO A;  4A5U A;  3NHE A;  3LFY A;  4BS6 A;  1MEM A;  1MEG A;  2YJB A;  5CVO B;  4PT5 A;  1PPP A;  3RVX A;  2HHN A;  1DF0 A;  2PAD A;  4BQV A;  2WBF X;  1ME3 A;  2B1M A;  1UKF A;  2BU3 A;  4W5B A;  1DEU A;  4YYW A;  1THE A;  2PBH A;  1PIP A;  4MZO A;  1M6D A;  1QDQ A;  4PP2 E;  1NB5 A;  4CDD B;  3IUT A;  1PXV A;  4OEM A;  2JQF R;  2FYE A;  3S3Q A;  4DMY A;  1BY8 A;  4OEL A;  5E6J A;  2OP3 A;  2DZZ A;  3RNV A;  4FK5 A;  4CDE B;  3E1Z B;  4CZW A;  3MP2 A;  3OIS A;  1U5I A;  1F2B A;  2PRE A;  4YYS A;  2ACT A;  1HUC B;  3BPM A;  1BP4 A;  3CH2 X;  2YJ8 A;  1Y4H A;  2YJ2 A;  2IBI A;  1YZB A;  2VHS A;  3QT4 A;  4BOZ A;  1Q6K A;  4PP1 A;  2AU1 A;  4ZUX U;  1EWL A;  2E00 A;  1QMY A;  2XU5 A;  1AYV A;  2DC8 A;  2AS8 A;  1AU2 A;  2R9O A;  2DOS A;  5F02 A;  2FO5 A;  4I07 A;  4MI7 A;  2NQD B;  2Y5B A;  2OZ2 A;  3HWN A;  4WA6 A;  4D8E A;  1QOL A;  2XU4 A;  3ERV A;  1U9X A;  2DC7 A;  1YVB A;  3BOW A;  1NL6 A;  3PHW A;  3MOR A;  1AYU A;  1KFU L;  1SP4 B;  2R9N A;  2FRQ A;  1MS6 A;  2Y6E A;  4YYU A;  3OVZ A;  3RVW A;  3V6C A;  3O0U A;  1CJL A;  2FUD A;  5EF4 A;  4YVA A;  1X9Y A;  1MIR A;  4RF1 A;  4BSQ A;  3IEJ A;  3BWK A;  4YYQ A;  3H8C A;  2BDL A;  4W5C A;  5CVN B;  1POP A;  1EF7 A;  1KHQ A;  1ICF A;  4BOQ A;  3I3T A;  4MZS A;  3P5U A;  5EZQ A;  2BDZ A;  2AUZ A;  1MHW A;  3CBJ A;  4RY2 A;  3QJ3 A;  4Q8G A;  1FH0 A;  3BC3 A;  3OQC A;  3K24 A;  3LXS A;  4AXM A;  1EWM A;  4OVZ B;  1VJV A;  3P5W A;  3OF8 A;  3HHI A;  2G8J A;  3N4C A;  4WUR A;  3N3K A;  4BOP A;  3IMA A;  4QRG A;  1AU4 A;  4XZX A;  1QXP A;  4KLB A;  5CVM A;  1PPN A;  1F2C A;  2YJC A;  1AU0 A;  1KFX L;  2C0Y A;  1PCI A;  3IOQ A;  2OUL A;  5CHV A;  3MJ5 A;  2NQI A;  1SNK A;  4D8I A;  2YJ9 A;  3PHX A;  3V6E A;  3BB7 A;  3C0R A;  4HWY A;  5K16 A;  2E01 A;  3HHA A;  5EGW A;  4I05 A;  1NPZ A;  3B79 A;  4MM3 B;  2BTW B;  4FJC A;  1NB3 A;  3O65 A;  5KO3 A;  1ME4 A;  2P7U A;  3O1G A;  4X6I A;  1CS8 A;  1TU6 A;  3BBA A;  3S3R A;  3TRK A;  1KXR A;  1K3B B;  2XU3 A;  4N8W A;  1JQP A;  2P86 A;  2B1N A;  2CB5 A;  3PBH A;  3WXF A;  4HXD B;  1PPO A;  3PRM A;  1ATK A;  1TL9 A;  1GLO A;  3P5X A;  3PT2 A;  3U8E A;  4W4U A;  2GFO A;  9PAP A;  1KHP A;  1VSN A;  4G54 A;  2FTD A;  3D6S A;  2DJF B;  4RKX A;  1EWP A;  2J7Q A;  5A24 A;  1U9V A;  3PNR A;  3C9E A;  4PI3 A;  2DCB A;  3H7D A;  7PCK A;  3MTV A;  3P5V A;  4QRX A;  4REZ A;  4DMX A;  3KKU A;  3KFQ A;  5CHT A;  5JA7 A;  2DCC A;  3BPF A;  3RVV A;  4XUI A;  1TLO A;  2UZJ A;  8PCH A;  3TNX A;  3OVX A;  1GMY A;  1PPD A;  1ZIV A;  1IWD A;  1NQC A;  3PW3 A;  2H7J A;  2G7Y A;  2FE8 A;  4ZTB A;  3IV2 A;  5FPW A;  3IHP A;  2AGA A;  3ZUA A;  2FQ9 A;  3N3G A;  4AXL A;  3H8B A;  1F29 A;  4R3D A;  2ARY A;  2HXZ A;  3AI8 A;  3PHU A;  3W31 A;  4BOU A;  1DKI A;  2G8E A;  2HH5 A;  3QSD A;  4IUM A;  1F2A A;  3I06 A;  3PDF A;  2R9C A;  1YK7 A;  1U9Q X;  2AYO A;  2F7D A;  4PAD A;  1EWO A;  3KW9 A;  4P16 A;  5JH3 A;  3MHH A;  2HD5 A;  4MSX A;  3M99 A;  4D8B A;  2PNS A;  6PAD A;  1AU3 A;  4FIP A;  1AIM A;  2AUX A;  3W30 A;  1CB5 A;  3K8U A;  3F5V A;  4QRV A;  2O6X A;  2F1G A;  4GUA A;  1XKG A;  2VHF A;  2DC6 A;  3CBK A;  2AYN A;  2JTC A;  3DF0 A;  4X6J A;  2FT2 A;  4XR7 A;  3KWB X;  4YYR A;  3BCN A;  1YT7 A;  1Y08 A;  4YV8 A;  1CVZ A;  2DJG B;  4BOS A;  2R9F A;  2P0R A;  1CQD A;  3F75 A;  3KSE A;  1O0E A;  1ZCM A;  4X6H A;  4RF0 A;  3WXE A;  3USV A;  4OVZ A;  2E02 A;  3B21 A;  3PSE A;  2E03 A;  3IFU A;  2IPP B;  2CIO A;  4CDF B;  1PAD A;  1YAL A;  2NQG A;  3K9M A;  1S4V A;  1A6R A;  3H89 A;  4OW0 A;  2XU1 A;  2GHU A;  3KWZ A;  2Z84 A;  4YYV A;  1CPJ A;  3ZNH A;  4P6G A;  2DZY A;  2JRI A;  1BQI A;  3BY4 A;  2DCA A;  3E9S A;  2DCD A; 
#chains in the Genus database with same CATH homology
 3OF9 A;  4K7C A;  2NQA A;  2G6D A;  1PE6 A;  1CSB B;  4CDC B;  1U9W A;  3KX1 A;  1YK8 A;  4P6E A;  4N79 A;  2R9M A;  3H6S A;  4I04 A;  3CH3 X;  3GCB A;  1CV8 A;  1AYW A;  4QBB A;  1GEC E;  2R6N A;  1GCB A;  2AIM A;  2AVW A;  1NLJ A;  5PAD A;  1PBH A;  1CTE A;  4BPV A;  1AEC A;  1BGO A;  1MDW A;  3WXG A;  4N4Z A;  1E2T A;  3MHS A;  5J94 A;  3HD3 A;  1ITO A;  2DC9 A;  2JQG R;  1STF E;  4BS5 A;  3MTN A;  4QH6 A;  4BGF A;  2FRA A;  4Q8H A;  2ATO A;  3NHE A;  3LFY A;  4BS6 A;  1MEM A;  1MEG A;  2YJB A;  5CVO B;  1PPP A;  3RVX A;  2HHN A;  1DF0 A;  2PAD A;  4BQV A;  2WBF X;  1ME3 A;  2B1M A;  4W5B A;  1DEU A;  4YYW A;  1THE A;  2PBH A;  1PIP A;  4MZO A;  1M6D A;  1QDQ A;  4PP2 E;  1NB5 A;  4CDD B;  3IUT A;  1PXV A;  4OEM A;  2JQF R;  2FYE A;  3S3Q A;  2VFC A;  4DMY A;  1BY8 A;  4OEL A;  2OP3 A;  2DZZ A;  4FK5 A;  4CDE B;  3E1Z B;  4CZW A;  3OIS A;  1U5I A;  1F2B A;  2PRE A;  4YYS A;  2ACT A;  1HUC B;  3BPM A;  1BP4 A;  3CH2 X;  2YJ8 A;  1Y4H A;  2YJ2 A;  2IBI A;  2VHS A;  3QT4 A;  1Q6K A;  4PP1 A;  2AU1 A;  4ZUX U;  1EWL A;  2E00 A;  1QMY A;  1AYV A;  2DC8 A;  2XU5 A;  2AS8 A;  1AU2 A;  2R9O A;  5F02 A;  2FO5 A;  4I07 A;  2NQD B;  2Y5B A;  2OZ2 A;  3HWN A;  4WA6 A;  1QOL A;  2XU4 A;  3ERV A;  1U9X A;  2DC7 A;  1YVB A;  3BOW A;  1NL6 A;  3MOR A;  1AYU A;  1KFU L;  1SP4 B;  2R9N A;  2FRQ A;  1MS6 A;  2Y6E A;  4YYU A;  3OVZ A;  3RVW A;  3V6C A;  3O0U A;  1CJL A;  2FUD A;  5EF4 A;  4YVA A;  1X9Y A;  1MIR A;  4BSQ A;  3IEJ A;  3BWK A;  4YYQ A;  3H8C A;  2BDL A;  4W5C A;  5CVN B;  1POP A;  1EF7 A;  1KHQ A;  1ICF A;  3I3T A;  4MZS A;  3P5U A;  2BDZ A;  4NV8 A;  2AUZ A;  1MHW A;  3CBJ A;  4RY2 A;  3QJ3 A;  4Q8G A;  1FH0 A;  3BC3 A;  3K24 A;  3LXS A;  4AXM A;  1EWM A;  1VJV A;  3P5W A;  4GUZ A;  3OF8 A;  3HHI A;  2G8J A;  3N4C A;  3N3K A;  3IMA A;  4QRG A;  1AU4 A;  1QXP A;  4KLB A;  5CVM A;  1PPN A;  1F2C A;  2YJC A;  1AU0 A;  1KFX L;  2C0Y A;  1PCI A;  3IOQ A;  2OUL A;  5CHV A;  2NQI A;  1SNK A;  2YJ9 A;  3V6E A;  4HWY A;  3LTW A;  5K16 A;  2E01 A;  3HHA A;  5EGW A;  4I05 A;  1NPZ A;  3B79 A;  4FJC A;  1NB3 A;  1ME4 A;  2P7U A;  3O1G A;  4X6I A;  1CS8 A;  1TU6 A;  3S3R A;  1KXR A;  1K3B B;  2XU3 A;  2VFB A;  4N8W A;  1JQP A;  2P86 A;  2B1N A;  2CB5 A;  3PBH A;  3WXF A;  1PPO A;  1ATK A;  1TL9 A;  1GLO A;  3P5X A;  3U8E A;  4W4U A;  2GFO A;  9PAP A;  1KHP A;  1VSN A;  4G54 A;  2FTD A;  3D6S A;  2DJF B;  1EWP A;  5A24 A;  1U9V A;  3PNR A;  3C9E A;  4PI3 A;  2DCB A;  3H7D A;  7PCK A;  4C5P A;  3P5V A;  4QRX A;  4DMX A;  3KKU A;  3KFQ A;  5CHT A;  4NV7 A;  2DCC A;  3BPF A;  5JA7 A;  3RVV A;  4XUI A;  1TLO A;  8PCH A;  3TNX A;  3OVX A;  1GMY A;  1PPD A;  1ZIV A;  1IWD A;  1NQC A;  3PW3 A;  2H7J A;  2G7Y A;  3IV2 A;  5FPW A;  3IHP A;  4B55 A;  3ZUA A;  2FQ9 A;  3N3G A;  4AXL A;  3H8B A;  1F29 A;  2ARY A;  2HXZ A;  3AI8 A;  3D9W A;  2G8E A;  2HH5 A;  3QSD A;  1F2A A;  3I06 A;  3PDF A;  2R9C A;  1YK7 A;  1U9Q X;  2AYO A;  2F7D A;  1W4T A;  4PAD A;  1EWO A;  3KW9 A;  5JH3 A;  3MHH A;  2HD5 A;  4MSX A;  3M99 A;  2PNS A;  6PAD A;  1AU3 A;  4FIP A;  1AIM A;  2AUX A;  3K8U A;  1CB5 A;  3F5V A;  1GX3 A;  4QRV A;  2O6X A;  2F1G A;  1XKG A;  2VHF A;  2DC6 A;  3CBK A;  2AYN A;  3DF0 A;  4X6J A;  2FT2 A;  4XR7 A;  3KWB X;  4YYR A;  3BCN A;  1YT7 A;  1Y08 A;  4YV8 A;  1CVZ A;  2DJG B;  2R9F A;  2P0R A;  1CQD A;  3F75 A;  3KSE A;  1O0E A;  1W6F A;  1ZCM A;  4X6H A;  3WXE A;  3USV A;  2E02 A;  2E03 A;  1W5R A;  2IPP B;  2CIO A;  4CDF B;  1PAD A;  1YAL A;  2NQG A;  3K9M A;  2BSZ A;  1S4V A;  1A6R A;  3H89 A;  2XU1 A;  2GHU A;  3KWZ A;  4YYV A;  1CPJ A;  4P6G A;  2DZY A;  1BQI A;  2DCA A;  2DCD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...