1ME3A

High resolution crystal structure analysis of cruzain non-covalently bound to a hydroxymethyl ketone inhibitor (ii)
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
215
structure length
215
Chain Sequence
APAAVDWRARGAVTAVKDQGQCGSCWAFSAIGNVECQWFLAGHPLTNLSEQMLVSCDKTDSGCSGGLMNNAFEWIVQENNGAVYTEDSYPYASGEGISPPCTTSGHTVGATITGHVELPQDEAQIAAWLAVNGPVAVAVDASSWMTYTGGVMTSCVSEQLDHGVLLVGYNDSAAVPYWIIKNSWTTQWGEEGYIRIAKGSNQCLVKEEASSAVVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of Reversible Ketone-based Inhibitors of the Cysteine Protease Cruzain
pubmed doi rcsb
source organism Trypanosoma cruzi
molecule tags Hydrolase
molecule keywords Cruzipain
total genus 63
structure length 215
sequence length 215
ec nomenclature ec 3.4.22.51: Cruzipain.
pdb deposition date 2002-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1me3A00
2CB5A 1KFXL 1YT7A 3BC3A 3BCNA 2DCBA 2NQDB 3BPFA 4XUIA 5K16A 2DCCA 1CPJA 3IMAA 1HUCB 5CHTA 3H6SA 4I07A 2E01A 2DJFB 3I3TA 3KFQA 3P5UA 4YYVA 3BOWA 4OELA 3CBJA 4QH6A 4QRGA 4PP1A 1CS8A 3ERVA 2DCDA 1Y08A 3IHPA 4G54A 2DJGB 2B1NA 2AYNA 4N79A 2ARYA 1CVZA 4W5BA 4PP2E 2P86A 3OF9A 1VJVA 1PCIA 2DC6A 7PCKA 4BQVA 2E00A 4YYWA 3MTNA 2O6XA 2AIMA 2OULA 3KW9A 1PBHA 1SP4B 3U8EA 3IOQA 3D6SA 1MS6A 1Y4HA 4RY2A 2HXZA 4BSQA 2NQIA 2PNSA 4ZUXU 2E02A 1AYUA 4W5CA 1QXPA 1MDWA 2FRQA 2FRAA 1MEMA 3IV2A 2BDZA 1CQDA 2WBFX 3V6EA 2XU4A 1FH0A 2FUDA 1MIRA 3B79A 3OISA 2NQGA 1ICFA 2GFOA 1CV8A 2YJ9A 2F7DA 1AU0A 2BDLA 1KFUL 1VSNA 2R6NA 3N4CA 1U9WA 1STFE 1NPZA 4OEMA 1POPA 2DC7A 1ME4A 3H8CA 3F5VA 1DF0A 1CTEA 2XU3A 3V6CA 3MORA 1IWDA 4MSXA 1DEUA 1U9XA 3WXFA 1Q6KA 4I04A 1BP4A 1QMYA 3P5VA 1EWMA 1AU2A 2P7UA 1QOLA 2NQAA 1CB5A 2PREA 9PAPA 3KWBX 5EGWA 1AECA 2YJBA 2AUZA 4WA6A 4YVAA 5CVOB 1O0EA 2R9OA 2PADA 4QBBA 1AIMA 1F2AA 4CDEB 3MHHA 3LXSA 3DF0A 4YV8A 1ZIVA 4PADA 5CVMA 2G7YA 1YALA 2XU5A 3MHSA 4FK5A 4X6JA 2Y5BA 3CH3X 1MEGA 3LFYA 3RVWA 5F02A 3ZUAA 4HWYA 3HHIA 3CH2X 2HD5A 1PXVA 2HHNA 2VHSA 2GHUA 1ME3A 4X6HA 4DMYA 4AXMA 4CZWA 3KKUA 4CDDB 2FO5A 3IUTA 5JA7A 1AU3A 2B1MA 1YVBA 3PBHA 2ACTA 3PDFA 3NHEA 2Y6EA 3I06A 1NB3A 1PE6A 2R9CA 1YK8A 3HD3A 3O1GA 1EWPA 4BS6A 3C9EA 3WXGA 2F1GA 3IEJA 2IPPB 2HH5A 2R9FA 3P5WA 1AYWA 4FIPA 2FT2A 1ATKA 1BQIA 1GLOA 1TLOA 1GMYA 3N3GA 3N3KA 3PNRA 1YK7A 3KX1A 5CHVA 3S3QA 1THEA 3E1ZB 3P5XA 2H7JA 4BPVA 5PADA 3GCBA 2FTDA 1ZCMA 2VHFA 4CDFB 3OF8A 2DZYA 1TU6A 1PPPA 1A6RA 1PADA 1CJLA 3OVXA 1F2BA 1ITOA 2P0RA 3M99A 8PCHA 1NQCA 3CBKA 4N8WA 2PBHA 3RVXA 3OVZA 4XR7A 2CIOA 3S3RA 3TNXA 4FJCA 1CSBB 4BS5A 1GCBA 2ATOA 1KXRA 6PADA 1AU4A 1KHQA 1BGOA 2JQFR 2XU1A 2DC8A 3F75A 4MZSA 2YJ2A 4CDCB 3K24A 5J94A 3QJ3A 2AUXA 3BWKA 4I05A 1BY8A 2OZ2A 1XKGA 3H7DA 2FQ9A 1S4VA 4DMXA 2DC9A 1GECE 1PPDA 1TL9A 4X6IA 2AS8A 2AVWA 4QRXA 5CVNB 1EWOA 3QT4A 1MHWA 3RVVA 2IBIA 3KWZA 3QSDA 2G6DA 2G8EA 1M6DA 3HWNA 1KHPA 4Q8HA 4KLBA 3O0UA 1NB5A 2YJCA 1SNKA 1PPNA 4N4ZA 3BPMA 4Q8GA 1EWLA 1EF7A 2YJ8A 2E03A 4PI3A 2FYEA 4YYRA 1U5IA 3K8UA 4P6EA 1JQPA 2OP3A 3H89A 2DCAA 4YYSA 1AYVA 1F2CA 2R9MA 1PIPA 3USVA 2C0YA 5FPWA 3PW3A 5A24A 4YYQA 4P6GA 1X9YA 2JQGR 4K7CA 3WXEA 1U9VA 2R9NA 1U9QX 4W4UA 3KSEA 4AXLA 2G8JA 5JH3A 4QRVA 1QDQA 1K3BB 1PPOA 3AI8A 1NL6A 3K9MA 3H8BA 4YYUA 5EF4A 3HHAA 2DZZA 2AU1A 2AYOA 4MZOA 1NLJA 1F29A
chains in the Genus database with same CATH superfamily
2CB5A 3PHUA 1KFXL 1YT7A 3BC3A 3BCNA 2DCBA 4OVZA 2NQDB 3BPFA 4XUIA 4IP3A 5K16A 2DCCA 1CPJA 3IMAA 1HUCB 2Z84A 5CHTA 4D8BA 3H6SA 4I07A 2E01A 4BOZA 2DJFB 2HWKA 3I3TA 3KFQA 3P5UA 4YYVA 3BOWA 3C0RA 4OELA 3CBJA 4QH6A 4QRGA 2BTWA 4PP1A 1CS8A 3ERVA 2DCDA 1Y08A 4GUAA 5JZEA 3IHPA 4G54A 2DJGB 2B1NA 2AYNA 4N79A 2ARYA 1CVZA 4W5BA 4PP2E 4BOPA 5EZSA 2P86A 3OF9A 1VJVA 1PCIA 2DC6A 7PCKA 4BQVA 2E00A 3W30A 4YYWA 3MTNA 4RKXA 2O6XA 2AIMA 2OULA 3KW9A 3W31A 1PBHA 1SP4B 3U8EA 3IOQA 3D6SA 1MS6A 4M0WA 1Y4HA 4RY2A 2HXZA 4BSQA 2NQIA 2J7QA 3B21A 4XZXA 2PNSA 4ZUXU 2E02A 2JRIA 1AYUA 4W5CA 1QXPA 1MDWA 2FRQA 2FRAA 1MEMA 3IV2A 2BDZA 3MTVA 1CQDA 2WBFX 4REZA 3V6EA 2XU4A 1FH0A 2FUDA 1MIRA 3B79A 3MP2A 3OISA 1ICFA 2NQGA 2GFOA 1CV8A 2YJ9A 2F7DA 1AU0A 2BDLA 1KFUL 1VSNA 2R6NA 2DOSA 3N4CA 1U9WA 3OQCA 1STFE 1NPZA 4OEMA 1POPA 2DC7A 1ME4A 3PRMA 5E6JA 3H8CA 3F5VA 4MM3B 1DF0A 1CTEA 2XU3A 3V6CA 3MORA 4IUMA 1IWDA 4MSXA 4BOUA 2J7QC 1DEUA 1U9XA 3WXFA 1Q6KA 4I04A 1BP4A 1QMYA 3P5VA 1EWMA 3RNVA 1AU2A 2P7UA 1QOLA 2NQAA 1CB5A 2PREA 9PAPA 2FE8A 3KWBX 5EZQA 5EGWA 1AECA 2YJBA 2AUZA 4WA6A 4YVAA 4RNAA 5CVOB 1O0EA 2R9OA 2PADA 4QBBA 1AIMA 1F2AA 4CDEB 3MHHA 1PVJA 3LXSA 3ZNHA 3DF0A 4YV8A 1ZIVA 4PADA 5CVMA 2G7YA 1YALA 2XU5A 3MHSA 4FK5A 4X6JA 2Y5BA 3CH3X 1MEGA 3LFYA 3RVWA 1YZBA 5F02A 3ZUAA 4A5UA 4HWYA 3HHIA 3CH2X 4R3DA 2HD5A 1PXVA 2HHNA 2VHSA 2GHUA 1ME3A 4X6HA 4DMYA 4AXMA 4CZWA 3KKUA 4CDDB 2FO5A 3IUTA 5JA7A 4OW0A 1AU3A 2B1MA 1YVBA 3PBHA 2ACTA 3PDFA 4D8EA 3NHEA 2Y6EA 4D8IA 3I06A 1NB3A 1PE6A 2BTWB 2R9CA 4HXDB 2JTCA 1YK8A 3HD3A 3O1GA 1EWPA 4BS6A 3C9EA 3IFUA 4BOQA 3BB7A 3WXGA 2F1GA 3IEJA 2IPPB 2HH5A 2R9FA 3P5WA 1AYWA 4FIPA 2FT2A 1ATKA 1BQIA 4MI7A 1GLOA 3PT2A 1TLOA 1GMYA 3N3GA 4WURA 3N3KA 3PNRA 1YK7A 3KX1A 5CHVA 3S3QA 1THEA 2UZJA 3E1ZB 3P5XA 2H7JA 4BPVA 5PADA 3GCBA 2FTDA 3E9SA 1ZCMA 2VHFA 4CDFB 3OF8A 3BBAA 2DZYA 4OVZB 1TU6A 1PPPA 1A6RA 1PADA 4RF0A 1CJLA 2AGAA 3OVXA 1F2BA 1ITOA 2P0RA 3M99A 8PCHA 1NQCA 3CBKA 3TRKA 4N8WA 2PBHA 3PSEA 3RVXA 3OVZA 4XR7A 2CIOA 3S3RA 3TNXA 4FJCA 1CSBB 4BS5A 1GCBA 2ATOA 1KXRA 6PADA 1AU4A 1KHQA 1BGOA 2JQFR 4BOSA 4RF1A 2XU1A 1UKFA 2DC8A 3F75A 4MZSA 2YJ2A 4ZTBA 4CDCB 3K24A 3MJ5A 5J94A 3QJ3A 2AUXA 1DKIA 3BWKA 4I05A 1BY8A 2OZ2A 1XKGA 3PHWA 3PRPA 3H7DA 2FQ9A 1S4VA 4DMXA 2DC9A 1GECE 1PPDA 1TL9A 4X6IA 2AS8A 2AVWA 4QRXA 5CVNB 1EWOA 3QT4A 1MHWA 3RVVA 3PHXA 2IBIA 3KWZA 3QSDA 2G6DA 2G8EA 1M6DA 3HWNA 1KHPA 4Q8HA 4KLBA 3O0UA 1NB5A 2YJCA 1SNKA 1PPNA 3BY4A 4N4ZA 3BPMA 4Q8GA 1EWLA 5KO3A 1EF7A 3O65A 2YJ8A 2E03A 4PI3A 2FYEA 4YYRA 1U5IA 3K8UA 4P6EA 1JQPA 2OP3A 3H89A 2DCAA 4YYSA 1AYVA 1F2CA 2R9MA 1PIPA 3USVA 2C0YA 3TMPA 5FPWA 3PW3A 5A24A 4YYQA 4P6GA 1X9YA 2JQGR 4K7CA 3WXEA 4P16A 1U9VA 2R9NA 1U9QX 4W4UA 3KSEA 4AXLA 2G8JA 5JH3A 4QRVA 1QDQA 1K3BB 1PPOA 3AI8A 1NL6A 2BU3A 4PT5A 3K9MA 3H8BA 4YYUA 5EF4A 3HHAA 2DZZA 2AU1A 2AYOA 4MZOA 1NLJA 1F29A
chains in the Genus database with same CATH topology
2CB5A 1KFXL 1YT7A 3BC3A 3BCNA 2DCBA 2NQDB 3BPFA 1GX3A 4XUIA 5K16A 2DCCA 1CPJA 3IMAA 1HUCB 5CHTA 3H6SA 4I07A 2E01A 2DJFB 3I3TA 3KFQA 3P5UA 4YYVA 3BOWA 4OELA 3CBJA 4QH6A 2VFCA 4QRGA 4PP1A 1CS8A 3ERVA 2DCDA 1Y08A 3IHPA 4G54A 2DJGB 2B1NA 2AYNA 4N79A 2ARYA 1CVZA 4W5BA 4PP2E 2P86A 3OF9A 1VJVA 1PCIA 2DC6A 7PCKA 4BQVA 2E00A 1W6FA 4YYWA 3MTNA 2O6XA 2AIMA 2OULA 3KW9A 1PBHA 1SP4B 3U8EA 3IOQA 3D6SA 1MS6A 1Y4HA 4RY2A 2HXZA 4BSQA 2NQIA 2PNSA 4ZUXU 2E02A 1AYUA 4W5CA 1QXPA 1MDWA 2FRQA 2FRAA 1MEMA 4GUZA 3IV2A 2BDZA 3LTWA 1CQDA 2WBFX 3V6EA 2XU4A 1FH0A 1W5RA 2FUDA 1MIRA 3B79A 3OISA 2NQGA 1ICFA 2GFOA 1CV8A 2YJ9A 2F7DA 1AU0A 2BDLA 1KFUL 1VSNA 2R6NA 3N4CA 1U9WA 1STFE 1NPZA 4OEMA 1POPA 2DC7A 1ME4A 3H8CA 3F5VA 1DF0A 1CTEA 2XU3A 3V6CA 3MORA 1IWDA 4MSXA 1W4TA 1DEUA 1U9XA 3WXFA 1Q6KA 4I04A 1BP4A 1QMYA 3P5VA 1EWMA 1AU2A 2P7UA 1QOLA 2NQAA 1CB5A 2PREA 9PAPA 3KWBX 5EGWA 1AECA 2YJBA 2AUZA 4WA6A 4YVAA 5CVOB 1O0EA 2R9OA 2PADA 4QBBA 1AIMA 1F2AA 4CDEB 3MHHA 3LXSA 3DF0A 4YV8A 1ZIVA 4PADA 5CVMA 2G7YA 1YALA 2XU5A 3MHSA 4FK5A 4X6JA 2Y5BA 3CH3X 1MEGA 3LFYA 3RVWA 5F02A 3ZUAA 4HWYA 3HHIA 3CH2X 2HD5A 1PXVA 2HHNA 2VHSA 2GHUA 1ME3A 4X6HA 4DMYA 2BSZA 4AXMA 4CZWA 3KKUA 4CDDB 2FO5A 3IUTA 5JA7A 1AU3A 2B1MA 1YVBA 3PBHA 2ACTA 3PDFA 3NHEA 2Y6EA 3I06A 1NB3A 1PE6A 2R9CA 1YK8A 3HD3A 3O1GA 1EWPA 4BS6A 3C9EA 3WXGA 2F1GA 3IEJA 2IPPB 2HH5A 2R9FA 3P5WA 1AYWA 4FIPA 2FT2A 1ATKA 1BQIA 1GLOA 2VFBA 4BGFA 1TLOA 1GMYA 3N3GA 3N3KA 3PNRA 1YK7A 3KX1A 5CHVA 3S3QA 1THEA 3E1ZB 3P5XA 2H7JA 4BPVA 5PADA 3GCBA 2FTDA 1ZCMA 2VHFA 4CDFB 3OF8A 2DZYA 1TU6A 1PPPA 1A6RA 4B55A 1PADA 1CJLA 3OVXA 1F2BA 1ITOA 2P0RA 4C5PA 3M99A 8PCHA 1NQCA 3CBKA 4N8WA 2PBHA 3RVXA 3OVZA 4XR7A 2CIOA 3S3RA 3TNXA 4FJCA 1CSBB 3D9WA 4BS5A 1GCBA 2ATOA 1KXRA 6PADA 1AU4A 1KHQA 1BGOA 2JQFR 2XU1A 2DC8A 3F75A 4MZSA 2YJ2A 4CDCB 3K24A 5J94A 3QJ3A 2AUXA 3BWKA 4I05A 1BY8A 2OZ2A 1XKGA 3H7DA 2FQ9A 1S4VA 4DMXA 2DC9A 1GECE 1PPDA 1TL9A 4X6IA 2AS8A 2AVWA 4QRXA 5CVNB 1EWOA 3QT4A 1MHWA 3RVVA 2IBIA 3KWZA 3QSDA 2G6DA 2G8EA 1M6DA 4NV7A 3HWNA 1KHPA 4Q8HA 4KLBA 3O0UA 1NB5A 2YJCA 1SNKA 1PPNA 4N4ZA 3BPMA 4Q8GA 1EWLA 1EF7A 2YJ8A 2E03A 4PI3A 2FYEA 4NV8A 4YYRA 1U5IA 3K8UA 4P6EA 1JQPA 2OP3A 3H89A 2DCAA 4YYSA 1AYVA 1F2CA 2R9MA 1PIPA 3USVA 2C0YA 5FPWA 3PW3A 5A24A 4YYQA 1E2TA 4P6GA 1X9YA 2JQGR 4K7CA 3WXEA 1U9VA 2R9NA 1U9QX 4W4UA 3KSEA 4AXLA 2G8JA 5JH3A 4QRVA 1QDQA 1K3BB 1PPOA 3AI8A 1NL6A 3K9MA 3H8BA 4YYUA 5EF4A 3HHAA 2DZZA 2AU1A 2AYOA 4MZOA 1NLJA 1F29A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CB5 A;  1KFX L;  1YT7 A;  3BC3 A;  3BCN A;  2DCB A;  2NQD B;  3BPF A;  4XUI A;  5K16 A;  2DCC A;  1CPJ A;  3IMA A;  1HUC B;  5CHT A;  3H6S A;  4I07 A;  2E01 A;  2DJF B;  3I3T A;  3KFQ A;  3P5U A;  4YYV A;  3BOW A;  4OEL A;  3CBJ A;  4QH6 A;  4QRG A;  4PP1 A;  1CS8 A;  3ERV A;  2DCD A;  1Y08 A;  3IHP A;  4G54 A;  2DJG B;  2B1N A;  2AYN A;  4N79 A;  2ARY A;  1CVZ A;  4W5B A;  4PP2 E;  2P86 A;  3OF9 A;  1VJV A;  1PCI A;  2DC6 A;  7PCK A;  4BQV A;  2E00 A;  4YYW A;  3MTN A;  2O6X A;  2AIM A;  2OUL A;  3KW9 A;  1PBH A;  1SP4 B;  3U8E A;  3IOQ A;  3D6S A;  1MS6 A;  1Y4H A;  4RY2 A;  2HXZ A;  4BSQ A;  2NQI A;  2PNS A;  4ZUX U;  2E02 A;  1AYU A;  4W5C A;  1QXP A;  1MDW A;  2FRQ A;  2FRA A;  1MEM A;  3IV2 A;  2BDZ A;  1CQD A;  2WBF X;  3V6E A;  2XU4 A;  1FH0 A;  2FUD A;  1MIR A;  3B79 A;  3OIS A;  2NQG A;  1ICF A;  2GFO A;  1CV8 A;  2YJ9 A;  2F7D A;  1AU0 A;  2BDL A;  1KFU L;  1VSN A;  2R6N A;  3N4C A;  1U9W A;  1STF E;  1NPZ A;  4OEM A;  1POP A;  2DC7 A;  1ME4 A;  3H8C A;  3F5V A;  1DF0 A;  1CTE A;  2XU3 A;  3V6C A;  3MOR A;  1IWD A;  4MSX A;  1DEU A;  1U9X A;  3WXF A;  1Q6K A;  4I04 A;  1BP4 A;  1QMY A;  3P5V A;  1EWM A;  1AU2 A;  2P7U A;  1QOL A;  2NQA A;  1CB5 A;  2PRE A;  9PAP A;  3KWB X;  5EGW A;  1AEC A;  2YJB A;  2AUZ A;  4WA6 A;  4YVA A;  5CVO B;  1O0E A;  2R9O A;  2PAD A;  4QBB A;  1AIM A;  1F2A A;  4CDE B;  3MHH A;  3LXS A;  3DF0 A;  4YV8 A;  1ZIV A;  4PAD A;  5CVM A;  2G7Y A;  1YAL A;  2XU5 A;  3MHS A;  4FK5 A;  4X6J A;  2Y5B A;  3CH3 X;  1MEG A;  3LFY A;  3RVW A;  5F02 A;  3ZUA A;  4HWY A;  3HHI A;  3CH2 X;  2HD5 A;  1PXV A;  2HHN A;  2VHS A;  2GHU A;  1ME3 A;  4X6H A;  4DMY A;  4AXM A;  4CZW A;  3KKU A;  4CDD B;  2FO5 A;  3IUT A;  5JA7 A;  1AU3 A;  2B1M A;  1YVB A;  3PBH A;  2ACT A;  3PDF A;  3NHE A;  2Y6E A;  3I06 A;  1NB3 A;  1PE6 A;  2R9C A;  1YK8 A;  3HD3 A;  3O1G A;  1EWP A;  4BS6 A;  3C9E A;  3WXG A;  2F1G A;  3IEJ A;  2IPP B;  2HH5 A;  2R9F A;  3P5W A;  1AYW A;  4FIP A;  2FT2 A;  1ATK A;  1BQI A;  1GLO A;  1TLO A;  1GMY A;  3N3G A;  3N3K A;  3PNR A;  1YK7 A;  3KX1 A;  5CHV A;  3S3Q A;  1THE A;  3E1Z B;  3P5X A;  2H7J A;  4BPV A;  5PAD A;  3GCB A;  2FTD A;  1ZCM A;  2VHF A;  4CDF B;  3OF8 A;  2DZY A;  1TU6 A;  1PPP A;  1A6R A;  1PAD A;  1CJL A;  3OVX A;  1F2B A;  1ITO A;  2P0R A;  3M99 A;  8PCH A;  1NQC A;  3CBK A;  4N8W A;  2PBH A;  3RVX A;  3OVZ A;  4XR7 A;  2CIO A;  3S3R A;  3TNX A;  4FJC A;  1CSB B;  4BS5 A;  1GCB A;  2ATO A;  1KXR A;  6PAD A;  1AU4 A;  1KHQ A;  1BGO A;  2JQF R;  2XU1 A;  2DC8 A;  3F75 A;  4MZS A;  2YJ2 A;  4CDC B;  3K24 A;  5J94 A;  3QJ3 A;  2AUX A;  3BWK A;  4I05 A;  1BY8 A;  2OZ2 A;  1XKG A;  3H7D A;  2FQ9 A;  1S4V A;  4DMX A;  2DC9 A;  1GEC E;  1PPD A;  1TL9 A;  4X6I A;  2AS8 A;  2AVW A;  4QRX A;  5CVN B;  1EWO A;  3QT4 A;  1MHW A;  3RVV A;  2IBI A;  3KWZ A;  3QSD A;  2G6D A;  2G8E A;  1M6D A;  3HWN A;  1KHP A;  4Q8H A;  4KLB A;  3O0U A;  1NB5 A;  2YJC A;  1SNK A;  1PPN A;  4N4Z A;  3BPM A;  4Q8G A;  1EWL A;  1EF7 A;  2YJ8 A;  2E03 A;  4PI3 A;  2FYE A;  4YYR A;  1U5I A;  3K8U A;  4P6E A;  1JQP A;  2OP3 A;  3H89 A;  2DCA A;  4YYS A;  1AYV A;  1F2C A;  2R9M A;  1PIP A;  3USV A;  2C0Y A;  5FPW A;  3PW3 A;  5A24 A;  4YYQ A;  4P6G A;  1X9Y A;  2JQG R;  4K7C A;  3WXE A;  1U9V A;  2R9N A;  1U9Q X;  4W4U A;  3KSE A;  4AXL A;  2G8J A;  5JH3 A;  4QRV A;  1QDQ A;  1K3B B;  1PPO A;  3AI8 A;  1NL6 A;  3K9M A;  3H8B A;  4YYU A;  5EF4 A;  3HHA A;  2DZZ A;  2AU1 A;  2AYO A;  4MZO A;  1NLJ A;  1F29 A; 
#chains in the Genus database with same CATH topology
 2CB5 A;  3PHU A;  1KFX L;  1YT7 A;  3BC3 A;  3BCN A;  2DCB A;  4OVZ A;  2NQD B;  3BPF A;  4XUI A;  4IP3 A;  5K16 A;  2DCC A;  1CPJ A;  3IMA A;  1HUC B;  2Z84 A;  5CHT A;  4D8B A;  3H6S A;  4I07 A;  2E01 A;  4BOZ A;  2DJF B;  2HWK A;  3I3T A;  3KFQ A;  3P5U A;  4YYV A;  3BOW A;  3C0R A;  4OEL A;  3CBJ A;  4QH6 A;  4QRG A;  2BTW A;  4PP1 A;  1CS8 A;  3ERV A;  2DCD A;  1Y08 A;  4GUA A;  5JZE A;  3IHP A;  4G54 A;  2DJG B;  2B1N A;  2AYN A;  4N79 A;  2ARY A;  1CVZ A;  4W5B A;  4PP2 E;  4BOP A;  5EZS A;  2P86 A;  3OF9 A;  1VJV A;  1PCI A;  2DC6 A;  7PCK A;  4BQV A;  2E00 A;  3W30 A;  4YYW A;  3MTN A;  4RKX A;  2O6X A;  2AIM A;  2OUL A;  3KW9 A;  3W31 A;  1PBH A;  1SP4 B;  3U8E A;  3IOQ A;  3D6S A;  1MS6 A;  4M0W A;  1Y4H A;  4RY2 A;  2HXZ A;  4BSQ A;  2NQI A;  2J7Q A;  3B21 A;  4XZX A;  2PNS A;  4ZUX U;  2E02 A;  2JRI A;  1AYU A;  4W5C A;  1QXP A;  1MDW A;  2FRQ A;  2FRA A;  1MEM A;  3IV2 A;  2BDZ A;  3MTV A;  1CQD A;  2WBF X;  4REZ A;  3V6E A;  2XU4 A;  1FH0 A;  2FUD A;  1MIR A;  3B79 A;  3MP2 A;  3OIS A;  1ICF A;  2NQG A;  2GFO A;  1CV8 A;  2YJ9 A;  2F7D A;  1AU0 A;  2BDL A;  1KFU L;  1VSN A;  2R6N A;  2DOS A;  3N4C A;  1U9W A;  3OQC A;  1STF E;  1NPZ A;  4OEM A;  1POP A;  2DC7 A;  1ME4 A;  3PRM A;  5E6J A;  3H8C A;  3F5V A;  4MM3 B;  1DF0 A;  1CTE A;  2XU3 A;  3V6C A;  3MOR A;  4IUM A;  1IWD A;  4MSX A;  4BOU A;  2J7Q C;  1DEU A;  1U9X A;  3WXF A;  1Q6K A;  4I04 A;  1BP4 A;  1QMY A;  3P5V A;  1EWM A;  3RNV A;  1AU2 A;  2P7U A;  1QOL A;  2NQA A;  1CB5 A;  2PRE A;  9PAP A;  2FE8 A;  3KWB X;  5EZQ A;  5EGW A;  1AEC A;  2YJB A;  2AUZ A;  4WA6 A;  4YVA A;  4RNA A;  5CVO B;  1O0E A;  2R9O A;  2PAD A;  4QBB A;  1AIM A;  1F2A A;  4CDE B;  3MHH A;  1PVJ A;  3LXS A;  3ZNH A;  3DF0 A;  4YV8 A;  1ZIV A;  4PAD A;  5CVM A;  2G7Y A;  1YAL A;  2XU5 A;  3MHS A;  4FK5 A;  4X6J A;  2Y5B A;  3CH3 X;  1MEG A;  3LFY A;  3RVW A;  1YZB A;  5F02 A;  3ZUA A;  4A5U A;  4HWY A;  3HHI A;  3CH2 X;  4R3D A;  2HD5 A;  1PXV A;  2HHN A;  2VHS A;  2GHU A;  1ME3 A;  4X6H A;  4DMY A;  4AXM A;  4CZW A;  3KKU A;  4CDD B;  2FO5 A;  3IUT A;  5JA7 A;  4OW0 A;  1AU3 A;  2B1M A;  1YVB A;  3PBH A;  2ACT A;  3PDF A;  4D8E A;  3NHE A;  2Y6E A;  4D8I A;  3I06 A;  1NB3 A;  1PE6 A;  2BTW B;  2R9C A;  4HXD B;  2JTC A;  1YK8 A;  3HD3 A;  3O1G A;  1EWP A;  4BS6 A;  3C9E A;  3IFU A;  4BOQ A;  3BB7 A;  3WXG A;  2F1G A;  3IEJ A;  2IPP B;  2HH5 A;  2R9F A;  3P5W A;  1AYW A;  4FIP A;  2FT2 A;  1ATK A;  1BQI A;  4MI7 A;  1GLO A;  3PT2 A;  1TLO A;  1GMY A;  3N3G A;  4WUR A;  3N3K A;  3PNR A;  1YK7 A;  3KX1 A;  5CHV A;  3S3Q A;  1THE A;  2UZJ A;  3E1Z B;  3P5X A;  2H7J A;  4BPV A;  5PAD A;  3GCB A;  2FTD A;  3E9S A;  1ZCM A;  2VHF A;  4CDF B;  3OF8 A;  3BBA A;  2DZY A;  4OVZ B;  1TU6 A;  1PPP A;  1A6R A;  1PAD A;  4RF0 A;  1CJL A;  2AGA A;  3OVX A;  1F2B A;  1ITO A;  2P0R A;  3M99 A;  8PCH A;  1NQC A;  3CBK A;  3TRK A;  4N8W A;  2PBH A;  3PSE A;  3RVX A;  3OVZ A;  4XR7 A;  2CIO A;  3S3R A;  3TNX A;  4FJC A;  1CSB B;  4BS5 A;  1GCB A;  2ATO A;  1KXR A;  6PAD A;  1AU4 A;  1KHQ A;  1BGO A;  2JQF R;  4BOS A;  4RF1 A;  2XU1 A;  1UKF A;  2DC8 A;  3F75 A;  4MZS A;  2YJ2 A;  4ZTB A;  4CDC B;  3K24 A;  3MJ5 A;  5J94 A;  3QJ3 A;  2AUX A;  1DKI A;  3BWK A;  4I05 A;  1BY8 A;  2OZ2 A;  1XKG A;  3PHW A;  3PRP A;  3H7D A;  2FQ9 A;  1S4V A;  4DMX A;  2DC9 A;  1GEC E;  1PPD A;  1TL9 A;  4X6I A;  2AS8 A;  2AVW A;  4QRX A;  5CVN B;  1EWO A;  3QT4 A;  1MHW A;  3RVV A;  3PHX A;  2IBI A;  3KWZ A;  3QSD A;  2G6D A;  2G8E A;  1M6D A;  3HWN A;  1KHP A;  4Q8H A;  4KLB A;  3O0U A;  1NB5 A;  2YJC A;  1SNK A;  1PPN A;  3BY4 A;  4N4Z A;  3BPM A;  4Q8G A;  1EWL A;  5KO3 A;  1EF7 A;  3O65 A;  2YJ8 A;  2E03 A;  4PI3 A;  2FYE A;  4YYR A;  1U5I A;  3K8U A;  4P6E A;  1JQP A;  2OP3 A;  3H89 A;  2DCA A;  4YYS A;  1AYV A;  1F2C A;  2R9M A;  1PIP A;  3USV A;  2C0Y A;  3TMP A;  5FPW A;  3PW3 A;  5A24 A;  4YYQ A;  4P6G A;  1X9Y A;  2JQG R;  4K7C A;  3WXE A;  4P16 A;  1U9V A;  2R9N A;  1U9Q X;  4W4U A;  3KSE A;  4AXL A;  2G8J A;  5JH3 A;  4QRV A;  1QDQ A;  1K3B B;  1PPO A;  3AI8 A;  1NL6 A;  2BU3 A;  4PT5 A;  3K9M A;  3H8B A;  4YYU A;  5EF4 A;  3HHA A;  2DZZ A;  2AU1 A;  2AYO A;  4MZO A;  1NLJ A;  1F29 A; 
#chains in the Genus database with same CATH homology
 2CB5 A;  1KFX L;  1YT7 A;  3BC3 A;  3BCN A;  2DCB A;  2NQD B;  3BPF A;  1GX3 A;  4XUI A;  5K16 A;  2DCC A;  1CPJ A;  3IMA A;  1HUC B;  5CHT A;  3H6S A;  4I07 A;  2E01 A;  2DJF B;  3I3T A;  3KFQ A;  3P5U A;  4YYV A;  3BOW A;  4OEL A;  3CBJ A;  4QH6 A;  2VFC A;  4QRG A;  4PP1 A;  1CS8 A;  3ERV A;  2DCD A;  1Y08 A;  3IHP A;  4G54 A;  2DJG B;  2B1N A;  2AYN A;  4N79 A;  2ARY A;  1CVZ A;  4W5B A;  4PP2 E;  2P86 A;  3OF9 A;  1VJV A;  1PCI A;  2DC6 A;  7PCK A;  4BQV A;  2E00 A;  1W6F A;  4YYW A;  3MTN A;  2O6X A;  2AIM A;  2OUL A;  3KW9 A;  1PBH A;  1SP4 B;  3U8E A;  3IOQ A;  3D6S A;  1MS6 A;  1Y4H A;  4RY2 A;  2HXZ A;  4BSQ A;  2NQI A;  2PNS A;  4ZUX U;  2E02 A;  1AYU A;  4W5C A;  1QXP A;  1MDW A;  2FRQ A;  2FRA A;  1MEM A;  4GUZ A;  3IV2 A;  2BDZ A;  3LTW A;  1CQD A;  2WBF X;  3V6E A;  2XU4 A;  1FH0 A;  1W5R A;  2FUD A;  1MIR A;  3B79 A;  3OIS A;  2NQG A;  1ICF A;  2GFO A;  1CV8 A;  2YJ9 A;  2F7D A;  1AU0 A;  2BDL A;  1KFU L;  1VSN A;  2R6N A;  3N4C A;  1U9W A;  1STF E;  1NPZ A;  4OEM A;  1POP A;  2DC7 A;  1ME4 A;  3H8C A;  3F5V A;  1DF0 A;  1CTE A;  2XU3 A;  3V6C A;  3MOR A;  1IWD A;  4MSX A;  1W4T A;  1DEU A;  1U9X A;  3WXF A;  1Q6K A;  4I04 A;  1BP4 A;  1QMY A;  3P5V A;  1EWM A;  1AU2 A;  2P7U A;  1QOL A;  2NQA A;  1CB5 A;  2PRE A;  9PAP A;  3KWB X;  5EGW A;  1AEC A;  2YJB A;  2AUZ A;  4WA6 A;  4YVA A;  5CVO B;  1O0E A;  2R9O A;  2PAD A;  4QBB A;  1AIM A;  1F2A A;  4CDE B;  3MHH A;  3LXS A;  3DF0 A;  4YV8 A;  1ZIV A;  4PAD A;  5CVM A;  2G7Y A;  1YAL A;  2XU5 A;  3MHS A;  4FK5 A;  4X6J A;  2Y5B A;  3CH3 X;  1MEG A;  3LFY A;  3RVW A;  5F02 A;  3ZUA A;  4HWY A;  3HHI A;  3CH2 X;  2HD5 A;  1PXV A;  2HHN A;  2VHS A;  2GHU A;  1ME3 A;  4X6H A;  4DMY A;  2BSZ A;  4AXM A;  4CZW A;  3KKU A;  4CDD B;  2FO5 A;  3IUT A;  5JA7 A;  1AU3 A;  2B1M A;  1YVB A;  3PBH A;  2ACT A;  3PDF A;  3NHE A;  2Y6E A;  3I06 A;  1NB3 A;  1PE6 A;  2R9C A;  1YK8 A;  3HD3 A;  3O1G A;  1EWP A;  4BS6 A;  3C9E A;  3WXG A;  2F1G A;  3IEJ A;  2IPP B;  2HH5 A;  2R9F A;  3P5W A;  1AYW A;  4FIP A;  2FT2 A;  1ATK A;  1BQI A;  1GLO A;  2VFB A;  4BGF A;  1TLO A;  1GMY A;  3N3G A;  3N3K A;  3PNR A;  1YK7 A;  3KX1 A;  5CHV A;  3S3Q A;  1THE A;  3E1Z B;  3P5X A;  2H7J A;  4BPV A;  5PAD A;  3GCB A;  2FTD A;  1ZCM A;  2VHF A;  4CDF B;  3OF8 A;  2DZY A;  1TU6 A;  1PPP A;  1A6R A;  4B55 A;  1PAD A;  1CJL A;  3OVX A;  1F2B A;  1ITO A;  2P0R A;  4C5P A;  3M99 A;  8PCH A;  1NQC A;  3CBK A;  4N8W A;  2PBH A;  3RVX A;  3OVZ A;  4XR7 A;  2CIO A;  3S3R A;  3TNX A;  4FJC A;  1CSB B;  3D9W A;  4BS5 A;  1GCB A;  2ATO A;  1KXR A;  6PAD A;  1AU4 A;  1KHQ A;  1BGO A;  2JQF R;  2XU1 A;  2DC8 A;  3F75 A;  4MZS A;  2YJ2 A;  4CDC B;  3K24 A;  5J94 A;  3QJ3 A;  2AUX A;  3BWK A;  4I05 A;  1BY8 A;  2OZ2 A;  1XKG A;  3H7D A;  2FQ9 A;  1S4V A;  4DMX A;  2DC9 A;  1GEC E;  1PPD A;  1TL9 A;  4X6I A;  2AS8 A;  2AVW A;  4QRX A;  5CVN B;  1EWO A;  3QT4 A;  1MHW A;  3RVV A;  2IBI A;  3KWZ A;  3QSD A;  2G6D A;  2G8E A;  1M6D A;  4NV7 A;  3HWN A;  1KHP A;  4Q8H A;  4KLB A;  3O0U A;  1NB5 A;  2YJC A;  1SNK A;  1PPN A;  4N4Z A;  3BPM A;  4Q8G A;  1EWL A;  1EF7 A;  2YJ8 A;  2E03 A;  4PI3 A;  2FYE A;  4NV8 A;  4YYR A;  1U5I A;  3K8U A;  4P6E A;  1JQP A;  2OP3 A;  3H89 A;  2DCA A;  4YYS A;  1AYV A;  1F2C A;  2R9M A;  1PIP A;  3USV A;  2C0Y A;  5FPW A;  3PW3 A;  5A24 A;  4YYQ A;  1E2T A;  4P6G A;  1X9Y A;  2JQG R;  4K7C A;  3WXE A;  1U9V A;  2R9N A;  1U9Q X;  4W4U A;  3KSE A;  4AXL A;  2G8J A;  5JH3 A;  4QRV A;  1QDQ A;  1K3B B;  1PPO A;  3AI8 A;  1NL6 A;  3K9M A;  3H8B A;  4YYU A;  5EF4 A;  3HHA A;  2DZZ A;  2AU1 A;  2AYO A;  4MZO A;  1NLJ A;  1F29 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...