1U9XA

Crystal structure of the cysteine protease human cathepsin k in complex with the covalent inhibitor nvp-abj688
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
216
structure length
216
Chain Sequence
RAPDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cathepsin K
publication title Novel purine nitrile derived inhibitors of the cysteine protease cathepsin K
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 63
structure length 216
sequence length 216
ec nomenclature ec 3.4.22.38: Cathepsin K.
pdb deposition date 2004-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1u9xA00
2GHUA 2R9NA 2FRAA 2FRQA 4BSQA 1BP4A 3CH3X 4BS5A 2FYEA 3BPFA 2PNSA 4I05A 5CVOB 2G8EA 3OF9A 2P0RA 1PADA 2F7DA 2ARYA 3KW9A 1CV8A 3WXFA 5J94A 2NQIA 7PCKA 3N3KA 3QSDA 1EWPA 1CSBB 1M6DA 1GCBA 4X6HA 3E1ZB 1STFE 1KXRA 1EWOA 3DF0A 4RY2A 1CQDA 2IBIA 4MSXA 1O0EA 1VSNA 2E00A 3RVXA 4N8WA 3MTNA 1PCIA 3OVXA 3OISA 3BC3A 5PADA 4YVAA 3WXEA 2Y6EA 1CS8A 3S3RA 5K16A 4XUIA 1U9XA 3TNXA 1U5IA 1YT7A 1YALA 3O1GA 2YJCA 2R9FA 1NB5A 2PADA 4BQVA 1Y4HA 1QXPA 2C0YA 1MS6A 3PW3A 5CHTA 4W4UA 2WBFX 1NB3A 4OEMA 1KFUL 4YYRA 4YYSA 2OZ2A 3K9MA 2XU4A 1PXVA 1AU4A 1AYVA 1U9WA 1THEA 6PADA 3N4CA 3BWKA 1AECA 5CVMA 3F75A 2JQGR 4YYVA 2AIMA 1X9YA 3MHSA 1ATKA 1PIPA 2DZZA 3IOQA 3KX1A 4I07A 4QRGA 1QOLA 2AYOA 2OP3A 1YVBA 4CDFB 1MEGA 1PE6A 3PBHA 3IHPA 3I3TA 2DCDA 2BDLA 4FK5A 2E03A 3PNRA 3LXSA 1S4VA 4Q8GA 1U9VA 4QBBA 5F02A 1A6RA 4MZOA 5CVNB 1QMYA 5A24A 3P5VA 3S3QA 2R6NA 2VHSA 1ZIVA 3IUTA 4N79A 2YJ2A 4QH6A 3CBJA 1YK7A 2DJGB 3D6SA 4X6IA 1AU3A 2Y5BA 3B79A 4YV8A 1NPZA 2E02A 2DCBA 2HHNA 4FIPA 1MIRA 2G8JA 3OF8A 1PPOA 3C9EA 3HHAA 2DC8A 4W5CA 2F1GA 2E01A 2AVWA 4FJCA 1AYUA 1AU0A 3IV2A 1FH0A 4K7CA 2PBHA 1GMYA 4PP1A 3QT4A 1DF0A 3O0UA 1KHQA 2AYNA 3K24A 4P6EA 2AU1A 4CZWA 2BDZA 2CB5A 2XU1A 1BQIA 3KWZA 1MEMA 3U8EA 1PPPA 2H7JA 3HWNA 4X6JA 3F5VA 4AXMA 3NHEA 3HHIA 4W5BA 1SNKA 3H89A 2ATOA 2AS8A 4YYQA 3GCBA 1VJVA 3H7DA 4KLBA 1ME3A 3USVA 4ZUXU 4N4ZA 3M99A 3P5XA 5FPWA 4CDEB 8PCHA 2DC6A 3KFQA 2NQGA 2XU3A 2IPPB 2AUXA 1K3BB 3KSEA 3BOWA 2DCCA 2B1NA 3PDFA 4DMYA 4MZSA 2DZYA 2O6XA 2FQ9A 3KKUA 3N3GA 2G6DA 4XR7A 4BPVA 1EWLA 1NLJA 3K8UA 2DC7A 3BPMA 2FUDA 2B1MA 3MHHA 1CPJA 5EGWA 4CDDB 1CB5A 1ICFA 1TLOA 1AU2A 1MDWA 1CTEA 3CBKA 3RVVA 3WXGA 1XKGA 3KWBX 3HD3A 1EWMA 2P7UA 2HD5A 2R9MA 1F29A 5EF4A 3BCNA 1HUCB 2ACTA 1F2CA 1PPNA 1TL9A 4YYUA 2HXZA 2OULA 4DMXA 5JH3A 3I06A 3OVZA 4PP2E 4Q8HA 1ME4A 2DCAA 2R9CA 3H8BA 1F2AA 1U9QX 1AYWA 3IEJA 4AXLA 1ITOA 1NQCA 4BS6A 1AIMA 1BGOA 4YYWA 2FO5A 1YK8A 3V6CA 4I04A 1POPA 5JA7A 1SP4B 1ZCMA 1DEUA 1IWDA 1CVZA 1Q6KA 2YJBA 4P6GA 3H6SA 2JQFR 1F2BA 2DC9A 2P86A 1Y08A 2NQDB 2GFOA 1GECE 3V6EA 2YJ9A 4HWYA 3H8CA 2HH5A 3MORA 2G7YA 2FTDA 1KFXL 3P5UA 2CIOA 1BY8A 4WA6A 4CDCB 3AI8A 2NQAA 1PBHA 2PREA 1MHWA 4QRXA 3ZUAA 2VHFA 1TU6A 3LFYA 4OELA 2FT2A 1PPDA 1CJLA 2AUZA 2XU5A 1GLOA 3P5WA 4PI3A 5CHVA 4G54A 2DJFB 3CH2X 1KHPA 1EF7A 3ERVA 3QJ3A 4QRVA 1QDQA 1NL6A 1JQPA 4PADA 2R9OA 3RVWA 2YJ8A 9PAPA 3IMAA
chains in the Genus database with same CATH superfamily
2GHUA 2R9NA 2FRAA 2FRQA 4BSQA 1BP4A 3CH3X 4BS5A 2FYEA 3BPFA 2PNSA 4IUMA 4I05A 5CVOB 2G8EA 3OF9A 2P0RA 1PADA 2F7DA 2ARYA 3KW9A 1CV8A 4ZTBA 3WXFA 5J94A 2NQIA 3PHXA 2HWKA 4OW0A 3N3KA 3QSDA 7PCKA 1EWPA 1CSBB 1M6DA 1GCBA 4X6HA 3E1ZB 3W30A 3MTVA 4BOZA 1STFE 1KXRA 1EWOA 3DF0A 1PVJA 4RY2A 1CQDA 2IBIA 4MSXA 3C0RA 1O0EA 1VSNA 4R3DA 2E00A 4GUAA 3RVXA 5KO3A 4N8WA 3MTNA 4D8BA 1PCIA 3OVXA 3OISA 3BC3A 3BBAA 5PADA 4YVAA 3WXEA 2Y6EA 1CS8A 3S3RA 5K16A 4XUIA 1U9XA 3TNXA 1U5IA 1YT7A 5E6JA 1YALA 3O1GA 2YJCA 2R9FA 1NB5A 2PADA 4BQVA 1Y4HA 1QXPA 2C0YA 1MS6A 3PW3A 5CHTA 4W4UA 4RF0A 2WBFX 1NB3A 4MI7A 3MJ5A 4OEMA 1KFUL 4YYRA 5EZQA 4YYSA 2OZ2A 3K9MA 2XU4A 1PXVA 1AU4A 3RNVA 1AYVA 4M0WA 1U9WA 1THEA 6PADA 3N4CA 3BWKA 1AECA 5CVMA 3F75A 2JQGR 4YYVA 4P16A 4WURA 2AIMA 1X9YA 3MHSA 1ATKA 1PIPA 2DZZA 3IOQA 2BTWA 3KX1A 4I07A 4QRGA 1QOLA 2AYOA 2OP3A 4A5UA 3PHUA 4HXDB 1YVBA 4CDFB 1MEGA 1PE6A 3PBHA 3IHPA 3I3TA 2DCDA 2BDLA 4FK5A 2E03A 3PNRA 3LXSA 1S4VA 4Q8GA 2DOSA 1U9VA 4QBBA 5F02A 1A6RA 4MZOA 5CVNB 1QMYA 5A24A 3P5VA 3S3QA 3ZNHA 2R6NA 2VHSA 1ZIVA 4RF1A 3IUTA 4N79A 2YJ2A 4QH6A 5JZEA 3CBJA 4BOSA 1YK7A 2DJGB 3D6SA 4X6IA 3BY4A 1AU3A 2Y5BA 3B79A 4YV8A 1NPZA 5EZSA 2E02A 2DCBA 2HHNA 3OQCA 4FIPA 1MIRA 2G8JA 3OF8A 1PPOA 3C9EA 3HHAA 2DC8A 4W5CA 2F1GA 2E01A 2AVWA 4MM3B 4FJCA 4BOUA 1AYUA 1AU0A 3IV2A 1FH0A 4K7CA 2PBHA 1GMYA 2JRIA 4PP1A 3QT4A 4PT5A 1DF0A 3O0UA 1KHQA 2AYNA 3MP2A 2AGAA 3TRKA 3K24A 4P6EA 2AU1A 4CZWA 2BDZA 2CB5A 2FE8A 2BTWB 2XU1A 1BQIA 3KWZA 1MEMA 3U8EA 1PPPA 2H7JA 3HWNA 4X6JA 3F5VA 2Z84A 4AXMA 3NHEA 3HHIA 4W5BA 1SNKA 3H89A 2ATOA 2AS8A 4IP3A 4YYQA 3GCBA 1VJVA 3H7DA 4KLBA 1ME3A 3USVA 4ZUXU 4N4ZA 4REZA 3O65A 3M99A 3P5XA 5FPWA 4CDEB 8PCHA 2DC6A 3KFQA 2NQGA 2XU3A 2IPPB 2AUXA 1K3BB 3PHWA 3KSEA 3BOWA 2DCCA 2B1NA 3PDFA 4DMYA 4MZSA 4BOQA 2DZYA 2O6XA 2FQ9A 3KKUA 3N3GA 2G6DA 4XR7A 4BPVA 1EWLA 1NLJA 3K8UA 2DC7A 3W31A 3BPMA 2FUDA 2B1MA 4D8EA 2BU3A 3MHHA 4XZXA 1CPJA 5EGWA 4CDDB 1CB5A 1ICFA 1TLOA 4OVZB 1AU2A 1MDWA 1CTEA 2J7QA 3CBKA 3RVVA 3WXGA 1XKGA 3KWBX 3HD3A 1EWMA 2P7UA 2HD5A 2R9MA 1F29A 5EF4A 3BCNA 1HUCB 2ACTA 1F2CA 1PPNA 1TL9A 4YYUA 2HXZA 2OULA 4DMXA 5JH3A 3I06A 3OVZA 4OVZA 4PP2E 4Q8HA 1ME4A 2DCAA 2R9CA 3H8BA 1F2AA 1U9QX 1AYWA 3IEJA 4AXLA 1ITOA 4RNAA 1NQCA 4BS6A 1AIMA 1BGOA 4YYWA 2FO5A 1YK8A 3V6CA 4I04A 1POPA 5JA7A 1SP4B 1ZCMA 1DEUA 1DKIA 1IWDA 1CVZA 1Q6KA 2YJBA 4P6GA 3H6SA 2JQFR 1F2BA 3PT2A 2DC9A 2P86A 2UZJA 4RKXA 4BOPA 1Y08A 3IFUA 2NQDB 2GFOA 1GECE 3V6EA 2YJ9A 4D8IA 3TMPA 4HWYA 3H8CA 3PSEA 3PRPA 3BB7A 2HH5A 3MORA 2G7YA 2FTDA 1KFXL 1YZBA 3P5UA 2CIOA 1BY8A 3B21A 4WA6A 3E9SA 4CDCB 3AI8A 2JTCA 2NQAA 1PBHA 2PREA 1MHWA 4QRXA 3ZUAA 2VHFA 1TU6A 3LFYA 4OELA 2FT2A 1PPDA 1CJLA 2AUZA 2XU5A 1GLOA 3P5WA 3PRMA 4PI3A 5CHVA 4G54A 2DJFB 3CH2X 1KHPA 1EF7A 2J7QC 3ERVA 3QJ3A 4QRVA 1QDQA 1NL6A 1JQPA 4PADA 2R9OA 3RVWA 2YJ8A 1UKFA 9PAPA 3IMAA
chains in the Genus database with same CATH topology
2GHUA 2R9NA 2FRAA 2FRQA 4BSQA 1BP4A 3CH3X 4BS5A 2FYEA 3BPFA 2PNSA 4I05A 5CVOB 2G8EA 3OF9A 2P0RA 1PADA 2F7DA 2ARYA 3KW9A 1CV8A 4NV8A 3WXFA 5J94A 2NQIA 7PCKA 3N3KA 3QSDA 1EWPA 1CSBB 1M6DA 1GCBA 4X6HA 3E1ZB 1STFE 1KXRA 1EWOA 2BSZA 3DF0A 4RY2A 1CQDA 2IBIA 4MSXA 1O0EA 1VSNA 2E00A 3RVXA 4N8WA 3MTNA 1PCIA 3OVXA 3OISA 3BC3A 5PADA 4YVAA 3WXEA 2Y6EA 4GUZA 1CS8A 3S3RA 5K16A 4XUIA 1U9XA 3TNXA 1U5IA 1YT7A 1YALA 3O1GA 2YJCA 2R9FA 1NB5A 2PADA 4BQVA 1Y4HA 1QXPA 2C0YA 1MS6A 3PW3A 5CHTA 4W4UA 2WBFX 1NB3A 4OEMA 1KFUL 4YYRA 4YYSA 2OZ2A 3K9MA 2XU4A 1PXVA 1AU4A 1AYVA 1U9WA 1THEA 6PADA 3D9WA 3N4CA 3BWKA 1AECA 5CVMA 3F75A 2JQGR 4YYVA 2AIMA 1X9YA 3MHSA 1ATKA 1PIPA 2DZZA 3IOQA 3KX1A 4I07A 4QRGA 1QOLA 1W5RA 2AYOA 2OP3A 1YVBA 4CDFB 1MEGA 1PE6A 3PBHA 3IHPA 3I3TA 2DCDA 2BDLA 1W6FA 4FK5A 2E03A 3PNRA 3LXSA 1S4VA 4Q8GA 1U9VA 4QBBA 5F02A 1A6RA 4MZOA 5CVNB 1QMYA 5A24A 3P5VA 3S3QA 2R6NA 2VHSA 1ZIVA 3IUTA 4N79A 2YJ2A 4QH6A 3LTWA 3CBJA 4BGFA 1YK7A 2DJGB 3D6SA 4X6IA 1AU3A 2Y5BA 3B79A 4YV8A 1NPZA 2E02A 2DCBA 2HHNA 4FIPA 1MIRA 2G8JA 3OF8A 1PPOA 3C9EA 3HHAA 2DC8A 4W5CA 2F1GA 2E01A 2AVWA 4FJCA 1AYUA 1AU0A 3IV2A 1FH0A 4K7CA 2PBHA 1GMYA 4PP1A 3QT4A 1DF0A 3O0UA 1KHQA 2AYNA 3K24A 4P6EA 2AU1A 4CZWA 2BDZA 2CB5A 2XU1A 1BQIA 3KWZA 1MEMA 3U8EA 1PPPA 2H7JA 3HWNA 2VFBA 4X6JA 3F5VA 4AXMA 3NHEA 3HHIA 1E2TA 4W5BA 1SNKA 3H89A 2ATOA 2AS8A 4YYQA 3GCBA 1VJVA 3H7DA 4KLBA 1ME3A 3USVA 4ZUXU 4N4ZA 3M99A 3P5XA 5FPWA 4CDEB 8PCHA 2DC6A 3KFQA 2NQGA 2XU3A 2IPPB 2AUXA 1K3BB 3KSEA 3BOWA 2DCCA 2B1NA 3PDFA 4DMYA 4MZSA 2DZYA 2O6XA 2FQ9A 3KKUA 3N3GA 2G6DA 4XR7A 4BPVA 1EWLA 1NLJA 3K8UA 2DC7A 2VFCA 3BPMA 2FUDA 2B1MA 3MHHA 1CPJA 5EGWA 4CDDB 1CB5A 1ICFA 1TLOA 1AU2A 1MDWA 1CTEA 3CBKA 3RVVA 3WXGA 1XKGA 3KWBX 3HD3A 1EWMA 2P7UA 2HD5A 2R9MA 1F29A 5EF4A 3BCNA 1HUCB 2ACTA 1F2CA 1PPNA 1W4TA 1TL9A 4YYUA 2HXZA 2OULA 4DMXA 5JH3A 3I06A 3OVZA 4PP2E 4Q8HA 1ME4A 2DCAA 2R9CA 3H8BA 1F2AA 1U9QX 1AYWA 3IEJA 4AXLA 4B55A 1ITOA 1NQCA 4BS6A 1AIMA 1BGOA 4YYWA 2FO5A 1YK8A 3V6CA 4NV7A 4I04A 1POPA 5JA7A 1SP4B 1ZCMA 1DEUA 1IWDA 1CVZA 1Q6KA 2YJBA 4P6GA 3H6SA 2JQFR 1F2BA 2DC9A 2P86A 1Y08A 2NQDB 2GFOA 1GECE 3V6EA 2YJ9A 4HWYA 3H8CA 2HH5A 3MORA 2G7YA 2FTDA 1KFXL 3P5UA 2CIOA 1BY8A 4WA6A 1GX3A 4CDCB 3AI8A 2NQAA 1PBHA 2PREA 1MHWA 4QRXA 3ZUAA 2VHFA 1TU6A 3LFYA 4OELA 2FT2A 1PPDA 1CJLA 2AUZA 2XU5A 1GLOA 3P5WA 4PI3A 5CHVA 4G54A 2DJFB 4C5PA 3CH2X 1KHPA 1EF7A 3ERVA 3QJ3A 4QRVA 1QDQA 1NL6A 1JQPA 4PADA 2R9OA 3RVWA 2YJ8A 9PAPA 3IMAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GHU A;  2R9N A;  2FRA A;  2FRQ A;  4BSQ A;  1BP4 A;  3CH3 X;  4BS5 A;  2FYE A;  3BPF A;  2PNS A;  4I05 A;  5CVO B;  2G8E A;  3OF9 A;  2P0R A;  1PAD A;  2F7D A;  2ARY A;  3KW9 A;  1CV8 A;  3WXF A;  5J94 A;  2NQI A;  7PCK A;  3N3K A;  3QSD A;  1EWP A;  1CSB B;  1M6D A;  1GCB A;  4X6H A;  3E1Z B;  1STF E;  1KXR A;  1EWO A;  3DF0 A;  4RY2 A;  1CQD A;  2IBI A;  4MSX A;  1O0E A;  1VSN A;  2E00 A;  3RVX A;  4N8W A;  3MTN A;  1PCI A;  3OVX A;  3OIS A;  3BC3 A;  5PAD A;  4YVA A;  3WXE A;  2Y6E A;  1CS8 A;  3S3R A;  5K16 A;  4XUI A;  1U9X A;  3TNX A;  1U5I A;  1YT7 A;  1YAL A;  3O1G A;  2YJC A;  2R9F A;  1NB5 A;  2PAD A;  4BQV A;  1Y4H A;  1QXP A;  2C0Y A;  1MS6 A;  3PW3 A;  5CHT A;  4W4U A;  2WBF X;  1NB3 A;  4OEM A;  1KFU L;  4YYR A;  4YYS A;  2OZ2 A;  3K9M A;  2XU4 A;  1PXV A;  1AU4 A;  1AYV A;  1U9W A;  1THE A;  6PAD A;  3N4C A;  3BWK A;  1AEC A;  5CVM A;  3F75 A;  2JQG R;  4YYV A;  2AIM A;  1X9Y A;  3MHS A;  1ATK A;  1PIP A;  2DZZ A;  3IOQ A;  3KX1 A;  4I07 A;  4QRG A;  1QOL A;  2AYO A;  2OP3 A;  1YVB A;  4CDF B;  1MEG A;  1PE6 A;  3PBH A;  3IHP A;  3I3T A;  2DCD A;  2BDL A;  4FK5 A;  2E03 A;  3PNR A;  3LXS A;  1S4V A;  4Q8G A;  1U9V A;  4QBB A;  5F02 A;  1A6R A;  4MZO A;  5CVN B;  1QMY A;  5A24 A;  3P5V A;  3S3Q A;  2R6N A;  2VHS A;  1ZIV A;  3IUT A;  4N79 A;  2YJ2 A;  4QH6 A;  3CBJ A;  1YK7 A;  2DJG B;  3D6S A;  4X6I A;  1AU3 A;  2Y5B A;  3B79 A;  4YV8 A;  1NPZ A;  2E02 A;  2DCB A;  2HHN A;  4FIP A;  1MIR A;  2G8J A;  3OF8 A;  1PPO A;  3C9E A;  3HHA A;  2DC8 A;  4W5C A;  2F1G A;  2E01 A;  2AVW A;  4FJC A;  1AYU A;  1AU0 A;  3IV2 A;  1FH0 A;  4K7C A;  2PBH A;  1GMY A;  4PP1 A;  3QT4 A;  1DF0 A;  3O0U A;  1KHQ A;  2AYN A;  3K24 A;  4P6E A;  2AU1 A;  4CZW A;  2BDZ A;  2CB5 A;  2XU1 A;  1BQI A;  3KWZ A;  1MEM A;  3U8E A;  1PPP A;  2H7J A;  3HWN A;  4X6J A;  3F5V A;  4AXM A;  3NHE A;  3HHI A;  4W5B A;  1SNK A;  3H89 A;  2ATO A;  2AS8 A;  4YYQ A;  3GCB A;  1VJV A;  3H7D A;  4KLB A;  1ME3 A;  3USV A;  4ZUX U;  4N4Z A;  3M99 A;  3P5X A;  5FPW A;  4CDE B;  8PCH A;  2DC6 A;  3KFQ A;  2NQG A;  2XU3 A;  2IPP B;  2AUX A;  1K3B B;  3KSE A;  3BOW A;  2DCC A;  2B1N A;  3PDF A;  4DMY A;  4MZS A;  2DZY A;  2O6X A;  2FQ9 A;  3KKU A;  3N3G A;  2G6D A;  4XR7 A;  4BPV A;  1EWL A;  1NLJ A;  3K8U A;  2DC7 A;  3BPM A;  2FUD A;  2B1M A;  3MHH A;  1CPJ A;  5EGW A;  4CDD B;  1CB5 A;  1ICF A;  1TLO A;  1AU2 A;  1MDW A;  1CTE A;  3CBK A;  3RVV A;  3WXG A;  1XKG A;  3KWB X;  3HD3 A;  1EWM A;  2P7U A;  2HD5 A;  2R9M A;  1F29 A;  5EF4 A;  3BCN A;  1HUC B;  2ACT A;  1F2C A;  1PPN A;  1TL9 A;  4YYU A;  2HXZ A;  2OUL A;  4DMX A;  5JH3 A;  3I06 A;  3OVZ A;  4PP2 E;  4Q8H A;  1ME4 A;  2DCA A;  2R9C A;  3H8B A;  1F2A A;  1U9Q X;  1AYW A;  3IEJ A;  4AXL A;  1ITO A;  1NQC A;  4BS6 A;  1AIM A;  1BGO A;  4YYW A;  2FO5 A;  1YK8 A;  3V6C A;  4I04 A;  1POP A;  5JA7 A;  1SP4 B;  1ZCM A;  1DEU A;  1IWD A;  1CVZ A;  1Q6K A;  2YJB A;  4P6G A;  3H6S A;  2JQF R;  1F2B A;  2DC9 A;  2P86 A;  1Y08 A;  2NQD B;  2GFO A;  1GEC E;  3V6E A;  2YJ9 A;  4HWY A;  3H8C A;  2HH5 A;  3MOR A;  2G7Y A;  2FTD A;  1KFX L;  3P5U A;  2CIO A;  1BY8 A;  4WA6 A;  4CDC B;  3AI8 A;  2NQA A;  1PBH A;  2PRE A;  1MHW A;  4QRX A;  3ZUA A;  2VHF A;  1TU6 A;  3LFY A;  4OEL A;  2FT2 A;  1PPD A;  1CJL A;  2AUZ A;  2XU5 A;  1GLO A;  3P5W A;  4PI3 A;  5CHV A;  4G54 A;  2DJF B;  3CH2 X;  1KHP A;  1EF7 A;  3ERV A;  3QJ3 A;  4QRV A;  1QDQ A;  1NL6 A;  1JQP A;  4PAD A;  2R9O A;  3RVW A;  2YJ8 A;  9PAP A;  3IMA A; 
#chains in the Genus database with same CATH topology
 2GHU A;  2R9N A;  2FRA A;  2FRQ A;  4BSQ A;  1BP4 A;  3CH3 X;  4BS5 A;  2FYE A;  3BPF A;  2PNS A;  4IUM A;  4I05 A;  5CVO B;  2G8E A;  3OF9 A;  2P0R A;  1PAD A;  2F7D A;  2ARY A;  3KW9 A;  1CV8 A;  4ZTB A;  3WXF A;  5J94 A;  2NQI A;  3PHX A;  2HWK A;  4OW0 A;  3N3K A;  3QSD A;  7PCK A;  1EWP A;  1CSB B;  1M6D A;  1GCB A;  4X6H A;  3E1Z B;  3W30 A;  3MTV A;  4BOZ A;  1STF E;  1KXR A;  1EWO A;  3DF0 A;  1PVJ A;  4RY2 A;  1CQD A;  2IBI A;  4MSX A;  3C0R A;  1O0E A;  1VSN A;  4R3D A;  2E00 A;  4GUA A;  3RVX A;  5KO3 A;  4N8W A;  3MTN A;  4D8B A;  1PCI A;  3OVX A;  3OIS A;  3BC3 A;  3BBA A;  5PAD A;  4YVA A;  3WXE A;  2Y6E A;  1CS8 A;  3S3R A;  5K16 A;  4XUI A;  1U9X A;  3TNX A;  1U5I A;  1YT7 A;  5E6J A;  1YAL A;  3O1G A;  2YJC A;  2R9F A;  1NB5 A;  2PAD A;  4BQV A;  1Y4H A;  1QXP A;  2C0Y A;  1MS6 A;  3PW3 A;  5CHT A;  4W4U A;  4RF0 A;  2WBF X;  1NB3 A;  4MI7 A;  3MJ5 A;  4OEM A;  1KFU L;  4YYR A;  5EZQ A;  4YYS A;  2OZ2 A;  3K9M A;  2XU4 A;  1PXV A;  1AU4 A;  3RNV A;  1AYV A;  4M0W A;  1U9W A;  1THE A;  6PAD A;  3N4C A;  3BWK A;  1AEC A;  5CVM A;  3F75 A;  2JQG R;  4YYV A;  4P16 A;  4WUR A;  2AIM A;  1X9Y A;  3MHS A;  1ATK A;  1PIP A;  2DZZ A;  3IOQ A;  2BTW A;  3KX1 A;  4I07 A;  4QRG A;  1QOL A;  2AYO A;  2OP3 A;  4A5U A;  3PHU A;  4HXD B;  1YVB A;  4CDF B;  1MEG A;  1PE6 A;  3PBH A;  3IHP A;  3I3T A;  2DCD A;  2BDL A;  4FK5 A;  2E03 A;  3PNR A;  3LXS A;  1S4V A;  4Q8G A;  2DOS A;  1U9V A;  4QBB A;  5F02 A;  1A6R A;  4MZO A;  5CVN B;  1QMY A;  5A24 A;  3P5V A;  3S3Q A;  3ZNH A;  2R6N A;  2VHS A;  1ZIV A;  4RF1 A;  3IUT A;  4N79 A;  2YJ2 A;  4QH6 A;  5JZE A;  3CBJ A;  4BOS A;  1YK7 A;  2DJG B;  3D6S A;  4X6I A;  3BY4 A;  1AU3 A;  2Y5B A;  3B79 A;  4YV8 A;  1NPZ A;  5EZS A;  2E02 A;  2DCB A;  2HHN A;  3OQC A;  4FIP A;  1MIR A;  2G8J A;  3OF8 A;  1PPO A;  3C9E A;  3HHA A;  2DC8 A;  4W5C A;  2F1G A;  2E01 A;  2AVW A;  4MM3 B;  4FJC A;  4BOU A;  1AYU A;  1AU0 A;  3IV2 A;  1FH0 A;  4K7C A;  2PBH A;  1GMY A;  2JRI A;  4PP1 A;  3QT4 A;  4PT5 A;  1DF0 A;  3O0U A;  1KHQ A;  2AYN A;  3MP2 A;  2AGA A;  3TRK A;  3K24 A;  4P6E A;  2AU1 A;  4CZW A;  2BDZ A;  2CB5 A;  2FE8 A;  2BTW B;  2XU1 A;  1BQI A;  3KWZ A;  1MEM A;  3U8E A;  1PPP A;  2H7J A;  3HWN A;  4X6J A;  3F5V A;  2Z84 A;  4AXM A;  3NHE A;  3HHI A;  4W5B A;  1SNK A;  3H89 A;  2ATO A;  2AS8 A;  4IP3 A;  4YYQ A;  3GCB A;  1VJV A;  3H7D A;  4KLB A;  1ME3 A;  3USV A;  4ZUX U;  4N4Z A;  4REZ A;  3O65 A;  3M99 A;  3P5X A;  5FPW A;  4CDE B;  8PCH A;  2DC6 A;  3KFQ A;  2NQG A;  2XU3 A;  2IPP B;  2AUX A;  1K3B B;  3PHW A;  3KSE A;  3BOW A;  2DCC A;  2B1N A;  3PDF A;  4DMY A;  4MZS A;  4BOQ A;  2DZY A;  2O6X A;  2FQ9 A;  3KKU A;  3N3G A;  2G6D A;  4XR7 A;  4BPV A;  1EWL A;  1NLJ A;  3K8U A;  2DC7 A;  3W31 A;  3BPM A;  2FUD A;  2B1M A;  4D8E A;  2BU3 A;  3MHH A;  4XZX A;  1CPJ A;  5EGW A;  4CDD B;  1CB5 A;  1ICF A;  1TLO A;  4OVZ B;  1AU2 A;  1MDW A;  1CTE A;  2J7Q A;  3CBK A;  3RVV A;  3WXG A;  1XKG A;  3KWB X;  3HD3 A;  1EWM A;  2P7U A;  2HD5 A;  2R9M A;  1F29 A;  5EF4 A;  3BCN A;  1HUC B;  2ACT A;  1F2C A;  1PPN A;  1TL9 A;  4YYU A;  2HXZ A;  2OUL A;  4DMX A;  5JH3 A;  3I06 A;  3OVZ A;  4OVZ A;  4PP2 E;  4Q8H A;  1ME4 A;  2DCA A;  2R9C A;  3H8B A;  1F2A A;  1U9Q X;  1AYW A;  3IEJ A;  4AXL A;  1ITO A;  4RNA A;  1NQC A;  4BS6 A;  1AIM A;  1BGO A;  4YYW A;  2FO5 A;  1YK8 A;  3V6C A;  4I04 A;  1POP A;  5JA7 A;  1SP4 B;  1ZCM A;  1DEU A;  1DKI A;  1IWD A;  1CVZ A;  1Q6K A;  2YJB A;  4P6G A;  3H6S A;  2JQF R;  1F2B A;  3PT2 A;  2DC9 A;  2P86 A;  2UZJ A;  4RKX A;  4BOP A;  1Y08 A;  3IFU A;  2NQD B;  2GFO A;  1GEC E;  3V6E A;  2YJ9 A;  4D8I A;  3TMP A;  4HWY A;  3H8C A;  3PSE A;  3PRP A;  3BB7 A;  2HH5 A;  3MOR A;  2G7Y A;  2FTD A;  1KFX L;  1YZB A;  3P5U A;  2CIO A;  1BY8 A;  3B21 A;  4WA6 A;  3E9S A;  4CDC B;  3AI8 A;  2JTC A;  2NQA A;  1PBH A;  2PRE A;  1MHW A;  4QRX A;  3ZUA A;  2VHF A;  1TU6 A;  3LFY A;  4OEL A;  2FT2 A;  1PPD A;  1CJL A;  2AUZ A;  2XU5 A;  1GLO A;  3P5W A;  3PRM A;  4PI3 A;  5CHV A;  4G54 A;  2DJF B;  3CH2 X;  1KHP A;  1EF7 A;  2J7Q C;  3ERV A;  3QJ3 A;  4QRV A;  1QDQ A;  1NL6 A;  1JQP A;  4PAD A;  2R9O A;  3RVW A;  2YJ8 A;  1UKF A;  9PAP A;  3IMA A; 
#chains in the Genus database with same CATH homology
 2GHU A;  2R9N A;  2FRA A;  2FRQ A;  4BSQ A;  1BP4 A;  3CH3 X;  4BS5 A;  2FYE A;  3BPF A;  2PNS A;  4I05 A;  5CVO B;  2G8E A;  3OF9 A;  2P0R A;  1PAD A;  2F7D A;  2ARY A;  3KW9 A;  1CV8 A;  4NV8 A;  3WXF A;  5J94 A;  2NQI A;  7PCK A;  3N3K A;  3QSD A;  1EWP A;  1CSB B;  1M6D A;  1GCB A;  4X6H A;  3E1Z B;  1STF E;  1KXR A;  1EWO A;  2BSZ A;  3DF0 A;  4RY2 A;  1CQD A;  2IBI A;  4MSX A;  1O0E A;  1VSN A;  2E00 A;  3RVX A;  4N8W A;  3MTN A;  1PCI A;  3OVX A;  3OIS A;  3BC3 A;  5PAD A;  4YVA A;  3WXE A;  2Y6E A;  4GUZ A;  1CS8 A;  3S3R A;  5K16 A;  4XUI A;  1U9X A;  3TNX A;  1U5I A;  1YT7 A;  1YAL A;  3O1G A;  2YJC A;  2R9F A;  1NB5 A;  2PAD A;  4BQV A;  1Y4H A;  1QXP A;  2C0Y A;  1MS6 A;  3PW3 A;  5CHT A;  4W4U A;  2WBF X;  1NB3 A;  4OEM A;  1KFU L;  4YYR A;  4YYS A;  2OZ2 A;  3K9M A;  2XU4 A;  1PXV A;  1AU4 A;  1AYV A;  1U9W A;  1THE A;  6PAD A;  3D9W A;  3N4C A;  3BWK A;  1AEC A;  5CVM A;  3F75 A;  2JQG R;  4YYV A;  2AIM A;  1X9Y A;  3MHS A;  1ATK A;  1PIP A;  2DZZ A;  3IOQ A;  3KX1 A;  4I07 A;  4QRG A;  1QOL A;  1W5R A;  2AYO A;  2OP3 A;  1YVB A;  4CDF B;  1MEG A;  1PE6 A;  3PBH A;  3IHP A;  3I3T A;  2DCD A;  2BDL A;  1W6F A;  4FK5 A;  2E03 A;  3PNR A;  3LXS A;  1S4V A;  4Q8G A;  1U9V A;  4QBB A;  5F02 A;  1A6R A;  4MZO A;  5CVN B;  1QMY A;  5A24 A;  3P5V A;  3S3Q A;  2R6N A;  2VHS A;  1ZIV A;  3IUT A;  4N79 A;  2YJ2 A;  4QH6 A;  3LTW A;  3CBJ A;  4BGF A;  1YK7 A;  2DJG B;  3D6S A;  4X6I A;  1AU3 A;  2Y5B A;  3B79 A;  4YV8 A;  1NPZ A;  2E02 A;  2DCB A;  2HHN A;  4FIP A;  1MIR A;  2G8J A;  3OF8 A;  1PPO A;  3C9E A;  3HHA A;  2DC8 A;  4W5C A;  2F1G A;  2E01 A;  2AVW A;  4FJC A;  1AYU A;  1AU0 A;  3IV2 A;  1FH0 A;  4K7C A;  2PBH A;  1GMY A;  4PP1 A;  3QT4 A;  1DF0 A;  3O0U A;  1KHQ A;  2AYN A;  3K24 A;  4P6E A;  2AU1 A;  4CZW A;  2BDZ A;  2CB5 A;  2XU1 A;  1BQI A;  3KWZ A;  1MEM A;  3U8E A;  1PPP A;  2H7J A;  3HWN A;  2VFB A;  4X6J A;  3F5V A;  4AXM A;  3NHE A;  3HHI A;  1E2T A;  4W5B A;  1SNK A;  3H89 A;  2ATO A;  2AS8 A;  4YYQ A;  3GCB A;  1VJV A;  3H7D A;  4KLB A;  1ME3 A;  3USV A;  4ZUX U;  4N4Z A;  3M99 A;  3P5X A;  5FPW A;  4CDE B;  8PCH A;  2DC6 A;  3KFQ A;  2NQG A;  2XU3 A;  2IPP B;  2AUX A;  1K3B B;  3KSE A;  3BOW A;  2DCC A;  2B1N A;  3PDF A;  4DMY A;  4MZS A;  2DZY A;  2O6X A;  2FQ9 A;  3KKU A;  3N3G A;  2G6D A;  4XR7 A;  4BPV A;  1EWL A;  1NLJ A;  3K8U A;  2DC7 A;  2VFC A;  3BPM A;  2FUD A;  2B1M A;  3MHH A;  1CPJ A;  5EGW A;  4CDD B;  1CB5 A;  1ICF A;  1TLO A;  1AU2 A;  1MDW A;  1CTE A;  3CBK A;  3RVV A;  3WXG A;  1XKG A;  3KWB X;  3HD3 A;  1EWM A;  2P7U A;  2HD5 A;  2R9M A;  1F29 A;  5EF4 A;  3BCN A;  1HUC B;  2ACT A;  1F2C A;  1PPN A;  1W4T A;  1TL9 A;  4YYU A;  2HXZ A;  2OUL A;  4DMX A;  5JH3 A;  3I06 A;  3OVZ A;  4PP2 E;  4Q8H A;  1ME4 A;  2DCA A;  2R9C A;  3H8B A;  1F2A A;  1U9Q X;  1AYW A;  3IEJ A;  4AXL A;  4B55 A;  1ITO A;  1NQC A;  4BS6 A;  1AIM A;  1BGO A;  4YYW A;  2FO5 A;  1YK8 A;  3V6C A;  4NV7 A;  4I04 A;  1POP A;  5JA7 A;  1SP4 B;  1ZCM A;  1DEU A;  1IWD A;  1CVZ A;  1Q6K A;  2YJB A;  4P6G A;  3H6S A;  2JQF R;  1F2B A;  2DC9 A;  2P86 A;  1Y08 A;  2NQD B;  2GFO A;  1GEC E;  3V6E A;  2YJ9 A;  4HWY A;  3H8C A;  2HH5 A;  3MOR A;  2G7Y A;  2FTD A;  1KFX L;  3P5U A;  2CIO A;  1BY8 A;  4WA6 A;  1GX3 A;  4CDC B;  3AI8 A;  2NQA A;  1PBH A;  2PRE A;  1MHW A;  4QRX A;  3ZUA A;  2VHF A;  1TU6 A;  3LFY A;  4OEL A;  2FT2 A;  1PPD A;  1CJL A;  2AUZ A;  2XU5 A;  1GLO A;  3P5W A;  4PI3 A;  5CHV A;  4G54 A;  2DJF B;  4C5P A;  3CH2 X;  1KHP A;  1EF7 A;  3ERV A;  3QJ3 A;  4QRV A;  1QDQ A;  1NL6 A;  1JQP A;  4PAD A;  2R9O A;  3RVW A;  2YJ8 A;  9PAP A;  3IMA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...